15Q(n<')%:NR2160_A55YFSS!V10#fmkyaffs2image Version: Linux-2.6.35-Google Nand Controller V301, make time: Thu May 8 11:39:10 2014 ..flash%A^jSYjSYjS0mntA^jSjSjS&nfsA^jSjSjS3partRecA^jSjSjS)mtdA^jSjSjS<partStorageA^jSjSjS?languageA^jS]jS]jS*lang_german.xmlQjScSYjS*<root> <Font Name="DejaVu Sans" /> <LanguageName str="Deutsch" /> <LanguageNameEng str="German" /> <Sch_Monitor str="berwachung Zeitplan" /> <Alarm_Monitor str="berwachung Alarme" /> <Week0 str="Sonntag" /> <Week1 str="Montag" /> <Week2 str="Dienstag" /> <Week3 str="Mittwoch" /> <Week4 str="Donnerstag" /> <Week5 str="Freitag" /> <Week6 str="Samstag" /> <WeekS0 str="So" /> <WeekS1 str="Mo" /> <WeekS2 str="Di" /> <WeekS3 str="Mi" /> <WeekS4 str="Do" /> <WeekS5 str="Fr" /> <WeekS6 str="Sa" /> <Disk_Free str="frei" /> <Error str="Fehler" /> <LoginError str="Fehler bei der Anmeldung, Benutzer oder Kennwort falsch" /> <DeviceInfo str="Gerteinformation" /> <DeviceTitle str="Gertename" /> <SoftwareVersion str="Softwareversion" /> <Characters str="Zeichen" /> <DateTimeInfo str="Datum/Zeit Info" /> <CurrentDate str="akt. Datum" /> <CurrentTime str="akt. Zeit" /> <Adjust str="einstellen" /> <Manual str="manuell" /> <SyncNTP str="Synchronisation mit NTP%" /> <Setting str="Einstellung" /> <NTPServer str="NTP Server" /> <Test str="Test" /> <NTPSyncInterval str="Synchronisationsintervall" /> <Hour str="Stunde" /> <Timezone str="Zeitzone" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-03 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, M&id-Atlantic)" /> <Timezone17 str="GMT-01 (Azores, Cap Verde Isl.)" /> <Timezone18 str="GMT (Dublin, Lisbon, London, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berlin, Rome, Stockholm, Warsaw)" /> <Timezone20 str="GMT+02 (Athens, Helsinki, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="GMT+03 (Moscow, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghai, Singap3 ore, Taipei)" /> <Timezone37 str="GMT+09 (Seoul, Osaka, Sapporo, Tokyo)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+12:45 (Chatham Island)" /> <DST str="Sommerzeit" /> <Disable str="deaktivieren" /> <Enable str="aktivieren" /> <DSTStart str="Sommerzeit Anfang" /> <DSTEnd str="Sommerzeit Ende" /> <DSTOffset str="Sommerzeit Differenz" /> <AutoLogin str="autom. Anmeldung" /> <UID str="Benutzername" /> <PWD str="Passwort" /> <System str="System" /> <AutoFullScreen str="autom. Vollbild" /> <Language str="Sprac)he" /> <Audio str="Ton" /> <InputGain str="Eingangsverstrkung" /> <OutputGain str="Ausgangsverstrkung" /> <KeyinNTPAddr str="Bitte geben Sie einen NTP Server an" /> <Success str="erfolgreich" /> <Fault str="fehlgeschlagen" /> <OK str="OK" /> <Cancel str="Abbrechen" /> <SetDateTime str="Datum &amp; Uhrzeit setzen" /> <Date str="Datum" /> <Time str="Zeit" /> <AutoSetting str="autom. Einstellung" /> <CameraName str="Kameraname" /> <ModelName str="Modellname" /> <IPAddress str="IP Adresse" /> <HTTPPort str="HTTP Port" /> <RTSPPort str="RTSP Port" /> <Camera str="Kamera" /> <Schedule str="Zeitplan" /> <Network str="Netzwerk" /> <User str="Benutzer" /> <MotionDetection str="Bewegungserkennung" /> <Snapshot str="Schnappschuss" /> <Maintenance str="Wartung" /> <Add str="hinzufgen" /> <Delete str="lschen" /> <Update str="aktualisieren" /> <Clear str="leeren" /> <Search str="suchen" /> <AutoDetect str="autom. erkennen" /> <Detect str="erkennen" /> <MAC< Address str="MAC Adresse" /> <Configuration str="Konfiguration" /> <Copy str="kopieren" /> <StartTime str="Startzeit" /> <EndTime str="Endzeit" /> <RecordType str="Aufnahmetyp" /> <PreAlarm str="vor Alarm" /> <PostAlarm str="nach Alarm" /> <RTC str="rund um die Uhr" /> <DIDetect str="DI Erkennung" /> <TimeSelErr str="Zeitraum ist nicht korrekt!" /> <NoSelSch str="Bitte whlen Sie einen Zeitplan!" /> <Warning str="Warnung" /> <WeekCopyToAll str="Alle Wochenzeitplne werden gleich gesetzt" /> <DHCP str="IP Adresse automatisch beziehen (DHCP)" /> <SubnetMask str="Subnetzmaske" /> <Gateway str="Gateway" /> <DNS_DHCP str="DNS ber DHCP beziehen" /> <PrimaryDNS str="prim. DNS" /> <SecondaryDNS str="sek. DNS" /> <PPPoE str="PPPoE" /> <Status str="Status" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Server" /> <IPUsed str="Diese Adresse wird bereits verwendet!" /> <IPNoUsed str="Diese Adresse kann genutzt werden" /> <Group str="Gruppe" /> <Descripti? on str="Beschreibung" /> <ConfirmPWD str="Passwort besttigen" /> <LiveView str="Live Ansicht" /> <Playback str="Wiedergabe" /> <Record str="Aufnahme" /> <PTZ str="PTZ" /> <TwoWayAudio str="Zwei-Wege-Audio" /> <CheckConfirmPWD str="Bitte prfen Sie die Wiederholung des Passwortes" /> <UIDEmpty str="Bitte ndern Sie den Benutzernamen" /> <UIDRepeat str="Sie haben den gleichen Benutzernamen angegeben. Bitte korrigieren Sie das." /> <NoSelUID str="Bitte whlen Sie ein Konto" /> <MotionID str="Motion ID" /> <Name str="Name" /> <Included str="eingeschlossen" /> <Excluded str="ausgeschlossen" /> <ObjectSize str="Objektgre" /> <Sensitivity str="Empfindlichkeit" /> <NoSelCamera str="Bitte whlen Sie eine Kamera" /> <OverMaxMotion10 str="Das Maximum ist 10" /> <NoSelMotion str="Bitte whlen Sie eine Bewegung" /> <MotionSettingEnpty str="Bitte definieren Sie erst eine Bewegung" /> <SourceSnapshotList str="Liste Schnappschuss Quellen" /> <SourceSnapshotPreview str="Voransich*t Schnappschuss Quellen" /> <DestinationSnapshotList str="Liste Schnappschuss Ziele" /> <DestinationSnapshotPreview str="Voransicht Schnappschuss Ziele" /> <NoFindSD str="Bitte legen Sie eine SD Karte ein!" /> <NoSelImg str="Bitte whlen Sie ein Bild!" /> <SameSnapshotImgName str="Auf der SD-Karte gibt es schon gleichnamige Dateien. Diese werden berschrieben!" /> <IsAutoSetting str="Wollen Sie die Kamera nun autom. einstellen?" /> <GetParamError str="Fehler beim Abrufen der Parameter!" /> <CameraNameEmpty str="Bitte Kamera Namen eingeben!" /> <IPAddressEmpty str="Bitte IP Adresse eingeben!" /> <UIDEmpty str="Bitte Benutzername angeben!" /> <HttpPortEmpty str="Bitte den HTTP Port angeben!" /> <CameraNameTheSame str="Name der Kamera existiert schon!" /> <CamParam str="Kamera Parameter" /> <Profile str="Profil" /> <FPS str="FPS" /> <Protocol str="Protokoll" /> <EnableAudio str="Ton aktivieren" /> <AudioRecord str="Audio-Aufnahme" /> <InputError str="Fehler (Input)" /> <De*faultSetting str="Voreinstellung" /> <FactoryDefaultSetting str="Werkseinstellung" /> <Default str="Vorgabe" /> <BackupSetting str="Einstellungen Sichern" /> <Backup str="Sicherung" /> <RestoreSetting str="Einstellungen wiederherstellen" /> <Restore str="Wiederherstellung" /> <FirmwareUpgrade str="Firmware Aktualisierung" /> <Upgrade str="Aktualisierung" /> <Browse str="whlen" /> <SystemRestart str="System Neustart" /> <Restart str="Neustart" /> <HDInformation str="Festplatteninformation" /> <SDInformation str="SD Karten Information" /> <TotalCapacity str="Gesamtkapazitt" /> <FreeCapacity str="Freie Kapazitt" /> <UsedCapacity str="Benutze Kapazitt" /> <UsedPercent str="benutzt (%)" /> <Format str="Format" /> <NoFind str="nicht gefunden" /> <NoMount str="nicht gemountet" /> <IsDefaultSetting str="Das System wird vollstndig zurckgesetzt, inkl. der Netzwerkeinstellung. Bitte besttige Sie dies." /> <NoBackupDevice str="Bitte geben Sie ein externes Sicherungsmediu ? m an" /> <NoFindConfigFile str="Kann die Konfiguration nicht finden." /> <ConfigFile str="Konfigurationsdatei" /> <ConfigFileVerErr str="Fehlerhafte Version der Konfigurationsdatei" /> <IsRestart str="System wird neu gestartet. Bitte besttigen" /> <NoFindFirmware str="Kann die Firmware nicht finden." /> <FirmwareFile str="Firmware Datei" /> <IsFormatHD str="Alle Daten werden gelscht. Sicher?" /> <OpenFirmwareUpgradeLogErr str="Kann firmware_upgrade.log nicht ffnen" /> <Playback str="Wiedergabe" /> <PlaybackTime str="Wiedergabe Zeit" /> <Play str="Abspielen" /> <Reverse str="Rckwrts" /> <Pause str="Pause" /> <Wait str="Bitte warten!" /> <Mute str="Stumm" /> <LiveAudio str="Live Ton" /> <PlaybackAudio str="Ton Wiedergeben" /> <ConvertToAvi str="zu AVI konvertieren" /> <NoFindRecord str="Aufnahme nicht gefunden" /> <TimePeriod str="Zeitabschnitt" /> <SaveTo str="Sichern nach" /> <BackupDeviceFull str="Sicherungsmedium evtl. voll. Bitte prfen." /> <SavePath str= < "Sicherungspfad" /> <Login str="Anmeldung" /> <Logout str="Abmeldung" /> <PictureSet str="Bild setzen" /> <Rotation str="Rotation" /> <Normal str="normal" /> <Mirror str="gespiegelt" /> <VerticaFlip str="vertikal gespiegelt" /> <ColorLevel str="Farblevel" /> <Brightness str="Helligkeit" /> <Contrast str="Kontrast" /> <Sharpness str="Schrfe" /> <RateControl str="Rate Control" /> <Quality str="Qualitt" /> <Bitrate str="Bitrate" /> <VideoOffset str="Video Offset" /> <De-Noise str="entrauschen" /> <None str="nichts" /> <Method str="Methode" /> <AutoMode str="Autom. Modus" /> <DayMode str="Tagmodus" /> <NightMode str="Nachtmodus" /> <Base str="Basis" /> <Picture str="Bild" /> <OutOfRange str="Auerhalb des Bereiches" /> <SystemClose str="System wird Heruntergefahren" /> <On str="An" /> <Off str="Aus" /> <Vendor str="Hersteller" /> <ModelName str="Modellname" /> <FriendlyName str="Anzeigename" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str= )"Portbereich" /> <ExternalIPAddress str="externe IP Adresse" /> <Information str="Information" /> <SelOverPlayerMaxCam str="ber %d der Kamera ausgewhlt" /> <Event str="Ereignis" /> <Event_List str="Ereignisliste" /> <Motion str="Bewegung" /> <DI str="digitaler Eingang" /> <DO str="digitaler Ausgang" /> <Event_Schedule_List str="Ereignisplaner Liste" /> <Action_List str="Aktionsliste" /> <Alarm_Trigger_Type str="Alarm Typ" /> <Alarm_Seconds str="Alarm Sekunden" /> <Buzzer str="Buzzer" /> <UnKnow str="unbekannt" /> <Display_On_CH str="Anzeige auf Kanal" /> <Action_Type str="Aktionstyp" /> <ERR_MSG_NO_CAM str="Bitte erst Kamera oder lokal whlen!" /> <ERR_MSG_NO_EVENT str="Bitte erst ein Ereignis whlen!" /> <ERR_MSG_NO_EVENT_SCH str="Bitte erst ein Ereignisplpan whlen!" /> <ERR_MSG_NO_ACTION str="Bitte erst eine Aktion whlen!" /> <ERR_MSG_TIME_PERIOD str="Fehler beim Zeitabschnitt, bitte prfen!" /> <ERR_MSG_TIME_CONFILT str="Konflikt beim Zeitabschnitt, bitte pr 3 fen!" /> <WeekDays str="Wochentag" /> <AlarmSetting str="Alarm Einstellung" /> <AlarmCondition str="Alarm Zustand" /> <Alarm_True str="Alarm aktiv" /> <Alarm_False str="Alarm inaktiv" /> <Alarm_Seconds str="Alarm Sekunden" /> <Alarm_Manual_Stop str="man. Stop" /> <Local str="lokal" /> <DI_Setting str="DI Einstellung" /> <System_Setting str="Systemeinstellung" /> <Log_Viewer str="Ereignisanzeige" /> <Event_Log str="Ereignisprotokoll" /> <Device str="Gert" /> <Log_Type str="Protokolltyp" /> <Motion_Alarm str="Bewegungsalarm" /> <DI_Alarm str="DI Alarm" /> <Input str="Eingang" /> <Limit_Record str="Beschrnkung Aufnahme" /> <Remark str="Hinweis" /> <Total str="Total" /> <HDD_Err_Alarm str="HDD Fehler Alarm" /> <Disconnect_Alarm str="Verbindung unterbrochen Alarm" /> <Schedule_Trigger str="Zeitplan Trigger" /> <Block_Alarm str="Block Alarm" /> <Blur_Alarm str="Blur Alarm" /> <Camera_Move_Alarm str="Kamera Bewegung Alarm" /> <Address_Book str="Adressbuch" />  & <Phone str="Telefon" /> <E_MAIL str="eMail" /> <Notification str="Benachrichtigung" /> <SMTP_Config str="SMTP Einstellung" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="Von" /> <SendMailWithoutPicture str="Mail ohne Bild senden" /> <ServerRequireAuthentication str="Server erfordert Anmeldung" /> <SSL str="Server erfordert sichere Verbindung (SSL)" /> <Send_Test str="Test Senden" /> <FTP_Config str="FTP Einstellung" /> <FTP_Server str="Server" /> <FTP_Port str="Port" /> <Retry str="Wiederholung" /> <RecycleDays str="Tage wiederverwenden" /> <RecycleSize str="Gre wiederverwenden" /> <Path str="Pfad" /> <AllowCreateFolder str="Ordner erstellen zulassen" /> <HTTP_Config str="HTTP Einstellung" /> <HTTP_IP str="IP" /> <HTTP_UID str="Konto" /> <HTTP_PWD str="Passwort" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Adresse" /> <Proxy_UID str="Proxy Konto" /> <Proxy_PWD str="Proxy Passwort" /> <Proxy_Port str="Proxy Port" /> <TCP_Co%nfig str="TCP Einstellung" /> <TCP_Server str="Server" /> <TCP_Port str="Port" /> <Alarm_Config str="Alarm Einstellung" /> <frame str="Bild" /> <SnapshotInterval str="Intervall Schnappschuss" /> <SendInterval str="Sendeintervall" /> <SnapshotTempFolder str="temporrer Ordner" /> <Mail str="Mail" /> <Subject str="Betreff" /> <body str="Body" /> <MS str="MS" /> <second str="Sekunde" /> <EventDetect str="Ereignis Erkennung" /> <EventForceRecord str="Ereignis Aufnahme erzwungen" /> <EventSetting str="Ereignis Einstellung" /> <MergeSeconds str="Sekunden zusammenlegen" /> <Display str="Anzeige" /> <Division str="Aufspalten" /> <FullScreen str="Vollbild" /> <ResetDIVDefault str="Aufspalten zurcksetzen" /> <CancelFullScreen str="Vollbild beenden" /> <Function str="Funktion" /> <SystemManagement str="Systemmanagement" /> <PTZControl str="PTZ Kontrolle" /> <Volume str="Lautstrke" /> <Monitor str="Monitor" /> <CancelMute str="stumm rckgngig" /> <TwoWayAudioON s0 tr="Zwei-Wege-Audio starten" /> <TwoWayAudioOFF str="Zwei-Wege-Audio stoppen" /> <Resolution str="Auflsung" /> <Style str="Style" /> <Simple str="einfach" /> <Professional str="professionell" /> <Output str="Ausgabe" /> <SettoOpen str="setzen zum ffnen" /> <SettoClose str="setzen zum Schlieen" /> <Preset str="Speicher" /> <Zoom str="Zoom" /> <Wide str="Weit" /> <Tele str="Tele" /> <Advanced str="Erweitert" /> <IsDeletePreset str="Klick auf OK wird den Speicher lschen" /> <System_Log str="Systemprotokoll" /> <PTZ_SPEED str="PTZ Geschwindigkeit" /> <PTZ_HOME str="PTZ Grundstellung" /> <PTZ_UP str="PTZ hoch" /> <PTZ_DOWN str="PTZ runter" /> <PTZ_LEFT str="PTZ links" /> <PTZ_RIGHT str="PTZ rechts" /> <PTZ_UP_RIGHT str="PTZ hoch-rechts" /> <PTZ_UP_LEFT str="PTZ hoch-links" /> <PTZ_DOWN_LEFT str="PTZ runter-links" /> <PTZ_DOWN_RIGHT str="PTZ runter-rechts" /> <PTZ_TOUR_GO str="PTZ starte Tour" /> <PTZ_TOUR_STOP str="PTZ stoppe Tour" /> <PTZ_FOCUS_UP str="PTZ Fokus rein" /> <PTZ_FOCUS_DOWN str="PTZ Fokus raus" /> <PTZ_IRIS_UP str="PTZ Iris auf" /> <PTZ_IRIS_DOWN str="PTZ Iris zu" /> <PTZ_FOCUS_AUTO str="PTZ Autofokus" /> <PTZ_IRIS_AUTO str="PTZ autom. Iris" /> <PTZ_AUTOPAN_START str="PTZ start Navigation" /> <PTZ_AUTOPAN_STOP str="PTZ stoppe Navigation" /> <PTZ_ZOOM_IN str="PTZ Hineinzoomen" /> <PTZ_ZOOM_OUT str="PTZ Herauszoomen" /> <SYS_LOG_SYSTEM_INIT str="System Initialisierung" /> <SYS_LOG_SYSTEM_SHUTDOWN str="System Herunterfahren" /> <SYS_LOG_USER_LOGIN str="Benutzer Anmeldung" /> <SYS_LOG_USER_LOGOUT str="Benutzer Abmeldung" /> <SYS_LOG_START_SCH_REC str="Starte geplante Aufnahme" /> <SYS_LOG_END_SCH_REC str="Stoppe geplante Aufnahme" /> <SYS_LOG_START_SCH_ALARM str="Starte Alarmplan" /> <SYS_LOG_END_SCH_ALARM str="Stoppe Alarmplan" /> <SYS_LOG_ENTER_SYS_SETUP str="Systemeinrichtung starten" /> <SYS_LOG_EXIT_SYS_SETUP str="Systemeinrichtung beenden" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Starte Einrichtung Aufnahmez eitplan" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Beende Einrichtung Aufnahmezeitplan" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Starte Einrichtung Alarmplan" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Beende Einrichtung Alarmplan" /> <SYS_LOG_RTSP_GET_CONNECT str="Verbindung herstellen" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Verbindung verloren" /> <SYS_LOG_SERVER_HTTP_START str="starte HTTP Server" /> <SYS_LOG_SERVER_HTTP_STOP str="stoppe HTTP Server" /> <SYS_LOG_SERVER_RTSP_START str="starte RTSP Server" /> <SYS_LOG_SERVER_RTSP_STOP str="stoppe RTSP Server" /> <SYS_LOG_SERVER_RPB_START str="starte entf. Wiedergabeserver" /> <SYS_LOG_SERVER_RPB_STOP str="stoppe entf. Wiedergabeserver" /> <DiskManagement str="Diskmanagement" /> <DeviceType str="Gertetyp" /> <Partition str="Partition" /> <FileSystem str="Dateisystem" /> <IsPartition str="Das System wird die HDD neu partitionieren. Bitte besttigen!" /> <Image str="Bild" /> <Brightness str="Helligkeit" /> <Contrast str="Kontrast" /> <Sa turation str="Sttigung" /> <Sharpness str="Schrfe" /> <Hue str="Farbton" /> <NoSeldesti str="Bitte Ziel whlen" /> <NoSelSource str="Bitte Quelle whlen!" /> <Time_Range str="Bereich Dateialter" /> <Event_Snapshot str="Ereignis Schnappschuss" /> <EventSnapshotViewer str="Ereignis Schnappschussanzeige" /> <Event_Time str="Ereignis Zeit" /> <Event_Type str="Ereignis Typ" /> <Change_Resolution str="Auflsung wurde gendert. Speichern?" /> <Select_All str="Alles auswhlen" /> <InitNetowrk str="Netzwerkmodul initialisiert" /> <InitSystemDate str="Datum/Zeit Modul initialisiert" /> <InitDisk str="Disk Modul initialisiert" /> <InitRTSP str="RTSP Modul initialisiert" /> <NoVideo str="kein Video" /> <Modify str="ndern" /> <DisplayCount str="Anzahl Anzeige" /> <Mount str="Mount" /> <Unmount str="un-mount" /> <EditEmpty str="Bitte prfen Sie, ob die Einstellung stimmt!" /> <Account str="Konto" /> <FindListLog str="ber %d Aufnahmen gefunden, nur die ersten %d Aufnahmen anzeigen " /> <Trigger_Interval_Seconds str="Trigger Intervall Sekunden" /> <Alarm_Always str="Immer Alarm" /> <LowFPS str="niedrige Bitrate FPS" /> <WithFPS str="wie oben" /> <ShowPW str="Passwort zeigen" /> <SelOverMaxPlayHours str="ber %d Stunden auswhlen" /> <SelectedCamera str="ausgewhlte Kamera" /> <Codec str="Codec" /> <Switchto str="wechseln zu" /> <Filter str="Filter" /> <AutoSettingNote str="Bitte geben Sie eine Filterregel ein oder frei lassen um alle zu suchen" /> <TemplateSetting str="Vorlage Einstellung" /> <SearchByEvent str="Suche nach Ereignis" /> <Control str="Kontrolle" /> <SwitchCamera str="Wechsel zu Kamera" /> <Preview str="Voransicht" /> <SequentialSearch str="sequentielle Suche" /> <Split str="Aufteilen" /> <PreSearch str="Pr-Suche" /> <SeekTo str="Suche bis" /> <ShowInformation str="Informationen anzeigen" /> <Bitrate_Log str="Bitrate Protokoll" /> <Save str="Speichern" /> <PlaybackControlPad str="Wiedergabe Kontrollpanel" /> <Format Fault str="Fehlerhaftes Format" /> <LowBitrateSetting str="Einstellung geringe Bitrate" /> <NotConfigured str="nicht konfiguriert" /> <Application str="Anwendung" /> <NameOrMailEmpty str="Name oder eMail leer" /> <ONVIF_Auth str="ONVIF Authentifizierung" /> <PIR_Alarm str="PIR Alarm" /> <CameraTamper str="Kamera Manipulation" /> <AudioDetection str="autom. Erkennung" /> <AutoSwitch str="autom. Wechsel" /> <CancelAutoSwitch str="autom. Wechsel abbrechen" /> <MailRepeat str="Sie haben die gleiche eMail Adresse hinzugefgt. Bitte ndern!" /> <SMART str="S.M.A.R.T." /> <OVERALL str="ber alles" /> <PASSED str="erfolgreich" /> <FAILED str="fehlgeschlagen" /> <Raw_Read_Error_Rate str="Raw Read Error Rate" /> <Throughput_Performance str="Throughput Performance" /> <Spin_Up_Time str="Spin Up Time" /> <Start_Stop_Count str="Start Stop Count" /> <Reallocated_Sector_Ct str="Reallocated Sectors Count" /> <Seek_Error_Rate str="Seek Error Rate" /> <Seek_Time_Performance str="Seek Time Performance" /> <Power_On_Hours str="Power On Hours" /> <Spin_Retry_Count str="Spin Retry Count" /> <Calibration_Retry_Count str="Calibration Retry Count" /> <Power_Cycle_Count str="Power Cycle Count" /> <Power_Off_Retract_Count str="Power Off Retract Count" /> <Load_Cycle_Count str="Load Cycle Count" /> <Temperature_Celsius str="Temperatur Celsius" /> <Reallocated_Event_Count str="Reallocated Event Count" /> <Current_Pending_Sector str="Current Pending Sector" /> <Offline_Uncorrectable str="Offline Uncorrectable" /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="Multi Zone Error Rate" /> <SMART_RAW_VALUE str="Raw Value" /> <SMART_WORST str="Reference" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Anzeigeformat" /> <FitWindow str="anpassen an Fenster" /> <KeepRatio str="Verhltnis beibehalten" /> <Joystick str="Joystick" /> <Joystick_Information str="Joystick Information" /> <Joystick_Model str="Joystick Modell" /> <Axis_Count str="Achsenkontrolle" /> <Button_Count str="Zhler Taster" /> <Axis_X str="Wert x-Achse" /> <Axis_Y str="Wert y-Achse" /> <Axis_Z str="Wert z-Achse" /> <Buttons_Status str="Status Taster" /> <Joystick_Buttons_Setting str="Joystick Tasteneinstellung" /> <Button str="Taster" /> <Next_Division str="nchster Bereich" /> <Previous_Division str="vorheriger Bereich" /> <Next_Window str="nchstes Fenster" /> <Previous_Window str="vorheriges Fenster" /> <Switch_Division_One str="gehe zum ersten Bereich" /> <Axis_Z_ID str="ID z-Achse" /> <RAID_Err_Alarm str="Alarm RAID Fehler" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Verbindung verloren"/> <Con nectFail str="Verbindung fehlgeschlagen"/> <GetSettingValueErr str="Kann die Einstellungen nicht laden!"/> <Refresh str="Bitte aktualisieren"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backup. Bitte warten& "/> <Converting str="Umwandlung. Bitte warten& "/> <ShowDate str="Datum anzeigen"/> <ShowTime str="Zeit anzeigen"/> <Subtitle str="berschrift"/> <PreSecond str="Vorherige Sekunde"/> <PreFrame str="Bild zurck"/> <NextSecond str="Nchste Sekunde"/> <NextFrame str="Nchstes Bild"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Bewegungssuche" /> <TimeSplit str="Zeitaufteilung" /> <ShowDetailWindow str="Details anzeigen" /> <FirstPage str="Erste Seite" /> <PrePage str="Vorherige Seite" /> <NextPage str="Nchste Seite" /> <LastPage str="Letzte Seite" /> <DetailPicture str="Detailbild" /> <SelectTime str="Zeit auswhlen" /> <ErrStartEndTm str="Fehler bei der Startzeit oder Endzeit" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Gesuchtes Bild anzeigen" /> <ShowDetectMark str="Erkennungsmakierung anzeigen" /> <DetectInterval str="Erkennungsintervall." /> <Exit str="Exit" /> <Grayscale str="Grauskalierung" /> <Softness str="Weichzeichnen" /> <Reset str="Reset" /> <Print str="Drucken" /> <RetryAgain str="Versuchen Sie es spter erneut." /> <FirmwareUpgrade_msg str="Firmwareupdate abgeschlossen. Bitte neu verbinden"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Zwei Wege Audio verwenden!"/> <Weekly str="Wchentlich"/> <SAVEAS str="Save As..."/> <Send_To str="Senden an"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Nachricht im Livebild anzeigen"/> <ACTION_DESC_MAIL str="E-Mail senden bei Ereignisalarm"/> <ACTION_DESC_VOICE str="Sound abspielen bei Ereignisalarm"/> <ACTION_DESC_DO str="Digitalen Ausgang nutzen bei Ereignisalarm"/> <ACTION_DESC_FTP str="Bilder auf FTP Server hochladen"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Bilder auf TCP Server hochladen"/> <ACTION_DESC_HTTP str="Bilder auf HTTP Server hochladen"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Bewegungsstatus erkennen"/> <EVENT_DESC_BLOCK str="Kamera Bild verdeckt/blockiert erkennen"/> <EVENT_DESC_BLUR str="Kamera Fokus verndert erkennen"/> <EVENT_DESC_CAM_MOVE str="Kamera verstellt erkennen."/> <EVENT_DESC_DI str="Statusnderung vom digitalen Eingang erkennen"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarmereignis auswhlen"/> <CREATE_NEW_FOLDER str="Neuen Ordner erstellen"/> <CHANGE_NAME str="Namen ndern"/> <TIME_SET_ERROR str="Einstellungsfehler bei der Zeit bitte berprfen."/> <Export str="Export"/> <SEL_VIEW_CH str="Kanalansicht auswhlen"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Start Monitor (alle)"/> <UPDATE_FAIL str="Kann die Einstellungen nicht hochladen, bitte spter versuchen!"/> <DI_REC_TRIGGER str="DI Aufnahmeauslser durch"/> <PASTE str="Einfgen"/> <PASTE_MON_FRI str="Einfgen von Montag bis Freitag"/> <PASTE_SAT_SUN str="Einfgen von Samstag bis Sonntag"/> <PASTE_ALL_CAM str="Einfgen bei allen Kameras"/> <APPLY_ALL str="Alle besttigen"/> <UN_SELECT_ALL str="Alle abbrechen"/> <GET_PARAM_FAIL_USE_DEFAULT str="Gerteerkennung fehlgeschlagen. System nutzt Standardwerte"/> <NO_CAM_NAME str="Kein Kameraname, nutzen St"/> <ERR_SETUP str="Konfiguration sfehler bitt prfen."/> <DEL_CAM_COFIRM str="Sind Sie sicher das Sie die Datei '%s' von der Liste lschen wollen?"/> <ADD_CAM_ERR_ALREADY_HAS str="Es sind '%s' in der Liste. Bitte die Konfiguration berprfen."/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Kamera Live"/> <SHOW_PB_CAM str="Kamera Wiedergabe"/> <DELETE_CAM str="Kamera vom Display entfernen"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str ="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root>3 lang_russian.xmlQjScSYjSN ?<root> <Font Name="unifont" /> <LanguageName str="=3;89A:89" /> <LanguageNameEng str="Russian" /> <Sch_Monitor str=">=8B>@8=3 @0A?8A0=8O" /> <Alarm_Monitor str=">=8B>@8=3 B@52>38" /> <Week0 str=">A:@." /> <Week1 str=">=54-:" /> <Week2 str="B>@=8:" /> <Week3 str="!@540" /> <Week4 str="'5B25@3" /> <Week5 str="OB=8F0" /> <Week6 str="!C11>B0" /> <WeekS0 str="A." /> <WeekS1 str="=." /> <WeekS2 str="B." /> <WeekS3 str="!@." /> <WeekS4 str="'B." /> <WeekS5 str="B." /> <WeekS6 str="!1." /> <Disk_Free str="!2>1>4=>" /> <Error str="H81:0" /> <LoginError str="H81:0 2E>40, =5?@028;L=>5 8<O ?>;L7>20B5;O 8;8 ?0@>;L" /> <DeviceInfo str="=D>@-8O" /> <DeviceTitle str="0720=85 CAB@." /> <SoftwareVersion str="5@A8O " /> <Characters str="!8<2>;" /> <DateTimeInfo str="=D. 40B0/2@5<O" /> <CurrentDate str=""5:CI0O 40B0" /> <CurrentTime str=""5:CI55 2@5<O" /> <Adjust str="#AB-B5" /> <Manual str=" CG=0O" /> <SyncNTP str="!8=E. ! NTP" /> <Setting str 0="0AB@-:8" /> <NTPServer str="NTP A5@25@" /> <Test str=""5AB" /> <NTPSyncInterval str="NTP 8=B5@20; A8=E." /> <Hour str="'0A" /> <Timezone str="@5<. >=0" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (-25=5B>:, 20460;59=)" /> <Timezone3 str="GMT-11 (!0<>0)" /> <Timezone4 str="GMT-10 (02098, ;5CBA:85 >-20)." /> <Timezone5 str="GMT-09 (;OA:0)" /> <Timezone6 str="GMT-08 (0A-530A, !0=-$@0=F8A:>, 0=:C25@0)" /> <Timezone7 str="GMT-07 (0;30@8, 5=25@5, !>;B-59:-!8B8)" /> <Timezone8 str="GMT-06 ('8:03>, 0;;0A, 5E8:>, LN-@;50=)" /> <Timezone9 str="GMT-05 (C10)" /> <Timezone10 str="GMT-05 (LN->@:, ">@>=B>, 0H8=3B>=, >:@C3 >;C<18O)" /> <Timezone11 str="GMT-04 (0@03209)" /> <Timezone12 str="GMT-04 ('8;8)" /> <Timezone13 str="GMT-04 ((0@;>BB0C=, 0=0CA)" /> <Timezone14 str="GMT-03:30 (LND0C=4;5=4)" /> <Timezone15 str="GMT-03 (@078;80, !0=-0C;C)" /> <Timezone16 str="GMT-02 (>@>=LO, Mid-Atlantic)" /> <Timezone17 str="GM 3T-01 (7>@A:85 >AB@>20, 01>-5@45)" /> <Timezone18 str="GMT (C1;8=, 8AA01>=, >=4>=, 59:LO28:)" /> <Timezone19 str="GMT +01 (<AB5@40<, 5@;8=, 8<, !B>:3>;L<, 0@H020)" /> <Timezone20 str="GMT +02 (D8=K, %5;LA8=:8, !B0<1C;, 830)" /> <Timezone21 str="GMT +02 (38?5B)" /> <Timezone22 str="GMT +02 (7@08;L)" /> <Timezone23 str="GMT +02 (820=)" /> <Timezone24 str="GMT +02 (!8@8O)" /> <Timezone25 str="GMT +03 (>A:20, -@- 8O4)" /> <Timezone26 str="GMT +03 (@0:)" /> <Timezone27 str="GMT +03:30 (@0=)" /> <Timezone28 str="GMT +04 (1C-C109, 0:C)" /> <Timezone29 str="GMT +04:30 (01C;)" /> <Timezone30 str="GMT +05 (A;0<0104, 0@0G8, "0H:5=B)" /> <Timezone31 str="GMT +05:30 (><159, 0;L:CBB0, LN-5;8)" /> <Timezone32 str="GMT +05:45 (0B<0=4C)" /> <Timezone33 str="GMT +06 (>2>A818@A:, <A:)" /> <Timezone34 str="GMT +06:30 ( 0=3C=)" /> <Timezone35 str="GMT +07 (0=3:>:, %0=>9, 60:0@B0)" /> <Timezone36 str="GMT +08 (5:8=, >=:>=3, (0=E09, !8=30?C@, "091M9)" /> <Ti & mezone37 str="GMT +09 (!5C;, A0:0, !0??>@>, ">:8>)" /> <Timezone38 str="GMT +09:30 (0@28=)" /> <Timezone39 str="GMT +09:30 (45;0840)" /> <Timezone40 str="GMT +10 (Hobart)" /> <Timezone41 str="GMT +10 (0=15@@0, 5;L1C@=, !84=59)" /> <Timezone42 str="GMT +11 (!>;><>=>2K >-20)." /> <Timezone43 str="GMT +11:30 (>@D>;:)" /> <Timezone44 str="GMT +12 (:;5=4, 5;;8=3B>=)" /> <Timezone45 str="GMT +12 ($8468)" /> <Timezone46 str="GMT +12 (0<G0B:0)" /> <Timezone47 str="GMT +12 (0@H0;;>2K >-20)." /> <Timezone48 str="GMT +13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT +13:45 ('0B5<)" /> <DST str="5B=55 2@5<O" /> <Disable str="50:B82=>" /> <Enable str=":B82=>" /> <DSTStart str="0G0;> ;5B=53> 2@5<5=8" /> <DSTEnd str=">=5F ;5B=53> 2@5<5=8" /> <DSTOffset str="!<5I5=85 2@5<5=8" /> <AutoLogin str="2B. E>4" /> <UID str=">38=" /> <PWD str="0@>;L" /> <System str="!8AB5<0" /> <AutoFullScreen str="0 25AL M:@0=" /> <Language str="/K7:" /> <Audio str="C48>" />  < <InputGain str="E. CA8;5=85" /> <OutputGain str="KE. CA8;5=85" /> <KeyinNTPAddr str="2548B5 04@5A NTP A5@25@0!" /> <Success str="#A?5H=>" /> <Fault str="H81:0" /> <OK str="OK" /> <Cancel str="B<5=0" /> <SetDateTime str="#AB. 40BC/2@5<O" /> <Date str="0B0" /> <Time str="@5<O" /> <AutoSetting str="2B> =0AB@>9:8" /> <CameraName str="<O :0<5@K" /> <ModelName str="<O <>45;8" /> <IPAddress str="IP 04@5A" /> <HTTPPort str="HTTP ?>@B" /> <RTSPPort str="RTSP ?>@B" /> <Camera str="0<5@0" /> <Schedule str=" 0A?8A0=85" /> <Network str="!5BL" /> <User str=".75@" /> <MotionDetection str="5B5:F8O 42865=8O" /> <Snapshot str="!:@8=H>B" /> <Maintenance str="1A;C6820=85" /> <Add str=">1-BL" /> <Delete str="#40;8BL" /> <Update str="1=-BL" /> <Clear str="G8A-BL" /> <Search str=">8A:" /> <AutoDetect str="2B> 45B5:-O" /> <Detect str="5B5:F8O" /> <MACAddress str="MAC 04@5A" /> <Configuration str=">=D83C@0F8O" /> <Copy str=">?8@>20BL" /> <StartTim ) e str="@5<O =0G." /> <EndTime str="@5<O :>=." /> <RecordType str=""8? 70?8A8" /> <PreAlarm str="@54B@52>30" /> <PostAlarm str=">AB@52>30" /> <RTC str="@C3>20O" /> <DIDetect str="DI 45B5:F8O" /> <TimeSelErr str="525@=K9 480?-= 2@5<5=8" /> <NoSelSch str="K15@8B5 >48= 3@0D8:" /> <Warning str="=8<0=85" /> <WeekCopyToAll str="@0D8: =0 =545;N B0:>9 65 :0: 2K1@0==K9" /> <DHCP str=">;CG8BL IP 04@5A 02B><0B8G5A:8(DHCP)" /> <SubnetMask str="0A:0 ?>4A5B8" /> <Gateway str="(;N7" /> <DNS_DHCP str=">;CG8BL DNS >B DHCP" /> <PrimaryDNS str="5@28G=K9 DNS" /> <SecondaryDNS str="B>@8G=K9 DNS" /> <PPPoE str="PPPoE" /> <Status str="!B0BCA" /> <Start str="!B0@B" /> <Stop str="!B>?" /> <Server str="!5@25@" /> <IPUsed str="4@5A 8A?>;L7C5BAO" /> <IPNoUsed str="4@5A <>6=> 8A?>;-BL" /> <Group str="@C??0" /> <Description str="?8A0=85" /> <ConfirmPWD str=">4B25@48B5 ?0@>;L" /> <LiveView str="@>A<>B@" /> <Playback str=">A?@-85" /> <Record str="0?8AL" /> <PTZ * str="PTZ" /> <TwoWayAudio str="2C=0?@->5 0C48>" /> <CheckConfirmPWD str="@>25@LB5 ?0@>;L" /> <UIDEmpty str="7<5=8B5 ;>38=" /> <UIDRepeat str=">38= ACI5AB25B. 7<5=8B5 53>." /> <NoSelUID str="K15@8B5 0::0C=B" /> <MotionID str="2865=85 ID" /> <Name str="<O" /> <Included str=":;." /> <Excluded str="A:;." /> <ObjectSize str=" 07<5@" /> <Sensitivity str="'C2AB-BL" /> <NoSelCamera str="K15@8B5 :0<5@C" /> <OverMaxMotion10 str="0:A. 10 7>= 42865=8O" /> <NoSelMotion str="K15@8B5 7>=C 42865=8O" /> <MotionSettingEnpty str="!=0G0;0 =0AB@>9B5 42865=85" /> <SourceSnapshotList str="!?8A>: A:@8=H>B>2" /> <SourceSnapshotPreview str="@54?@>A<>B@ A:@8=H>B>2" /> <DestinationSnapshotList str=" 0A?>;-85 A?8A:0 A:@8=H>B>2" /> <DestinationSnapshotPreview str="@54?@>A<B>@ A:@8=H>B>2" /> <NoFindSD str="AB02LB5 SD :0@BC" /> <NoSelImg str="K15@8B5 87>1@065=85" /> <SameSnapshotImgName str="$09; A B0:8< 8<5=5< 5AB =0 SD :0@B5. $09; 1C45B 70<5=5=." /> <IsAutoSetting str="K?>;= ?8BL 02B>=0AB@>9:8 :0<5@K?" /> <GetParamError str="H81:0 ?0@0<5B@>2" /> <CameraNameEmpty str="2548B5 8<O :0<5@K" /> <IPAddressEmpty str="2548B5 IP 04@5A" /> <UIDEmpty str="2548B5 ;>38=" /> <HttpPortEmpty str="2548B5 HTTP ?>@B" /> <CameraNameTheSame str=""0:>5 65 8<O :0<5@K" /> <CamParam str="0@0<5B@K :0<5@K" /> <Profile str="@>D8;L" /> <FPS str=":/A" /> <Protocol str="@>B>:>;" /> <EnableAudio str=":B. 0C48>" /> <AudioRecord str="C48> 70?8AL" /> <InputError str="H81:0 22>40" /> <DefaultSetting str="0AB@>9:8 ?> C<>;G0=8N" /> <FactoryDefaultSetting str="02>4A:85 =0AB@>9:8" /> <Default str="> C<>;G0=8N" /> <BackupSetting str="0AB@>9:8 @575@2=>3> :>?8@-8O" /> <Backup str=" 575@2=>5 :>?8@-85" /> <RestoreSetting str="0AB@>9:8 2>AAB0=>2;5=8O" /> <Restore str=">AAB0=>2;5=85" /> <FirmwareUpgrade str="1=>2;5=85 " /> <Upgrade str="1=>2;5=85" /> <Browse str="@>A<>B@" /> <SystemRestart str="5@5703@C7:0 A8AB5<K" /> <Restart str="5@5703@C7:0" /> <HDIn ?formation str="=D. > HDD" /> <SDInformation str="=D. > SD :0@B5" /> <TotalCapacity str="1I89 >1J5<" /> <FreeCapacity str="!2>1>4=K9 >1J5<" /> <UsedCapacity str="A?. 1J5<" /> <UsedPercent str="A?. @>F5=B" /> <Format str="$>@<0B-BL" /> <NoFind str="5 =0945=>" /> <NoMount str="5 CAB0=>2;5=" /> <IsDefaultSetting str="!8AB5<0 CAB0=>28B =0AB@>9:8 ?> C<>;G0=8N, 2:;. A5BL. >4B25@48B5 ?@>F54C@C" /> <NoBackupDevice str="AB02LB5 CAB@>9AB22> @575@2. :>?8@>20=8O" /> <NoFindConfigFile str="$09; :>=D83C@0F88 =5 =0945=" /> <ConfigFile str="$09; :>=D83C@0F88" /> <ConfigFileVerErr str="H81:0 25@A88 D09;0 :>=D83C@0F88." /> <IsRestart str="!8AB5<0 ?5@5703@C78BAO, ?>425@48B5 ?@>F54C@C" /> <NoFindFirmware str="@>H82:0 =5 =0945=0" /> <FirmwareFile str="$09; ?@>H82:8" /> <IsFormatHD str="A5 40==K5 1C4CB ?>B5@O=K, ?@>4>;68BL?" /> <OpenFirmwareUpgradeLogErr str="5 >B:@K205BAO firmware_upgrade.log" /> <Playback str=">A?@-85" /> <PlaybackTime str="@5<O 2>A?@-8O" /> <Play str="0  * ?CA:" /> <Reverse str="1@0B=0O" /> <Pause str="0C70" /> <Wait str=">4>648B5!" /> <Mute str="57 72C:0" /> <LiveAudio str="C48>" /> <PlaybackAudio str="C48> 2>A?@-85" /> <ConvertToAvi str=">=2-BL 2 AVI" /> <NoFindRecord str="0?8AL =5 =0945=0" /> <TimePeriod str="5@8>4 2@5<5=8" /> <SaveTo str="!>E@0=8BL 2" /> <BackupDeviceFull str="#AB@>9AB2> @575@2. :>?8@>20=8O 70?>;=5=>. @>25@LB5" /> <SavePath str="CBL A>E@-8O" /> <Login str=">9B8" /> <Logout str="K9B8" /> <PictureSet str="#AB0=>2:8 87>1@-8O" /> <Rotation str="5@525@=CBL" /> <Normal str="1KG=K9" /> <Mirror str="B>1@078BL" /> <VerticaFlip str="5@B8:0;L=>5 >B>1@-85" /> <ColorLevel str="#@>25=L F25B0" /> <Brightness str="/@:>ABL" /> <Contrast str=">=B@0AB" /> <Sharpness str="'5B:>ABL" /> <RateControl str=">=B@>;L A:>@>AB8" /> <Quality str="0G5AB2>" /> <Bitrate str="8B@59B" /> <VideoOffset str="845> A<5I5=85" /> <De-Noise str=">402;5=85 HC<0" /> <None str="8 >48=" /> <Method str="  ) 5B>4" /> <AutoMode str="C48> @568<" /> <DayMode str=" 568< 45=L" /> <NightMode str=" 568< =>GL" /> <Base str="A=>2=>9" /> <Picture str="7>1@065=85" /> <OutOfRange str="=5 480?>7>=0" /> <SystemClose str="025@H5=<5 @01>BK A8AB5<K" /> <On str=":;." /> <Off str="K:;." /> <Vendor str="@>872>48B5;L" /> <ModelName str="<O <>45;8" /> <FriendlyName str="<O 4>ABC?0" /> <UPnPTraversal str="UPnP >1E>4" /> <PortRange str="80?07>= ?>@B>2" /> <ExternalIPAddress str="=5H=89 IP-04@5A" /> <Information str="=D>@<0F8O" /> <SelOverPlayerMaxCam str="K15@8B5 :0<5@K" /> <Event str="!>1KB85" /> <Event_List str="!?8A>: A>1KB89" /> <Motion str="2865=85" /> <DI str="&8D@>2>9 2E>4" /> <DO str="&8D@>2>9 2KE>4" /> <Event_Schedule_List str="!?8A>: @0D8:0 A>1KB89" /> <Action_List str="!?8A>: 459AB289" /> <Alarm_Trigger_Type str=""8? B@52>38" /> <Alarm_Seconds str="@5<O B@52>38" /> <Buzzer str="C<<5@" /> <UnKnow str="58725AB=K9" /> <Display_On_CH str=">:070BL :0=0;"   </> <Action_Type str=""8? 459AB28O" /> <ERR_MSG_NO_CAM str="K15@8B5 :0<5@C" /> <ERR_MSG_NO_EVENT str="K15@8B5 A=0G0;0 A>1KB85" /> <ERR_MSG_NO_EVENT_SCH str="K15@8B5 A=0G0;0 A>1KB85 87 @0A?8A0=8O" /> <ERR_MSG_NO_ACTION str="2K15@8B5 A=0G0;0 459AB285" /> <ERR_MSG_TIME_PERIOD str="H81:0 =0AB@>9:8 ?5@8>40 2@5<5=8, ?@>25@LB5 =0AB@>9:8" /> <ERR_MSG_TIME_CONFILT str=">=D;8:B =0AB@>9:8 ?5@8>40 2@5<5=8, ?@>25@LB5 =0AB@>9:8!" /> <WeekDays str="=8 =545;8" /> <AlarmSetting str="0AB@>9:8 B@52>38" /> <AlarmCondition str="!>AB>O=85 B@52>38" /> <Alarm_True str="AB8=0 " /> <Alarm_False str=">6L" /> <Alarm_Seconds str="@5<O B@52>38" /> <Alarm_Manual_Stop str=" CG=0O >AB0=>2:0" /> <Local str=">:0;L=K9" /> <DI_Setting str="DI =0AB@>9:8" /> <System_Setting str="0AB@>9:8 A8AB5<K" /> <Log_Viewer str="@>A<>B@ 6C@=0;0" /> <Event_Log str="C@=0; A>1KB89" /> <Device str="#AB@>9AB2>" /> <Log_Type str=""8? 6C@=0;0" /> <Motion_Alarm str="?>25I. 42865=8O" /> <DI_Alarm str="DI >?>25  & I." /> <Input str="E>4=>9" /> <Limit_Record str="@545; 70?8A8" /> <Remark str="><5B:0" /> <Total str="1I89" /> <HDD_Err_Alarm str=""@52>30 >H81:8 HDD" /> <Disconnect_Alarm str=""@52>30 @07J548=5=8O" /> <Schedule_Trigger str=" 0A?8A0=85 B@8335@0" /> <Block_Alarm str=";>: B@52>38" /> <Blur_Alarm str="!83=0; B@52>38" /> <Camera_Move_Alarm str=""@52>30 2>7459AB28O =0 :0<5@C" /> <Address_Book str="4@5A=0O :=830" /> <Phone str=""5;." /> <E_MAIL str="E-Mail" /> <Notification str="#254><;5=85" /> <SMTP_Config str="SMTP =0AB@>9:8" /> <SMTP_Server str="!5@25@" /> <SMTP_Port str=">@B" /> <From str="B" /> <SendMailWithoutPicture str="B?@028BL ?>GBC 157 87>1@065=8O" /> <ServerRequireAuthentication str="!5@25@ 70?@0H8205B 02B>@870F8N" /> <SSL str="!5@25@ 70?@0H8205B 70I8I5==>5 A>548=5=85" /> <Send_Test str=""5AB" /> <FTP_Config str="FTP =0AB@>9:8" /> <FTP_Server str="!5@25@" /> <FTP_Port str=">@B" /> <Retry str=">2B>@8BL" /> <RecycleDays str=">2B>@8BL 4=8" /  3> <RecycleSize str=">2B>@8BL @07<5@" /> <Path str="CBL" /> <AllowCreateFolder str=" 07@5H8BL A>740BL ?0?:C" /> <HTTP_Config str="HTTP =0AB@>9:8" /> <HTTP_IP str="IP" /> <HTTP_UID str="::0C=B" /> <HTTP_PWD str="0@>;L" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="@>:A8 04@5A" /> <Proxy_UID str="@>:A8 0::0C=B" /> <Proxy_PWD str="@>:A8 ?0@>;L" /> <Proxy_Port str="@>:A8 ?>@B" /> <TCP_Config str="0AB@>9:8 TCP" /> <TCP_Server str="!5@25@" /> <TCP_Port str=">@B" /> <Alarm_Config str="0AB@>9:0 B@52>38" /> <frame str="04@" /> <SnapshotInterval str="=B5@20; A:@8=H>B>2" /> <SendInterval str="=B5@20; >B?@02:8" /> <SnapshotTempFolder str="@5<5==0O ?0?:0 A:@8=H>B>2" /> <Mail str=">GB0" /> <Subject str=""5<0" /> <body str="!>>1I5=85" /> <MS str="MS" /> <second str="!5:C=40" /> <EventDetect str="!>1KB85 >1=0@-O" /> <EventForceRecord str="0?8AL ?> A>1KB8N" /> <EventSetting str="0AB@>9:8 A>1KB8O" /> <MergeSeconds str="1J54-85 A5:C=4" /> <Display str 0="B>1@060BL" /> <Division str="5;5=85" /> <FullScreen str=">;=K9 M:@0=" /> <ResetDIVDefault str="!1@>A8BL" /> <CancelFullScreen str="B<5=8BL ?>;=K9 M:@0=" /> <Function str="$C=:F8O" /> <SystemManagement str="#?@02;5=85 A8AB5<>9" /> <PTZControl str="PTZ C?@02-85" /> <Volume str="@><:>ABL" /> <Monitor str="B>1@060BL" /> <CancelMute str=":;. 2C:" /> <TwoWayAudioON str=":;. 42C=0?@->5 0C48>" /> <TwoWayAudioOFF str="K:;. 42C=0?@->5 0C48>" /> <Resolution str=" 07@5H5=85" /> <Style str="!B8;L" /> <Simple str="@>AB>9" /> <Professional str="@>D5AA8>=0;L=K9" /> <Output str="KE>4=>9" /> <SettoOpen str="#AB. =0 >B:@KB85" /> <SettoClose str="#AB. =0 70:@KB85" /> <Preset str="@54CAB0=>2:0" /> <Zoom str="C<" /> <Wide str="@81;878BL" /> <Tele str="B40;8BL" /> <Advanced str=" 0AH8@5==K9" /> <IsDeletePreset str="06<8B5 , GB>1K C40;8BL ?@54CAB0=>2:C" /> <System_Log str="!8AB5<=K9 6C@=0;" /> <PTZ_SPEED str="!:>@>ABL" /> <PTZ_HOME str=" F5=B@" /> <PTZ_ % UP str="25@E" /> <PTZ_DOWN str="=87" /> <PTZ_LEFT str=";52>" /> <PTZ_RIGHT str="?@02>" /> <PTZ_UP_RIGHT str="25@E/2?@02>" /> <PTZ_UP_LEFT str="25@E/2;52>" /> <PTZ_DOWN_LEFT str="=87/2;52>" /> <PTZ_DOWN_RIGHT str="=87/2?@02>" /> <PTZ_TOUR_GO str=""C@ AB0@B" /> <PTZ_TOUR_STOP str=""C@ AB>?" /> <PTZ_FOCUS_UP str="#2. D>:CA" /> <PTZ_FOCUS_DOWN str="#<. D>:CA" /> <PTZ_IRIS_UP str="#2. 480D@0<C" /> <PTZ_IRIS_DOWN str="#<. 480D@0<C" /> <PTZ_FOCUS_AUTO str="2B>D>:CA" /> <PTZ_IRIS_AUTO str="2B>480D@03<0" /> <PTZ_AUTOPAN_START str="0?CA: =02830F88" /> <PTZ_AUTOPAN_STOP str="!B>? =02830F88" /> <PTZ_ZOOM_IN str="#2. 7C<" /> <PTZ_ZOOM_OUT str="#<. 7C<" /> <SYS_LOG_SYSTEM_INIT str="=8F80;-O A8AB5<K" /> <SYS_LOG_SYSTEM_SHUTDOWN str="025@H5=85 @01>BK A8AB5<K" /> <SYS_LOG_USER_LOGIN str="E>4" /> <SYS_LOG_USER_LOGOUT str="KE>4" /> <SYS_LOG_START_SCH_REC str="0G0BL 70?8AL ?> @0A?8A0=8N" /> <SYS_LOG_END_SCH_REC str="025@H8BL 70?8AL ?> @0A?8A0=8N" /> <SYS_LOG_ST ART_SCH_ALARM str=":;. @0A?8A0=85 B@52>38" /> <SYS_LOG_END_SCH_ALARM str="K:;. @0A?8A0=85 B@52>38" /> <SYS_LOG_ENTER_SYS_SETUP str=">9B8 2 A8AB5<=K5 =0AB@>9:8" /> <SYS_LOG_EXIT_SYS_SETUP str="K9B8 87 A8AB5<=KE =0AB@>5:" /> <SYS_LOG_ENTER_SCH_REC_SETUP str=">9B8 2 =0AB@>9:8 70?8A8 ?> @0A?8A0=8N" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="K9B8 87 =0AB@>5: 70?8A8 ?> @0A?8A0=8N" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str=">9B8 2 =0AB@>9:8 @0A?8A0=8O B@52>38 " /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="K9B8 87 =0AB@>5: @0A?8A0=8O B@52>38 " /> <SYS_LOG_RTSP_GET_CONNECT str="!>548=5=85" /> <SYS_LOG_RTSP_LOSE_CONNECT str=">B5@O A>548=5=8O" /> <SYS_LOG_SERVER_HTTP_START str="!B0@B HTTP A5@25@" /> <SYS_LOG_SERVER_HTTP_STOP str="!B>? HTTP A5@25@" /> <SYS_LOG_SERVER_RTSP_START str="!B0@B RTSP A5@25@" /> <SYS_LOG_SERVER_RTSP_STOP str="!B>? RTSP A5@25@" /> <SYS_LOG_SERVER_RPB_START str="!B0@B C40;5==K9 A5@25@ 2>A?@-8O" /> <SYS_LOG_SERVER_RPB_STOP str="!B>? C40;5==K9 A5@25@ 2>A?@-8O" /> <DiskManageme  nt str="#?@02;5=85 HDD" /> <DeviceType str=""8? CAB@>9AB20" /> <Partition str=" 0745;" /> <FileSystem str="$09;-0O A8AB5<0" /> <IsPartition str="!8AB5<0 ?>2B>@=> A>740AB @0745;, ?>4B25@48B5 ?@>F54C@C" /> <Image str="7>1@065=85" /> <Brightness str="/@:>ABL" /> <Contrast str=">=B@0AB" /> <Saturation str="0AKI5==>ABL" /> <Sharpness str="'5B:>ABL" /> <Hue str="BB5=>:" /> <NoSeldesti str="K15@8B5 =0?@02;5=85" /> <NoSelSource str="K15@8B5 A?8A>: 8AB>G=8:0" /> <Time_Range str="$09; 480?-=0 2@5<5=8" /> <Event_Snapshot str="!:@8=H>B A>1KB8O" /> <EventSnapshotViewer str="@>A<>B@ A:@8=H>B0" /> <Event_Time str="@5<O A>1KB8O" /> <Event_Type str=""8? A>1KB8O" /> <Change_Resolution str=" 07@5H5=85 M:@0=0 1K;> 87<5=5=>, 2K E>B8B5 87<5=8BL?" /> <Select_All str="K1@0BL 2A5" /> <InitNetowrk str="=8F80;870F8O A5B8" /> <InitSystemDate str="=8F80;870F8O 40BK/2@5<5=8" /> <InitDisk str="=8F80;870F8O 48A:0" /> <InitRTSP str="=8F80;870F8O RTSP " /> <NoVideo str="5B 2845>" /  > <Modify str="7<5=8BL" /> <DisplayCount str="B>1@060BL" /> <Mount str=">=B8@>20BL" /> <Unmount str=" 07<>=B8@>20BL" /> <EditEmpty str=">4B25@48B5 ?@028;L=>ABL =0AB@>5:" /> <Account str="::0C=B" /> <FindListLog str="0945=> 1>;55 % 4=59 70?8A59, >B>1@060BL B>;L:> ?5@2K5 % 4=O 70?8A8" /> <Trigger_Interval_Seconds str="=B5@20;" /> <Alarm_Always str="A5340 B@52>30" /> <LowFPS str="87:89 18B@59B :/A" /> <WithFPS str="0: 2KH5" /> <ShowPW str=">:070BL ?0@>;L" /> <SelOverMaxPlayHours str="K1@0=> 1>;55 G0A0" /> <SelectedCamera str="K1@0==0O :0<5@0" /> <Codec str=">45:" /> <Switchto str="5@5:;NG8BL" /> <Filter str="$8;LB@" /> <AutoSettingNote str="2548B5 ?@028;0 D8;LB@0F88 8;8 >AB028B5 ?CABK< 4;O ?>8A:0 2A5E 70?8A59" /> <TemplateSetting str="0AB@>9:0 H01;>=0" /> <SearchByEvent str=">8A: ?> A>1KB8N" /> <Control str="#?@02;585" /> <SwitchCamera str="5@5:;NG. 0<5@C" /> <Preview str="@54?@>A<>B@ " /> <SequentialSearch str="Sequential Search" /> <Split s tr="Split" /> <PreSearch str="Pre Search" /> <SeekTo str="Seek To" /> <ShowInformation str="Show Information" /> <Bitrate_Log str="Bitrate Log" /> <Save str="Save" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting"/> <NotConfigured str="Not Configured"/> <Application str="Application"/> <NameOrMailEmpty str="Name or E-Mail is empty"/> <ONVIF_Auth str="ONVIF Authentication"/> <PIR_Alarm str="PIR Alarm"/> <CameraTamper str="Camera Tamper"/> <AudioDetection str="Audio Detection"/> <AutoSwitch str="Auto Switch"/> <CancelAutoSwitch str="Cancel Auto Switch"/> <MailRepeat str="You add the same E-Mail. Please change it!"/> <SMART str="S.M.A.R.T Status"/> <OVERALL str="Over all"/> <PASSED str="PASSED"/> <FAILED str="FAILED"/> <Raw_Read_Error_Rate str="Raw Read Error Rate"/> <Throughput_Performance str="Throughput Performance"/> <Spin_Up_Time str="Spin Up Time"/> <Start_Stop_Count str="S  tart Stop Count"/> <Reallocated_Sector_Ct str="Reallocated Sectors Count"/> <Seek_Error_Rate str="Seek Error Rate"/> <Seek_Time_Performance str="Seek Time Performance"/> <Power_On_Hours str="Power On Hours"/> <Spin_Retry_Count str="Spin Retry Count"/> <Calibration_Retry_Count str="Calibration Retry Count"/> <Power_Cycle_Count str="Power Cycle Count"/> <Power_Off_Retract_Count str="Power Off Retract Count"/> <Load_Cycle_Count str="Load Cycle Count"/> <Temperature_Celsius str="Temperature Celsius"/> <Reallocated_Event_Count str="Reallocated Event Count"/> <Current_Pending_Sector str="Current Pending Sector"/> <Offline_Uncorrectable str="Offline Uncorrectable"/> <UDMA_CRC_Error_Count str="UDMA CRC Error Count"/> <Multi_Zone_Error_Rate str="Multi Zone Error Rate"/> <SMART_RAW_VALUE str="Raw Value"/> <SMART_WORST str="Reference"/> <SMART_Event str="HDD S.M.A.R.T"/> <DisplayRatio str="Display Ratio"/> <FitWindow str="Fit Window"/> <KeepRatio str="Keep Ratio"/> <Joystick   str="Joystick"/> <Joystick_Information str="Joystick Information"/> <Joystick_Model str="Joystick Model"/> <Axis_Count str="Axis Count"/> <Button_Count str="Button Count"/> <Axis_X str="Axis X Value"/> <Axis_Y str="Axis Y Value"/> <Axis_Z str="Axis Z Value"/> <Buttons_Status str="Buttons Status"/> <Joystick_Buttons_Setting str="Joystick Buttons Setting"/> <Button str="Button"/> <Next_Division str="Next Division"/> <Previous_Division str="Previous Division"/> <Next_Window str="Next Window"/> <Previous_Window str="Previous Window"/> <Switch_Division_One str="Switch Division One"/> <Axis_Z_ID str="Axis Z ID"/> <RAID_Err_Alarm str="RAID Error Alarm"/> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware s tr="Invalid Firmware!"/> <ConnectLost str=">B5@O !2O78"/> <ConnectFail str="H81:0 !>548=5=8O"/> <GetSettingValueErr str="52>7<>6=> >;CG8BL =0G5=85 0AB@>9:8!"/> <Refresh str=">60;C9AB0 1=>28B5!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str=" 575@2>=>5 :>?8@>20=85, >60;C9AB0 ?>4>648B5"/> <Converting str=">=25@B0F8O. >60;C9AB0 ?>4>648B5"/> <ShowDate str=">:070BL 0BC"/> <ShowTime str=">:070BL @5<O"/> <Subtitle str="Subtitle"/> <PreSecond str="@54 !5:C=40"/> <PreFrame str="@54 04@"/> <NextSecond str="!;54CNI0O !5:C=40"/> <NextFrame str="!;54CNI89 04@"/> <LowBitrate str="Low Bitrate"/> <DigitalZoom str="&8D@>2>9 C<" /> <MotionSearch str=">8A: 2865=8O" /> <TimeSplit str=" 0745;5=85 @5<5=8" /> <ShowDetailWindow str=">:070BL 5B0;L=>5 :=>" /> <FirstPage str="5@20O !B@0=8F0" /> <PrePage str="@54 !B@0=8F0" /> <NextPage str="!;54CNI0O !B@0=8F0" /> <LastPage str=">A;54=OO !B@0=8F0  " /> <DetailPicture str="5B0;L=>5 7>1@065=85" /> <SelectTime str="K1>@ @5<5=8" /> <ErrStartEndTm str="H81:0 0G0;L=>3> 8;8 >=5G=>3> @5<5=8!" /> <SearchSet str="#AB0=>2:0 >8A:0" /> <ShowSearchImage str=">:070BL 7>1@065=85 >8A:0" /> <ShowDetectMark str=">:070BL =0: 1=0@C65=8O" /> <DetectInterval str="=B5@20; 1=0@C65=8O:" /> <Exit str="KE>4" /> <Grayscale str="BB5=>: !5@>3>" /> <Softness str="O3:89" /> <Reset str="!1@>A" /> <Print str="5G0BL" /> <RetryAgain str=">60;C9AB0 ?>?@>1C9B5 ?>765!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="A?>;L7C5BAO 2C=0?@02;5==>5 C48>"/> <Weekly str="65=545;L=>"/> <SAVEAS str="Save As..."/> <Send_To str="B?@02:0 :"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/>  <ACTION_DESC_DISPLAY str="B>1@065=85 !>>1I5=8O =0 82>< 845"/> <ACTION_DESC_MAIL str="B>A;0BL !>>1I5=85 A @54C?@5645=85< ?@8 !@01>B:8 !>1KB8O!"/> <ACTION_DESC_VOICE str=">A?@>872545=85 "@52>6=>3> 2C:0 ?@8 !@01>B:8 2865=8O"/> <ACTION_DESC_DO str="!@01>B:0 &8D@>2>3> KE>40 ?@8 !@01>B:8 !>1KB8O"/> <ACTION_DESC_FTP str="03@C78BL 04@K =0 FTP A09B"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="1=0@C65=85 701;>:8@>20==>9 :0<5@K"/> <EVENT_DESC_BLUR str="1=0@C65=85 ?>B5@8 D>:CA0 :0<5@K"/> <EVENT_DESC_CAM_MOVE str="1=0@C65=85 =0?@02;5=8O ?5@5<5I5=8O :0<5@K"/> <EVENT_DESC_DI str="1=0@C65=85 AB0BCA0 87<5=5=8O F8D@>2>3> 2E>40"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected "/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="K1>@ !>1KB8O "@52>38"/> <CREATE_NEW_FOLDER str="!>740=85 >2>9 0?:8"/> <CHANGE_NAME str="7<5=5=85 <5=8"/> <TIME_SET_ERROR str="H81:0 CAB0=>2:8 2@5<5=8, ?>60;C9AB0 ?@>25@LB5 =0AB@>9:8 2@5<5=8"/> <Export str="-:A?>@B"/> <SEL_VIEW_CH str="K1@0BL 84 B>1@065=8O 0=0;>2"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="!B0@B A5E >=8B>@>2"/> <UPDATE_FAIL str="52>7<>6=> >1=>28BL =0AB@>9:8, ?>60;C9AB0, ?>?@>1C9B5 A=>20 ?>765!"/> <DI_REC_TRIGGER str="DI 0?8AL ?> !@01>B:5:"/> <PASTE str="AB028BL"/> <PASTE_MON_FRI str="AB028BL A >=545;L=8:0 ?> OB=8FC"/> <PASTE_SAT_SUN str="AB028BL A !C11>BK ?> >A:@5A5=L5"/> <PASTE_ALL_CAM str="AB028BL 4;O 2A5E :0<5@"/> <APPLY_ALL str=">1028BL 4;O 2A5E"/> <UN  _SELECT_ALL str="B<5=8BL A5"/> <GET_PARAM_FAIL_USE_DEFAULT str="H81:0 >;CG5=8O 0@0<5B@>2 #AB@>9AB20, !8AB5<0 1C45B 8A?>;L7>20BL 7=0G5=8O ?> C<>;G0=8N!"/> <NO_CAM_NAME str="5B 8<5=8 :0<5@K, 8A?>;L7>20BL 7=0G5=85 ?> C<>;G0=8N?"/> <ERR_SETUP str="H81:0 =0AB@>9:8 40==KE, ?>60;C9AB0, ?5@5?@>25@LB5"/> <DEL_CAM_COFIRM str="K 65;05B5 C40;8BL '%s' 87 A?8A:0?"/> <ADD_CAM_ERR_ALREADY_HAS str="#65 8<55BAO '%s', ?>60;C9AB0, ?5@5?@>25@LB5 =0AB@>9:8"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str=">:070BL 82>5 7>1@065=85 0<5@K"/> <SHOW_PB_CAM str=">:070BL >A?@>872545=85 0<5@K"/> <DELETE_CAM str="#40;5=85 B>1@065=85 0<5@K"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <  DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo st r="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root> N?lang_korean.xmlQjScSYjSj <<root> <Font Name="unifont" /> <LanguageName str="\m" /> <LanguageNameEng str="Korean" /> <Sch_Monitor str="t Ȳ0" /> <Alarm_Monitor str="LŌ Ȳ0" /> <Week0 str="|ǔ|" /> <Week1 str="Ɣ|" /> <Week2 str="T֔|" /> <Week3 str="”|" /> <Week4 str="|" /> <Week5 str="|" /> <Week6 str="є|" /> <WeekS0 str="|" /> <WeekS1 str="" /> <WeekS2 str="T" /> <WeekS3 str="" /> <WeekS4 str="" /> <WeekS5 str="" /> <WeekS6 str="" /> <Disk_Free str="" /> <Error str="$X" /> <LoginError str="\x (, Ɛ tDŽ  T8 ޹ JŵȲ." /> <DeviceInfo str="X " /> <DeviceTitle str="X tDŽ" /> <SoftwareVersion str="ոƴ " /> <Characters str="Characters" /> <DateTimeInfo str="  " /> <CurrentDate str="֬ " /> <CurrentTime str="֬ " /> <Adjust str="p" /> <Manual str="ٳ" /> <SyncNTP str="NTP  ٳ0T" /> <Setting str="$" /> <NTPServer str="NTP" /> <Test str="LѤ¸" /> <NTPSyncInterval str="NTP ٳ0T " /> <Hour str="" /> <Timezone str="" />  3 <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Azores, Cap Verde Isl.)" /> <Timezone18 str="GMT (Dublin, Lisbon, London, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berlin, Rome, Stockholm, War 0saw)" /> <Timezone20 str="GMT+02 (Athens, Helsinki, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="GMT+03 (Moscow, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)" /> <Timezone37 str="GMT+09 (Seoul, Osaka, Sapporo, Tokyo)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" / % > <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+13:45 (Chatham" /> <DST str="| } " /> <Disable str="D\1" /> <Enable str="\1" /> <DSTStart str="| }  ‘" /> <DSTEnd str="| }  ̸" /> <DSTOffset str="| }  (" /> <AutoLogin str="ٳ \x" /> <UID str="Ɛ tDŽ" /> <PWD str="T8" /> <System str="¤\" /> <AutoFullScreen str="ٳ ȴ Tt" /> <Language str="Ŵ" /> <Audio str="$$" /> <InputGain str="% ij" /> <OutputGain str="% ij" /> <KeyinNTPAddr str="NTP  Ȍ| % X8!" /> <Success str="1" /> <Fault str="(" /> <OK str="U" /> <Cancel str="͌" /> <SetDateTime str="  $" /> <Date str="" /> <Time str=""  ?/> <AutoSetting str="ٳ $" /> <CameraName str="tT| tDŽ" /> <ModelName str="x tDŽ" /> <IPAddress str="IP Ȍ" /> <HTTPPort str="HTTP Ӹ" /> <RTSPPort str="RTSP Ӹ" /> <Camera str="tT|" /> <Schedule str="t" /> <Network str="$l" /> <User str="Ɛ" /> <MotionDetection str="ٳ " /> <Snapshot str=" " /> <Maintenance str=" " /> <Add str="" /> <Delete str="" /> <Update str="ptǸ" /> <Clear str="ɰ0" /> <Search str="" /> <AutoDetect str="ٳ " /> <Detect str="" /> <MACAddress str="MAC Ȍ" /> <Configuration str="Xֽ $" /> <Copy str="" /> <StartTime str="‘ " /> <EndTime str="̸ " /> <RecordType str="yT Ѕ" /> <PreAlarm str="LŌ t" /> <PostAlarm str="LŌ t" /> <RTC str=" yT" /> <DIDetect str="DI " /> <TimeSelErr str=" $ $X!" /> <NoSelSch str="X՘X tD X8!" /> <Warning str="" /> <WeekCopyToAll str=" @ $ ȩ" /> <DHCP str="IP Ȍ ٳ `(DHCP)" /> <SubnetMask str=" 7 ȹl" /> <Gateway str="tǸ t" /> <D * NS_DHCP str="DHCP DNS 0" /> <PrimaryDNS str="0 DNS" /> <SecondaryDNS str="p DNS" /> <PPPoE str="PPPoE" /> <Status str="" /> <Start str="‘" /> <Stop str="" /> <Server str="" /> <IPUsed str="Ȍ  Ȳ!" /> <IPNoUsed str="Ȍ| `  ǵȲ!" /> <Group str="" /> <Description str="$" /> <ConfirmPWD str="T8 Ux" /> <LiveView str=" " /> <Playback str="" /> <Record str="yT" /> <PTZ str="PTZ" /> <TwoWayAudio str=") $$" /> <CheckConfirmPWD str="T8 UxD l X8." /> <UIDEmpty str="Ɛ tDŽD  X8." /> <UIDRepeat str="Ɛ tDŽt t ]  ǵȲ!" /> <NoSelUID str="ĬD X8!" /> <MotionID str="ٳ ID" /> <Name str="tDŽ" /> <Included str="Ŵ" /> <Excluded str="x" /> <ObjectSize str=" l0" /> <Sensitivity str="ij" /> <NoSelCamera str="tT|| X8!" /> <OverMaxMotion10 str="\ ٳ ɔ 10 Ȳ." /> <NoSelMotion str="ٳ | X8." /> <MotionSettingEnpty str="ٳ | < $ X8." /> <SourceSnapshotList str=" ]" /> <SourceSnapshotPreview  ) str="  0" /> <DestinationSnapshotList str="xƥ   ]" /> <DestinationSnapshotPreview str="xƥ   0" /> <NoFindSD str="SD tܴ| X8!" /> <NoSelImg str="t| X8!" /> <SameSnapshotImgName str="SD tܴ ٳ|\ tDŽt ǵȲ. |D iȲ!" /> <IsAutoSetting str="ٳ<\ tT| $D X ȲL?" /> <GetParamError str=" |0 8 $0 $X!" /> <CameraNameEmpty str="tT| tDŽD % X8!" /> <IPAddressEmpty str="IP Ȍ| % X8!" /> <UIDEmpty str="Ɛ tDŽD % X8!" /> <HttpPortEmpty str="HTTP Ӹ| % X8!" /> <CameraNameTheSame str="tT| tDŽt  )Ȳ.!" /> <CamParam str="tT| " /> <Profile str="\ |" /> <FPS str="FPS" /> <Protocol str="\\" /> <EnableAudio str="$$ \1" /> <AudioRecord str="$$ yL" /> <InputError str="% $X" /> <DefaultSetting str="$ 0T" /> <FactoryDefaultSetting str=" 0T" /> <Default str="0" /> <BackupSetting str="$ 1" /> <Backup str="1" /> <RestoreSetting str="$ l" /> <Restore str="l" /> <FirmwareUpgrade str="ƴ tܴ" /> <Upgrade str="tܴ" /> <B <rowse str="" /> <SystemRestart str="¤\ ‘" /> <Restart str="‘" /> <HDInformation str="Xܴl " /> <SDInformation str="SD tܴ " /> <TotalCapacity str="ȴ ɷ" /> <FreeCapacity str="@ ɷ" /> <UsedCapacity str=" ɷ" /> <UsedPercent str=" D(" /> <Format str="g" /> <NoFind str=">D  L" /> <NoMount str="Ű H(" /> <IsDefaultSetting str="$l $D hX $D 0T iȲ." /> <NoBackupDevice str="1 X| Ű X8." /> <NoFindConfigFile str="l1 |D >D  ŵȲ." /> <ConfigFile str="l1 |" /> <ConfigFileVerErr str="l1 |  $X." /> <IsRestart str="¤\D ‘ iȲ. Ux X8." /> <NoFindFirmware str="ƴ| >D  ŵȲ.!" /> <FirmwareFile str="ƴ |" /> <IsFormatHD str=" pt0 )Ȳ. Ĭ X ȲL?" /> <OpenFirmwareUpgradeLogErr str="ƴ tܴ \|  ŵȲ." /> <Playback str="" /> <PlaybackTime str=" " /> <Play str="" /> <Reverse str="\" /> <Pause str="|" /> <Wait str="0!" /> <Mute str="Lnjp" /> <LiveAudio str=" $$" /> <PlaybackAudio str="$$ " />  <<ConvertToAvi str="AVI | X" /> <NoFindRecord str="yT |t ŵȲ." /> <TimePeriod str="0" /> <SaveTo str="ȥ" /> <BackupDeviceFull str="1 XX t q iȲ. UxX8." /> <SavePath str="ȥ \" /> <Login str="\x" /> <Logout str="\D" /> <PictureSet str=" $" /> <Rotation str="" /> <Normal str="" /> <Mirror str="Ȱ " /> <VerticaFlip str="X " /> <ColorLevel str="" /> <Brightness str="0" /> <Contrast str="D" /> <Sharpness str=" ij" /> <RateControl str="ȡ ȴ" /> <Quality str="" /> <Bitrate str="DtǸ" /> <VideoOffset str="D$ " /> <De-Noise str="xtLj " /> <None str="L" /> <Method str=")" /> <AutoMode str="ٳ ܴ" /> <DayMode str=" ܴ" /> <NightMode str="| ܴ" /> <Base str="0" /> <Picture str="" /> <OutOfRange str=" " /> <SystemClose str="¤\ ̸ ..." /> <On str="0" /> <Off str="D0" /> <Vendor str="pȬ" /> <ModelName str="x" /> <FriendlyName str="ļ" /> <UPnPTraversal str="UPnP " /> <PortRange str="Ӹ " />   ) <ExternalIPAddress str="xƀ IP Ȍ" /> <Information str="" /> <SelOverPlayerMaxCam str="%d tT| !" /> <Event str="tǤ" /> <Event_List str="tǤ ]" /> <Motion str="ٳ" /> <DI str="8 %" /> <DO str="8 %" /> <Event_Schedule_List str="tǤ t ]" /> <Action_List str="ٳ ]" /> <Alarm_Trigger_Type str="LŌ Ѕ" /> <Alarm_Seconds str="LŌ " /> " <Buzzer str="L" /> <UnKnow str="L L" /> <Display_On_CH str="D \" /> <Action_Type str="ٳ Ѕ" /> <ERR_MSG_NO_CAM str="tT|| < X8!" /> <ERR_MSG_NO_EVENT str="tǤ| < X8!" /> <ERR_MSG_NO_EVENT_SCH str="tǤ tD < X8!" /> <ERR_MSG_NO_ACTION str="ٳD < X8!" /> <ERR_MSG_TIME_PERIOD str="$ 0t $X ǵȲ. Ux X8!" /> <ERR_MSG_TIME_CONFILT str="$  t ǵȲ. Ux X8!" /> <WeekDays str="" /> <AlarmSetting str="LŌ $" /> <AlarmCondition str="LŌ " /> <Alarm_True str="" /> <Alarm_False str="Hh" /> <Alarm_Seconds str="LŌ " /> <Alarm_Manual_Stop str="ٳ " /> <Local str="\" /> <DI_S  * etting str="DI $" /> <System_Setting str="¤\ $" /> <Log_Viewer str="\ 0" /> <Event_Log str="tǤ \" /> <Device str="X" /> <Log_Type str="\ Ѕ" /> <Motion_Alarm str="ٳ  LŌ" /> <DI_Alarm str="DI LŌ" /> <Input str="%" /> <Limit_Record str="yT \" /> <Remark str="D" /> <Total str="" /> <HDD_Err_Alarm str="HDD $X LŌ" /> <Disconnect_Alarm str="Ű J LŌ" /> <Schedule_Trigger str=" |" /> <Block_Alarm str="( LŌ" /> <Blur_Alarm str="P׼ LŌ" /> <Camera_Move_Alarm str="tT| tٳ LŌ" /> <Address_Book str="Ȍ]" /> <Phone str="T" /> <E_MAIL str="E-Mail" /> <Notification str="T" /> <SMTP_Config str="SMTP $" /> <SMTP_Server str="" /> <SMTP_Port str="Ӹ" /> <From str="" /> <SendMailWithoutPicture str="  t T| 0" /> <ServerRequireAuthentication str=" xǝ" /> <SSL str="SSLxǝ" /> <Send_Test str=" LѤ¸" /> <FTP_Config str="FTP $" /> <FTP_Server str="" /> <FTP_Port str="Ӹ" /> <Retry str="ij" /> <RecycleDays str=" " /> <Recy  ?cleSize str=" l0" /> <Path str="\" /> <AllowCreateFolder str="m T ̹0" /> <HTTP_Config str="HTTP $" /> <HTTP_IP str="IP" /> " <HTTP_UID str="Ĭ" /> <HTTP_PWD str="T8" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Ȍ" /> <Proxy_UID str="Proxy Ĭ" /> <Proxy_PWD str="Proxy T8" /> <Proxy_Port str="Proxy Ӹ" /> <TCP_Config str="TCP $" /> <TCP_Server str="" /> <TCP_Port str="Ӹ" /> <Alarm_Config str="LŌ $" /> <frame str="" /> <SnapshotInterval str="  " /> <SendInterval str="ȡ " /> <SnapshotTempFolder str="  T" /> <Mail str="T|" /> <Subject str="ȩ" /> <body str="" /> <MS str="MS" /> <second str="" /> <EventDetect str="tǤ " /> <EventForceRecord str="tǤ  yT" /> <EventSetting str="tǤ $" /> <MergeSeconds str="Ѽi " /> <Display str=" t" /> <Division str="`" /> <FullScreen str="ȴ Tt" /> <ResetDIVDefault str="` 0T" /> <CancelFullScreen str="ȴ Tt ͌" /> <Function str="0" /> <SystemManagement str  % ="¤\ " /> <PTZControl str="PTZθd" /> <Volume str="h" /> <Monitor str="Ȳ0" /> <CancelMute str="Lnjp ͌" /> <TwoWayAudioON str=") $$ ‘" /> <TwoWayAudioOFF str=") $$ " /> <Resolution str="tij" /> <Style str="|" /> <Simple str="" /> <Professional str="8" /> <Output str="%" /> <SettoOpen str="0 $" /> <SettoClose str="0 $" /> <Preset str="լK" /> <Zoom str=" " /> <Wide str="@tܴ" /> <Tele str="U" /> <Advanced str=" " /> <IsDeletePreset str="OK | tt լKt  )Ȳ." /> <System_Log str="¤\ \" /> <PTZ_SPEED str="PTZ ij" /> <PTZ_HOME str="PTZ H" /> <PTZ_UP str="PTZ \" /> <PTZ_DOWN str="PTZ DŘ\" /> <PTZ_LEFT str="PTZ |ƽ<\" /> <PTZ_RIGHT str="PTZ $x<\" /> <PTZ_UP_RIGHT str="PTZ $x \" /> <PTZ_UP_LEFT str="PTZ |ƽ \" /> <PTZ_DOWN_LEFT str="PTZ |ƽ DŘ\" /> <PTZ_DOWN_RIGHT str="PTZ $x DŘ\" /> <PTZ_TOUR_GO str="PTZ ,Ҵ ‘" /> <PTZ_TOUR_STOP str="PTZ ,Ҵ " /> <PTZ_FOCUS_UP str="PTZ  +" /> <PTZ_FOCUS_DOWN str="PTZ  -" /> <PTZ  0_IRIS_UP str="PTZ Iris " /> <PTZ_IRIS_DOWN str="PTZ Iris " /> <PTZ_FOCUS_AUTO str="PTZ ٳ " /> <PTZ_IRIS_AUTO str="PTZ ٳ Iris" /> <PTZ_AUTOPAN_START str="PTZ $DtX ‘" /> <PTZ_AUTOPAN_STOP str="PTZ $DtX " /> <PTZ_ZOOM_IN str="PTZ x" /> <PTZ_ZOOM_OUT str="PTZ D" /> <SYS_LOG_SYSTEM_INIT str="¤\ 0T" /> <SYS_LOG_SYSTEM_SHUTDOWN str="¤\ D0" /> <SYS_LOG_USER_LOGIN str="Ɛ \x" /> <SYS_LOG_USER_LOGOUT str="Ɛ \D" /> <SYS_LOG_START_SCH_REC str="t yT ‘" /> <SYS_LOG_END_SCH_REC str="t yT " /> <SYS_LOG_START_SCH_ALARM str="LŌ t ‘" /> <SYS_LOG_END_SCH_ALARM str="LŌ t " /> <SYS_LOG_ENTER_SYS_SETUP str="¤\ $ ‘" /> <SYS_LOG_EXIT_SYS_SETUP str="¤\ $ 0" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="T) t $ ‘" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="T) t $ 0" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="LŌ t $ ‘" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="LŌ t $ 0" /> <SYS_LOG_RTSP_GET_CONNECT str="Ű 8$0" /> <SYS_LOG_RTSP_LOSE_CONNECT str=" 3Ű J" /> <SYS_LOG_SERVER_HTTP_START str="HTTP  ‘" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP  " /> <SYS_LOG_SERVER_RTSP_START str="RTSP  ‘" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP  " /> <SYS_LOG_SERVER_RPB_START str="Ʃ  ‘" /> <SYS_LOG_SERVER_RPB_STOP str="Ʃ  " /> <DiskManagement str="l " /> <DeviceType str="X " /> <Partition str=" X" /> <FileSystem str=" | ¤\" /> <IsPartition str=" XD ̹ Ȳ. Ux X8." /> <Image str="" /> <Brightness str="0" /> <Contrast str="D" /> <Saturation str="Dij" /> <Sharpness str=" ij" /> <Hue str="p" /> <NoSeldesti str="| X8!" /> <NoSelSource str=" ]D X8!" /> <Time_Range str=" |  " /> <Event_Snapshot str="tǤ  " /> <EventSnapshotViewer str="tǤ   0" /> <Event_Time str="tǤ " /> <Event_Type str="tǤ Ѕ" /> <Change_Resolution str="Ȳ0 tij| X ȲL?" /> <Select_All str="ȴ " /> <InitNetowrk str="$l ȴ 0T" /> <InitSystemDate str="  ȴ 0T" /> <InitDis & k str="l ȴ 0T" /> <InitRTSP str="RTSP ȴ 0T" /> <NoVideo str="8 L" /> <Modify str="" /> <Display str="\" /> <Mount str="Ű" /> <Unmount str="Ű J0" /> <EditEmpty str="$t ,x Ux X8!" /> <Account str="Ĭ" /> <FindListLog str="%d  tX yT| >XŵȲ , < yT %d|(D) iȲ.." /> <Trigger_Interval_Seconds str="  " /> <Alarm_Always str="m LŌ" /> <LowFPS str="@ DtǸ FPS" /> <WithFPS str="@ t" /> <ShowPW str="T8 0" /> <SelOverMaxPlayHours str="%d  t 1" /> <SelectedCamera str="tT| " /> <Codec str="Tq" /> <Switchto str="X" /> <Filter str="D0" /> <AutoSettingNote str="D0 D % Xp P iȲ." /> <TemplateSetting str="\ տ $" /> <SearchByEvent str="tǤ " /> <Control str="θd" /> <SwitchCamera str="tT| X" /> <Preview str="0" /> <SequentialSearch str="Sequential Search" /> <Split str="Split" /> <PreSearch str="Pre Search" /> <SeekTo str="Seek To" /> <ShowInformation str="Show Information" /> <Bitrate_Log str="Bitrate Log" />  <Save str="Save" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting"/> <NotConfigured str="Not Configured"/> <Application str="Application"/> <NameOrMailEmpty str="Name or E-Mail is empty"/> <ONVIF_Auth str="ONVIF Authentication"/> <PIR_Alarm str="PIR Alarm"/> <CameraTamper str="Camera Tamper"/> <AudioDetection str="Audio Detection"/> <AutoSwitch str="Auto Switch"/> <CancelAutoSwitch str="Cancel Auto Switch"/> <MailRepeat str="You add the same E-Mail. Please change it!"/> <SMART str="S.M.A.R.T Status"/> <OVERALL str="Over all"/> <PASSED str="PASSED"/> <FAILED str="FAILED"/> <Raw_Read_Error_Rate str="Raw Read Error Rate"/> <Throughput_Performance str="Throughput Performance"/> <Spin_Up_Time str="Spin Up Time"/> <Start_Stop_Count str="Start Stop Count"/> <Reallocated_Sector_Ct str="Reallocated Sectors Count"/> <Seek_Error_Rate str="Seek Error Rate"/> <Seek_Time_Performance str="Seek T  ime Performance"/> <Power_On_Hours str="Power On Hours"/> <Spin_Retry_Count str="Spin Retry Count"/> <Calibration_Retry_Count str="Calibration Retry Count"/> <Power_Cycle_Count str="Power Cycle Count"/> <Power_Off_Retract_Count str="Power Off Retract Count"/> <Load_Cycle_Count str="Load Cycle Count"/> <Temperature_Celsius str="Temperature Celsius"/> <Reallocated_Event_Count str="Reallocated Event Count"/> <Current_Pending_Sector str="Current Pending Sector"/> <Offline_Uncorrectable str="Offline Uncorrectable"/> <UDMA_CRC_Error_Count str="UDMA CRC Error Count"/> <Multi_Zone_Error_Rate str="Multi Zone Error Rate"/> <SMART_RAW_VALUE str="Raw Value"/> <SMART_WORST str="Reference"/> <SMART_Event str="HDD S.M.A.R.T"/> <DisplayRatio str="Display Ratio"/> <FitWindow str="Fit Window"/> <KeepRatio str="Keep Ratio"/> <Joystick str="Joystick"/> <Joystick_Information str="Joystick Information"/> <Joystick_Model str="Joystick Model"/> <Axis_Count str="Axis Count"/> <Button_Co  unt str="Button Count"/> <Axis_X str="Axis X Value"/> <Axis_Y str="Axis Y Value"/> <Axis_Z str="Axis Z Value"/> <Buttons_Status str="Buttons Status"/> <Joystick_Buttons_Setting str="Joystick Buttons Setting"/> <Button str="Button"/> <Next_Division str="Next Division"/> <Previous_Division str="Previous Division"/> <Next_Window str="Next Window"/> <Previous_Window str="Previous Window"/> <Switch_Division_One str="Switch Division One"/> <Axis_Z_ID str="Axis Z ID"/> <RAID_Err_Alarm str="RAID Error Alarm"/> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Ű J@"/> <ConnectFail str="Ű ("/> <GetSettingValueErr str="$t ǻ ŵȲ!"/> <Refresh str="\hD X8!" /> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="1. 0$ 8"/> <Converting str="X. 0$ 8"/> <ShowDate str=" t0"/> <ShowTime str=" t0"/> <Subtitle str="Subtitle"/> <PreSecond str="L "/> <PreFrame str="t "/> <NextSecond str="t "/> <NextFrame str="L "/> <LowBitrate str="Low Bitrate"/> <DigitalZoom str="8 " /> <MotionSearch str="ٳ  :" /> <TimeSplit str=" `" /> <ShowDetailWindow str="8 Tt 0" /> <FirstPage str="̘t" /> <PrePage str="t t" /> <NextPage str="L t" /> <LastPage str="ȹɹ t" /> <DetailPicture str="8 " /> <SelectTime str=" " /> <ErrStartEndTm str="‘  ̸  $X ǵȲ." /> <SearchSet str=" $" /> <ShowSearchImage str=" t 0" /> <ShowDetectMark str=" 0" /> <DetectInterval str=":" /> <Exit str="0" /> <Grayscale str="Q1 X" /> <Softness str="ܴ" /> <Reset str="K" /> <Print str="x" /> <RetryAgain str="  ij X8!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str=") L !"/> <Weekly str=""/> <SAVEAS str="Save As..."/> <Send_To str="0"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="լ Tt T \X0"/> <ACTION_DESC_MAIL str="tǤ  T| 0"/> <ACTION_DESC_VOICE str="tǤ 0 LŌ X0"/> <ACTION_DESC_DO str= "tǤ  8 % 8 0"/> <ACTION_DESC_FTP str="FTP \ t 0"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="t ٳ "/> <EVENT_DESC_BLOCK str="tT|  "/> <EVENT_DESC_BLUR str="tT| P׼ "/>  <EVENT_DESC_CAM_MOVE str="tT| tٳ "/> <EVENT_DESC_DI str="8 % "/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="LŌ tǤ "/> <CREATE_NEW_FOLDER str="T ̹0"/> <CHANGE_NAME str="tDŽ "/> <TIME_SET_ERROR str=" $ $X,  $D Uxt 8"/> <Export str="%"/> <SEL_VIEW_CH str="tT| "/> <SYSTEM_UPDATEMESSAGE str= "Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str=" Ȳ0 ‘"/> <UPDATE_FAIL str="$ ptǸ| `  ŵȲ. ij Ȳ."/> <DI_REC_TRIGGER str="DI yT :"/> <PASTE str="#0"/> <PASTE_MON_FRI str="Ɣ|ǀ0 |L #0"/> <PASTE_SAT_SUN str="є|ǀ0 |ǔ|L #0"/> <PASTE_ALL_CAM str=" tT| #0"/> <APPLY_ALL str=" $ U"/> <UN_SELECT_ALL str="ȴ ͌"/> <GET_  PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="$ $X. 0<\ $ iȲ!"/> <ERR_SETUP str="$ $X. Ux Ȳ."/> <DEL_CAM_COFIRM str="'%s' | ]  XՠȲL?"/> <ADD_CAM_ERR_ALREADY_HAS str="'%s' ¸ tȬ iȲ. Uxt 8"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="  0"/> <SHOW_PB_CAM str="ȥ  0"/> <DELETE_CAM str="Tt 0"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"  /> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Si  ze str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root> j lang_traditional_chinese.xmlQjScSYjS, )<root> <Font Name="wenquanyi" /> <LanguageName str="A~Ԛ-Ne" /> <LanguageNameEng str="Traditional Chinese" /> <Sch_Monitor str="q_c z_UR" /> <Alarm_Monitor str="f1Xc z_UR" /> <Week0 str="fge" /> <Week1 str="fgN" /> <Week2 str="fgN" /> <Week3 str="fg N" /> <Week4 str="fgV" /> <Week5 str="fgN" /> <Week6 str="fgmQ" /> <WeekS0 str="fge" /> <WeekS1 str="fgN" /> <WeekS2 str="fgN" /> <WeekS3 str="fg N" /> <WeekS4 str="fgV" /> <WeekS5 str="fgN" /> <WeekS6 str="fgmQ" /> <Disk_Free str="iRzz" /> <Error str="/" /> <LoginError str="{veQ/,l gdk3^_b[x/" /> <DeviceInfo str="݈n o`" /> <DeviceTitle str="݈n T1z" /> <SoftwareVersion str="ߎԚHr,g" /> <Characters str="W[CQ" /> <DateTimeInfo str="egBfnj " /> <CurrentDate str="s(Weg" /> <CurrentTime str="s(WBf" /> <Adjust str="!h" /> <Manual str="KbR" /> <SyncNTP str="TNTP Tek" /> <Setting str="-[" /> <NTPServer str="NTP:O ghV" /> <Test str=",nf" /> <NTPSyncInterval str="NTP Tek" /> <Hour str="\Bf" /> <Timezone str="Bf@S" /> <Timezone0 st &r="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (}XbKQ\, tRg\)" /> <Timezone3 str="GMT-11 (-N\, idN)" /> <Timezone4 str="GMT-10 (YZ7Y, ?Yu3u\)" /> <Timezone5 str="GMT-09 (?beR)" /> <Timezone6 str="GMT-08 (be}Re, ёq\, nT)" /> <Timezone7 str="GMT-07 (aSR)R, 9N[O, }VnW)" /> <Timezone8 str="GMT-06 (RT, Tbe, XT, egY>ro)" /> <Timezone9 str="GMT-05 (S])" /> <Timezone10 str="GMT-05 (}}, Y+PY/n^, v)" /> <Timezone11 str="GMT-04 (]b-W)" /> <Timezone12 str="GMT-04 (zf)R)" /> <Timezone13 str="GMT-04 (Ymyr, Yte)" /> <Timezone14 str="GMT-03:30 (}-)" /> <Timezone15 str="GMT-03 (], VO)" /> <Timezone16 str="GMT-02 (<\N, 'Y m-N)" /> <Timezone17 str="GMT-01 (N>r\, }_҉\)" /> <Timezone18 str="GMT (gg, ̑e,g, +Pfe, KQŖ}KQ)" /> <Timezone19 str="GMT+01 (?Yeyr9N, gg, , e_T>rid, l)" /> <Timezone20 str="GMT+02 (ŖxQ, k>rW, OefW^>r, ψR)" /> <Timezone21 str="GMT+02 (WS)" /> <Timezone22 str="GMT+02 (NrR)" /> <Timezone23 str="GMT+02 (Ξ]Z)" /> <Timezone24 str="GMT+02 (Xe)RN)" /> <Timezone25 str %="GMT+03 (ey, )RŖ_)" /> <Timezone26 str="GMT+03 ( ObKQ)" /> <Timezone27 str="GMT+03:30 ( Og)" /> <Timezone28 str="GMT+04 (?^Tk, ]^)" /> <Timezone29 str="GMT+04:30 (U^>r)" /> <Timezone30 str="GMT+05 ( Oe-]_, aSbGY^, TXNy^)" /> <Timezone31 str="GMT+05:30 (_[, R>rTT{, e_̑)" /> <Timezone32 str="GMT+05:45 (R_n)" /> <Timezone33 str="GMT+06 (e/O)RN, (geKQ)" /> <Timezone34 str="GMT+06:30 (NIQ)" /> <Timezone35 str="GMT+07 (f7, lgQ, ŖRT)" /> <Timezone36 str="GMT+08 (SN, /n, Nwm, eRaW, S)" /> <Timezone37 str="GMT+09 ("oW, 'Y*, -gL^, qgN)" /> <Timezone38 str="GMT+09:30 (T>re)" /> <Timezone39 str="GMT+09:30 (?_ _)" /> <Timezone40 str="GMT+10 ( ]yr)" /> <Timezone41 str="GMT+10 (NWWb, X>r,g, ꖨh)" /> <Timezone42 str="GMT+11 (@b\)" /> <Timezone43 str="GMT+11:30 (yKQ)" /> <Timezone44 str="GMT+12 (gYKQ-, ZH)" /> <Timezone45 str="GMT+12 (eo)" /> <Timezone46 str="GMT+12 (*X[RJS\)" /> <Timezone47 str="GMT+12 (Gk>r\)" /> <Timezone48 str="GMT+13 (onRTX, R^?ml)" /> <Timezone49 str="GMT+13:45 (gTXY\" /> <DST str 0 ="eIQ{}Bf" /> <Disable str="\P(u" /> <Enable str="_U(u" /> <DSTStart str="eIQ{}BfY" /> <DSTEnd str="eIQ{}BfP}_g" /> <DSTOffset str="eIQ{}BfOP] <AutoLogin str="R{veQ" /> <UID str="3^_" /> <PWD str="[x" /> <System str="|q}" /> <AutoFullScreen str="RhQU^" /> <Language str="" /> <Audio str="r" /> <InputGain str="8eQXv" /> <OutputGain str="8QXv" /> <KeyinNTPAddr str="ˊ8eQNTP:O ghVMOn!" /> <Success str="bR" /> <Fault str="1YWe" /> <OK str="x" /> <Cancel str="Sm" /> <SetDateTime str="-[egBf" /> <Date str="eg" /> <Time str="Bf" /> <AutoSetting str="R-[" /> <CameraName str="eq__j T1z" /> <ModelName str="W_" /> <IPAddress str="IPMO@W" /> <HTTPPort str="HTTPW" /> <RTSPPort str="RTSPW" /> <Camera str="eq__j" /> <Schedule str="c z" /> <Network str="}" /> <User str="O(u" /> <MotionDetection str="MOyuP,n" /> <Snapshot str="_gq" /> <Maintenance str="}w" /> <Add str="eX" /> <Delete str="*Rd" /> <Update str="fe" /> <Clear str="nd" /> <Search str="d \" /> <AutoDetect str= *"RuP,n" /> <Detect str="uP,n" /> <MACAddress str="MACMO@W" /> <Configuration str="Mn" /> <Copy str="" /> <StartTime str="YBf" /> <EndTime str="P}_gBf" /> <RecordType str="q_!j_" /> <PreAlarm str="HQf1X" /> <PostAlarm str="f1X_q_" /> <RTC str="hQBfq_" /> <DIDetect str="DI uP,n" /> <TimeSelErr str="Bf@Sk Nckx!" /> <NoSelSch str="ˊxdc z" /> <Warning str="fJT" /> <WeekCopyToAll str="WY(u0RvQNc z" /> <DHCP str="RS_IP(DHCP)" /> <SubnetMask str="P[}ni" /> <Gateway str="-S" /> <DNS_DHCP str="RS_DNS" /> <PrimaryDNS str="ca(uDNS:O ghV" /> <SecondaryDNS str="vQNDNS:O ghV" /> <PPPoE str="PPPoE" /> <Status str="rKa" /> <Start str="_UR" /> <Stop str="\Pbk" /> <Server str=":O ghV" /> <IPUsed str="dkIPMO@WO(u-N" /> <IPNoUsed str="dkIPMO@WSNO(u" /> <Group str="D}" /> <Description str="c" /> <ConfirmPWD str="x[x" /> <LiveView str="sSBfq_P" /> <Playback str="V>e" /> <Record str="q_" /> <PTZ str="PTZ" /> <TwoWayAudio str="ٖT" /> <CheckConfirmPWD str="ˊ͑ex[x!" /> <UIDEmpty str="ˊ8eQ3^_!" /> <UID ? Repeat str="3^_͑ ˊ͑e8eQ!" /> <NoSelUID str="ˊxd3^6b!" /> <MotionID str="MOy}_" /> <Name str=" T1z" /> <Included str="S+T" /> <Excluded str="cd" /> <ObjectSize str="irN:\[" /> <Sensitivity str="HOe^" /> <NoSelCamera str="ˊxdeq__j!" /> <OverMaxMotion10 str="gYS10 PMOy@SJX!" /> <NoSelMotion str="ˊxdMOy@SJX!" /> <MotionSettingEnpty str="ˊkXnMOySxe" /> <SourceSnapshotList str="On_gqRh" /> <SourceSnapshotPreview str="On_gqo:y" /> <DestinationSnapshotList str="vv_gqRh" /> <DestinationSnapshotPreview str="vv_gqo:y" /> <NoFindSD str="ˊceQSDaS" /> <NoSelImg str="ˊxdWGr!" /> <SameSnapshotImgName str="j T͑,\g˄dkjHh!" /> <IsAutoSetting str="/f&Ts(WWLR-[?" /> <GetParamError str="S_Sxe1YWe!" /> <CameraNameEmpty str="ˊkXeQeq__j T1z" /> <IPAddressEmpty str="ˊkXeQIPMO@W!" /> <UIDEmpty str="ˊkXeQ3^_!" /> <HttpPortEmpty str="ˊkXeQHTTPW!" /> <CameraNameTheSame str="eq__j T1zv T!" /> <CamParam str="eq__jSxe" /> <Profile str=" <FPS str="ky5_xe" /> <Protocol str=" TS[" /> <EnableAudio str="_U(ur" /> <AudioRecord str="_U(u" />  < <InputError str="8eQ/" /> <DefaultSetting str="b`_- <FactoryDefaultSetting str="Q^- <Default str="-" /> <BackupSetting str="PN-[j" /> <Backup str="PN" /> <RestoreSetting str="S-[j" /> <Restore str="S" /> <FirmwareUpgrade str="̗Ԛfe" /> <Upgrade str="fe" /> <Browse str="p" /> <SystemRestart str="|q}͑e_UR" /> <Restart str="͑e_UR" /> <HDInformation str="lxxnj " /> <SDInformation str="SDaSnj " /> <TotalCapacity str="=~[ϑ" /> <FreeCapacity str="iR[ϑ" /> <UsedCapacity str="O(u[ϑ" /> <UsedPercent str="O(ukO" /> <Format str=" <NoFind str="!q" /> <NoMount str="lc " /> <IsDefaultSetting str="|q}\gV_0RQ^- <NoBackupDevice str="ˊceQPN݈n" /> <NoFindConfigFile str="~b N0R-[j" /> <ConfigFile str="-[j" /> <ConfigFileVerErr str="-[jHr,g/" /> <IsRestart str="|q}\g͑e_UR,/f&T|~~WL?" /> <NoFindFirmware str="~b N0RNUO̗Ԛ" /> <FirmwareFile str="̗Ԛj" /> <IsFormatHD str="|q}\WL <OpenFirmwareUpgradeLogErr str="!ql_Ufirmware_upgrade.log" /> <Pl )ayback str="V>e" /> <PlaybackTime str="V>eBf" /> <Play str="d>e" /> <Reverse str="Pd" /> <Pause str="f\P" /> <Wait str="ˊ zP!" /> <Mute str="\" /> <LiveAudio str="s4X" /> <PlaybackAudio str="V>e" /> <ConvertToAvi str="IbAVI" /> <NoFindRecord str="~b N0R" /> <TimePeriod str="Bf@Sk" /> <SaveTo str="2QX[0R" /> <BackupDeviceFull str="ˊjgPN݈nzz/f&T Y" /> <SavePath str="2QX[_" /> <Login str="{veQ" /> <Logout str="{vQ" /> <PictureSet str="q_P-[" /> <Rotation str="eI" /> <Normal str="ck8^" /> <Mirror str="\" /> <VerticaFlip str="WvI" /> <ColorLevel str="i_^" /> <Brightness str="N^" /> <Contrast str=" \k" /> <Sharpness str=")R^" /> <RateControl str="Amϑc6R" /> <Quality str="T" /> <Bitrate str="MOCQs" /> <VideoOffset str="q_PMOy" /> <De-Noise str="Sdܖ " /> <None str="!q" /> <Method str="el" /> <AutoMode str="R!j_" /> <DayMode str="e!j_" /> <NightMode str="Y!j_" /> <Base str="Wy" /> <Picture str="WP" /> <OutOfRange str="Q{ W" /> <SystemClose str="|q}ܕ-N!" /> <On str )="_U" /> <Off str="ܕ" /> <Vendor str="TLr" /> <ModelName str="W_" /> <FriendlyName str="SU T1z" /> <UPnPTraversal str="UPnPz2kpFr" /> <PortRange str="W{ W" /> <ExternalIPAddress str=" \Y}MOn" /> <Information str=" o`" /> <SelOverPlayerMaxCam str="xdN%deq__j" /> <Event str="NN" /> <Event_List str="NNRh" /> <Motion str="RKauP,n" /> <DI str="xeMO8eQ" /> <DO str="xeMO8Q" /> <Event_Schedule_List str="NNc z" /> <Action_List str="f1XUnRh" /> <Alarm_Trigger_Type str="|v1XhN" /> <Alarm_Seconds str="|v1Xyxe" /> <Buzzer str="hV" /> <UnKnow str=" Nf" /> <Display_On_CH str="o:ye;S" /> <Action_Type str="f1X^%R" /> <ERR_MSG_NO_CAM str="ˊHQxdeq__jb,g_j!" /> <ERR_MSG_NO_EVENT str="ˊHQxdNN!" /> <ERR_MSG_NO_EVENT_SCH str="ˊHQxdN PNNc z!" /> <ERR_MSG_NO_ACTION str="ˊHQxdN PNNUn!" /> <ERR_MSG_TIME_PERIOD str="Bf-[ g,ˊ͑ex-[ <ERR_MSG_TIME_CONFILT str="Bf-[]z,ˊ͑ex-[ <WeekDays str="1-[" /> <AlarmSetting str="f1X-[" /> <AlarmCondition str="|v1XrKa" /> <Alarm_True str="&{T" /> <Alarm_False str=  < "ST" /> <Alarm_Seconds str="|v1Xyxe" /> <Alarm_Manual_Stop str="KbR\Pbk" /> <Local str=",g_j" /> <DI_Setting str="DI -[" /> <System_Setting str="|q}-[" /> <Log_Viewer str="j]wQ" /> <Event_Log str="NN" /> <Device str="݈n" /> <Log_Type str=".z^" /> <Motion_Alarm str="MOyuP,n|v" /> <DI_Alarm str="xeMO8eQ|v" /> <Input str="8eQ" /> <Limit_Record str="P6RF{xe" /> <Remark str="P;" /> <Total str="hQ" /> <HDD_Err_Alarm str="lxx/|v" /> <Disconnect_Alarm str="e}|v" /> <Schedule_Trigger str="c z|v" /> <Block_Alarm str="niuP,n|v" /> <Blur_Alarm str="1Y&quP,n|v" /> <Camera_Move_Alarm str="-MOy|v" /> <Address_Book str=" " /> <Phone str="q" /> <E_MAIL str="P[N" /> <Notification str="f1Xw" /> <SMTP_Config str="SMTP-[" /> <SMTP_Server str=":O ghV" /> <SMTP_Port str=" W" /> <From str="[N" /> <SendMailWithoutPicture str="[O ND6^Wj" /> <ServerRequireAuthentication str=":O ghVI" /> <SSL str=":O ghV[hQ#}(SSL)" /> <Send_Test str="[N,nf" /> <FTP_Config str="FTP-[" /> <FTP_Server str=";N_j  ? " /> <FTP_Port str=" W" /> <Retry str="1YWe͑f!kxe" /> <RecycleDays str="OYu)Yxe" /> <RecycleSize str="Recycle'Y\" /> <Path str="_" /> <AllowCreateFolder str="AQ1^znje>Y" /> <HTTP_Config str="HTTP-[" /> <HTTP_IP str="IP" /> <HTTP_UID str="3^_" /> <HTTP_PWD str="[x" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Nt:O ghVMOn" /> <Proxy_UID str="Nt:O ghV3^_" /> <Proxy_PWD str="Nt:O ghV" /> <Proxy_Port str="Nt:O ghVW" /> <TCP_Config str="TCP-[" /> <TCP_Server str=":O ghV" /> <TCP_Port str=" W" /> <Alarm_Config str="f1X-[" /> <frame str="5_" /> <SnapshotInterval str="k5_Wg\" /> <SendInterval str="P" /> <SnapshotTempFolder str="WGrfX[nje>Y" /> <Mail str="O{" /> <Subject str=";Ne" /> <body str="gQ[" /> <MS str="ky" /> <second str="y" /> <EventDetect str="NNuP,n" /> <EventForceRecord str="NN7_6Rq_" /> <EventSetting str="NN-[" /> <MergeSeconds str="TuOyxe" /> <Display str="o:y" /> <Division str="RrR" /> <FullScreen str="hQU^" /> <ResetDIVDefault str="b`_RrR- <CancelFullScreen str  *="SmhQU^" /> <Function str="R" /> <SystemManagement str="|q}{t" /> <PTZControl str="PTZ c6R" /> <Volume str="ϑ" /> <Monitor str="vc" /> <CancelMute str="Sm\" /> <TwoWayAudioON str="YٖT" /> <TwoWayAudioOFF str="\PbkٖT" /> <Resolution str="㉐g^" /> <Style str="^W" /> <Simple str="!|f" /> <Professional str="\mi" /> <Output str="8Q" /> <SettoOpen str="-b" /> <SettoClose str="-b" /> <Preset str="-ޞ" /> <Zoom str="-.~>e" /> <Wide str="^҉" /> <Tele str="g`" /> <Advanced str="2" /> <IsDeletePreset str=" c N'x'\g*Rd-ޞ." /> <System_Log str="|q}" /> <PTZ_SPEED str="PTZ ^" /> <PTZ_HOME str="PTZ Vwޞ" /> <PTZ_UP str="PTZ Ny" /> <PTZ_DOWN str="PTZ Ny" /> <PTZ_LEFT str="PTZ ]y" /> <PTZ_RIGHT str="PTZ Sy" /> <PTZ_UP_RIGHT str="PTZ S Ny" /> <PTZ_UP_LEFT str="PTZ ] Ny" /> <PTZ_DOWN_LEFT str="PTZ ] Ny" /> <PTZ_DOWN_RIGHT str="PTZ S Ny" /> <PTZ_TOUR_GO str="PTZ -]*Y" /> <PTZ_TOUR_STOP str="PTZ -]*\Pbk" /> <PTZ_FOCUS_UP str="PTZ \&qXR" /> <PTZ_FOCUS_DOWN str  0 ="PTZ \&qn\" /> <PTZ_IRIS_UP str="PTZ IQWXR" /> <PTZ_IRIS_DOWN str="PTZ IQWn\" /> <PTZ_FOCUS_AUTO str="PTZ R \&q" /> <PTZ_IRIS_AUTO str="PTZ RIQW" /> <PTZ_AUTOPAN_START str="PTZ R]*Y" /> <PTZ_AUTOPAN_STOP str="PTZ R]*\Pbk" /> <PTZ_ZOOM_IN str="PTZ >e'Y" /> <PTZ_ZOOM_OUT str="PTZ .~\" /> <SYS_LOG_SYSTEM_INIT str="|q}RYS" /> <SYS_LOG_SYSTEM_SHUTDOWN str="|q}ܕ" /> <SYS_LOG_USER_LOGIN str="O(u{veQ" /> <SYS_LOG_USER_LOGOUT str="O(u{vQ" /> <SYS_LOG_START_SCH_REC str="_URq_c z" /> <SYS_LOG_END_SCH_REC str="P}_gq_c z" /> <SYS_LOG_START_SCH_ALARM str="_URf1Xc z" /> <SYS_LOG_END_SCH_ALARM str="P}_gf1Xc z" /> <SYS_LOG_ENTER_SYS_SETUP str="2eQ|q}-[" /> <SYS_LOG_EXIT_SYS_SETUP str="▋|q}-[" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="2eQq_c z-[" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="▋q_c z-[" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="2eQf1Xc z-[" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="▋f1Xc z-[" /> <SYS_LOG_RTSP_GET_CONNECT str="rs_#}" /> <SYS_LOG_RTSP_LOSE_CONNECT str="1YS#}" /> <SYS_LOG_SERVER_HTTP_START str="  %HTTP:O ghV_UR" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP:O ghV\Pbk" /> <SYS_LOG_SERVER_RTSP_START str="RTSP:O ghV_UR" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP:O ghV\Pbk" /> <SYS_LOG_SERVER_RPB_START str="Remote`zV>e:O ghV_UR" /> <SYS_LOG_SERVER_RPB_STOP str="Remote`zV>e:O ghV_UR\Pbk" /> <DiskManagement str="xx{t" /> <DeviceType str="݈n^W" /> <Partition str="R@S" /> <FileSystem str="jHh|q}" /> <IsPartition str="|q}\͑e^zR@S, ˊx/f&T|~~WL" /> <Image str="q_P" /> <Brightness str="N^" /> <Contrast str=" \k" /> <Saturation str="i_^" /> <Sharpness str="q_P)R" /> <Hue str="r" /> <NoSeldesti str="ˊxdvv0W!" /> <NoSelSource str="ˊxdOnRh!" /> <Time_Range str="jHhBf{ W" /> <Event_Snapshot str="NN_gq" /> <EventSnapshotViewer str="NN_gqj" /> <Event_Time str="NNBf" /> <Event_Type str="NN.z^" /> <Change_Resolution str="㉐g^]f,/f&TOYu-[?" /> <Select_All str="hQx" /> <InitNetowrk str="}!jD}RYS" /> <InitSystemDate str="egBf!jD}RYS" /> <InitDisk str="lxxRYS" /> <InitRTSP str="RTSPRYS" /> <NoVideo str="l gq_P" /> <Modify str="O9e &" /> <DisplayCount str="o:y=~xe" /> <Mount str="c " /> <Unmount str="xS " /> <EditEmpty str="ˊxkMOgQ[/f&Tckx!" /> <Account str="3^_" /> <FindListLog str="~b0RN %d F{, Po:yMR %d F{" /> <Trigger_Interval_Seconds str="|vyxe" /> <Alarm_Always str="=~/f|v1X" /> <LowFPS str="NOMOCQsky5_xe" /> <WithFPS str="ky5_xev T" /> <ShowPW str="o:y[x" /> <SelOverMaxPlayHours str="xdN%d\Bf" /> <SelectedCamera str="]xdeq__j" /> <Codec str="}x" /> <Switchto str="Rc0R" /> <Filter str="{x" /> <AutoSettingNote str="ˊ8eQ{xhNb}czz}v2LhQd \" /> <TemplateSetting str="{,g-[" /> <SearchByEvent str="ONNd \" /> <Control str="c6R" /> <SwitchCamera str="Rceq__j" /> <Preview str="p" /> <SequentialSearch str="_^d \" /> <Split str="RrR" /> <PreSearch str="MR!kd \" /> <SeekTo str="y" /> <ShowInformation str="o:y o`" /> <Bitrate_Log str="MOCQs" /> <Save str="2QX[" /> <PlaybackControlPad str="`Oc6RS" /> <FormatFault str=" <LowBitrateSetting str="NOMOCQs-["/> <NotConfigured str="*gRM"/> <Application str="a(u"/> <Name 3 OrMailEmpty str=" T1zbP[Nzz}v"/> <ONVIF_Auth str="ONVIFI"/> <PIR_Alarm str="}Y}uP,n"/> <CameraTamper str="q_P1YHe"/> <AudioDetection str="ruP,n"/> <AutoSwitch str="RS"/> <CancelAutoSwitch str="SmRS"/> <MailRepeat str="EMail]X[(W0ˊ͑-EMail!"/> <SMART str="lxxrKa"/> <OVERALL str="=~"/> <PASSED str="N"/> <FAILED str="/"/> <Raw_Read_Error_Rate str="xedS/s"/> <Throughput_Performance str="X[SHe"/> <Spin_Up_Time str="xv_URBf(ms)"/> <Start_Stop_Count str="_UR/\Pbkxe"/> <Reallocated_Sector_Ct str="͑nSectorsxe"/> <Seek_Error_Rate str=" \~b/s"/> <Seek_Time_Performance str=" \~bs^GWBf"/> <Power_On_Hours str="_U(u\Bf"/> <Spin_Retry_Count str="_UR͑fxe"/> <Calibration_Retry_Count str="!hn͑fxe"/> <Power_Cycle_Count str="n_URܕ!kxe"/> <Power_Off_Retract_Count str="n_xkxe"/> <Load_Cycle_Count str=" eQ/xS xe"/> <Temperature_Celsius str="n^(el)"/> <Reallocated_Event_Count str="͑eRMxe"/> <Current_Pending_Sector str="vuMR\PbkSectorxe"/> <Offline_Uncorrectable str="!qlOckSectorxe"/> <UDMA_CRC_Error_Count st r="UDMA CRC/xe"/> <Multi_Zone_Error_Rate str="Y@SW/s"/> <SMART_RAW_VALUE str="s <SMART_WORST str="S <SMART_Event str="lxx S.M.A.R.T"/> <DisplayRatio str="o:ykO"/> <FitWindow str="kXnz"/> <KeepRatio str="OckO"/> <Joystick str="c6Rv"/> <Joystick_Information str="c6Rvnj "/> <Joystick_Model str="c6RvW_"/> <Axis_Count str="eTxeϑ"/> <Button_Count str=" cxeϑ"/> <Axis_X str="X <Axis_Y str="Y <Axis_Z str="Z <Buttons_Status str=" crKa"/> <Joystick_Buttons_Setting str="c6Rv c-["/> <Button str=" c"/> <Next_Division str="Rc NN.zRrR"/> <Previous_Division str="Rc NN.zRrR"/> <Next_Window str="Rc NN Pz"/> <Previous_Window str="Rc NN Pz"/> <Switch_Division_One str="RcURrR"/> <Axis_Z_ID str="ZN_"/> <RAID_Err_Alarm str="RAID/|v"/> <Create str="^z"/> <Detail str="0}{"/> <Rebuild str="͑^"/> <EraseDisk str="dkR\O\nzzlxx Nv@b gnje,ˊx/f&T|~~WL"/> <FishEyeCtrl str="Z <FishEyeDispMode str="o:y!j_"/> <FishEyePosition str="[݈e_"/> <FishEyeWin str="z"/> <Invalid  Firmware str="!qHev̗Ԛ!"/> <ConnectLost str="1YS#}"/> <ConnectFail str="#}1YWe"/> <GetSettingValueErr str="!qlS_-[ <Refresh str="ˊ͑etet"/> <IE_Protected_Open str="IEvOw!j_]_U ˊbdk}@WReQIEvON}z0"/> <Backuping str="PN-N ˊ z_0"/> <Converting str="Ij-N ˊ z_0"/> <ShowDate str="o:yeg"/> <ShowTime str="o:yBf"/> <Subtitle str="W[U^"/> <PreSecond str=" NNy"/> <PreFrame str=" NN5_"/> <NextSecond str=" NNy"/> <NextFrame str=" NN5_"/> <LowBitrate str="NOMOCQs"/> <DigitalZoom str="xeMO>e'Y"/> <MotionSearch str="R\OuP,n"/> <TimeSplit str="BfRk" /> <ShowDetailWindow str="o:y>e'Yz" /> <FirstPage str=",{N" /> <PrePage str="MRN" /> <NextPage str=" NN" /> <LastPage str="g_N" /> <DetailPicture str="s0}WGr" /> <SelectTime str="xdBfk" /> <ErrStartEndTm str="YBfbP}_gBf/" /> <SearchSet str="d \-[" /> <ShowSearchImage str="o:yd \q_P" /> <ShowDetectMark str="o:yuP,nj" /> <DetectInterval str="uP,n" /> <Exit str="▋" /> <Grayscale str="pp" /> <Softness str="s^nS" /> <Reset str="͑-" /> <Print str="RpS" /> <R  etryAgain str="ˊ z_Qf" /> <FirmwareUpgrade_msg str="̗Ԛfe[b,ˊ͑e#}"/> <SYSTEM_TIME_MSG str="O9eBf\͑_Uq_, /f&T|~~?"/> <TWO_WAYAUDIOUSED str="ٖTck(WO(u-N"/> <Weekly str="1c z"/> <SAVEAS str="SX[..."/> <Send_To str="6eN"/> <ACTION_DESC_SNAPSHOT str="vuNN|vBfgqv"/> <ACTION_DESC_RECORD str="vuNN|vBfq_"/> <ACTION_DESC_DISPLAY str="o:y o`esSBfkub N"/> <ACTION_DESC_MAIL str="vuNN|vBf,[|vwN"/> <ACTION_DESC_VOICE str="vuNN|vBf,d>efJT"/> <ACTION_DESC_DO str="vuNN|vBf,|vxeMO8Q"/> <ACTION_DESC_FTP str=" NPWGr0RFTP:O ghV"/> <ACTION_DESC_BUZZER str="vuNN|vBf,hV\OR"/> <ACTION_DESC_TCP str=" NPWGr0RTCP:O ghV"/> <ACTION_DESC_HTTP str=" NPWGr0RHTTP:O ghV"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="uP,nq_P/f&T gR"/> <EVENT_DESC_BLOCK str="uP,n-puirn="/> <EVENT_DESC_BLUR str="-&qݍ1Y&q"/> <EVENT_DESC_CAM_MOVE str="-eTMOy"/> <EVENT_DESC_DI str="uP,nDIrKa"/> <EVENT_DESC_HDD_ERR str="uP,nlxx/"/> <EVENT_DESC_DISCONNECT str="uP,neq__je}"/> <EVENT_DESC_FORCE str="uP,nc z|v"/> <EVENT_DESC_PIR str="}Y}uP,n"/> <EVENT_ DESC_TAMPER str="q_P1YHe"/> <EVENT_DESC_AUDIO_DETECTION str="ruP,n"/> <ALARM_EVENT_SELECT str="f1XNNxd"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="^zenje>Y"/> <TIME_SET_ERROR str="Bf-[ g,ˊ͑exBf-["/> <Export str="/SQ"/> <SEL_VIEW_CH str="xdo:y;S"/> <SYSTEM_UPDATEMESSAGE str="fe,g_j-[,ˊe'Y}40y_͑e#}"/> <START_MONITOR_ALL str="_URhQvc"/> <UPDATE_FAIL str="!ql NP-[,ˊ z_Qf"/> <DI_REC_TRIGGER str="f1Xq_|vOd:"/> <PASTE str=" N"/> <PASTE_MON_FRI str=" N(WfgN0RN"/> <PASTE_SAT_SUN str=" N(WfgmQ0Re"/> <PASTE_ALL_CAM str=" N@b geq__je "/> <APPLY_ALL str="WY(uhQ"/> <UN_SELECT_ALL str="SmhQx"/> <GET_PARAM_FAIL_USE_DEFAULT str="S_݈nSxe1YWe, |q}\O(u- <NO_CAM_NAME str="*gkXeQeq__j T1z /f&TO(u- <ERR_SETUP str="-[gQ[ g,ˊ͑ex"/> <DEL_CAM_COFIRM str="/f&Tx[*Rd '%s' ?"/> <ADD_CAM_ERR_ALREADY_HAS str="nU-N] g '%s' ,ˊ͑ex-["/> <MOTION_GET_DATA_ERR str="njeS_1YWe"/> <SHOW_LIVE_CAM str="o:ysSBfeq__jq_P"/> <SHOW_PB_CAM str="o:yV>eeq__jq_P"/> <DELETE_CAM str="ydeq__jo:y"/> <NoCamSupportPreset str="l geq__j/ec-ޞ"/>  <ACTION_DESC_PRESET str="y-ޞ"/> <EVENT_DESC_SMART_ERR str="uP,nlxx S.M.A.R.T /"/> <EVENT_DESC_RAID_ERR str="uP,n RAID /"/> <AutoPan str="R]*"/> <ACTION_DESC_AUTO_PAN str="R]*Y"/> <DDNS str="DDNS"/> <DDNS_Server str="DDNS :O ghV"/> <DDNS_Host str="}W T1z"/> <DDNS_UID str="3^_"/> <DDNS_PWD str="[x"/> <DDNS_Status str=" \aIP"/> <DDNS_Test str=",nf"/> <UIStyle str=" <UIS_Overlap str="͑ujLR"/> <UIS_ScaleLv str=".~>e Ps"/> <UIS_AutoScale str="R.~>e"/> <UIS_RecStatus str="q_rKa"/> <UIS_TxtShaow str="eW[pq_"/> <REMOVE_ALL str="ydhQ"/> <QUICK_SETUP str="_-["/> <Primary str=";N"/> <Secondary str="!k"/> <Setup str="-["/> <GroupPreview str="D}"/> <Action_Popup str="Rc"/> <Action_Popup_Desc str="RcsSBfD}"/> <ToolBox_Setting str="]wQ{-["/> <ToolBox_List str="]wQ{nU"/> <DivGroup str="RrRD}"/> <AddDivGrp str="eXRrRD}"/> <GroupName str="D} T1z"/> <Management str="{t"/> <MaxGroups str="g'YD}xeϑ"/> <IVS str="zfq_PRg"/> <EVENT_DESC_IVS str="c6ezfq_PRgP}g"/> < CopyTo str="0R"/> <CopyToAll str="0RhQ"/> <EMap str="P[0WW"/> <Map str="0WW"/> <Change_Map str="f0WW"/> <File_MaxSize str="jHh'Y\ NP"/> <File_List str="jHhnU"/> <File_Name str="jHh T1z"/> <File_Size str="jHh'Y\"/> <File_Type str="jHh^W"/> <File_Open str="_U j"/> <File_Save str="2QX[jHh"/> <File_SaveAs str="SX[ej"/> <MainStream str=";N2NAm"/> <SecondStream str="!k2NAm"/> <VideoSetting str="q_P-["/> <DeleteItemConfirm str="ck(W*Rd %s , ˊOU/f&Tx[WL?"/> <AudioSource str="rOn"/> <AudioEncoder str="r}xhV"/> <SampleRate str="S#js"/> <VideoSource str="q_POn"/> <VideoEncoder str="q_P}xhV"/> <ProfileSetting str=" </root> ,*lang_polish.xmlQjScSYjS 3<root> <Font Name="DejaVu Sans" /> <LanguageName str="Polski" /> <LanguageNameEng str="Polish" /> <Sch_Monitor str="Monitoring wg Harmonogramu" /> <Alarm_Monitor str="Monitoring wg Alarmu" /> <Week0 str="Niedziela" /> <Week1 str="PoniedziaBek" /> <Week2 str="Wtorek" /> <Week3 str="Zroda" /> <Week4 str="Czwartek" /> <Week5 str="Pitek" /> <Week6 str="Sobota" /> <WeekS0 str="Niedziela" /> <WeekS1 str="Pon " /> <WeekS2 str="Wt " /> <WeekS3 str="Zr " /> <WeekS4 str="Czw" /> <WeekS5 str="Pi " /> <WeekS6 str="Sob " /> <Disk_Free str="Wolny" /> <Error str="BBd" /> <LoginError str="BBd logowania, brak u|ytkownika lub nieprawidBowe hasBo" /> <DeviceInfo str="Informacje o urzdzeniu" /> <DeviceTitle str="Nazwa urzdzenia" /> <SoftwareVersion str="Wersja oprogramowania" /> <Characters str="Znakw" /> <DateTimeInfo str="Ustawienia Daty i Czasu" /> <CurrentDate str="Aktualna data" /> <CurrentTime str="Aktualny czas" /> <Adjust str="Zmieniaj" /> <Manual str= <"Rcznie" /> <SyncNTP str="Synchronizacja z NTP" /> <Setting str="Ustawiania" /> <NTPServer str="Ntp Serwer" /> <Test str="Test" /> <NTPSyncInterval str="Okres synchronizacji NTP" /> <Hour str="Godzina" /> <Timezone str="Strefa czasowa" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway ISL., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleuty ISL.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Kuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paragwaj)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Nowa Fundlandia)" /> <Timezone15 str="GMT-03 (Brazili ?a, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Azory, Cap Verde ISL.)" /> <Timezone18 str="GMT (Dublin, Lizbona, Londyn, Reykjavik)" /> <Timezone19 str="GMT +01 (Amsterdam, Berlin, Rzym, Sztokholm, Warszawa)" /> <Timezone20 str="GMT +02 (Ateny, Helsinki, IstambuB, Ryga)" /> <Timezone21 str="GMT +02 (Egipt)" /> <Timezone22 str="GMT +02 (Izrael)" /> <Timezone23 str="GMT +02 (Liban)" /> <Timezone24 str="GMT +02 (Syria)" /> <Timezone25 str="GMT +03 (Moscow, Riyadh)" /> <Timezone26 str="GMT +03 (Irak)" /> <Timezone27 str="GMT +03:30 (Iran)" /> <Timezone28 str="GMT +04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT +04:30 (Kabul)" /> <Timezone30 str="GMT +05 (Islamabad, Karaczi, Taszkient)" /> <Timezone31 str="GMT +05:30 (Bombaj, Kalkuta, New Delhi)" /> <Timezone32 str="GMT +05:45 (Katmandu)" /> <Timezone33 str="GMT +06 (Nowosybirsk, Omsk)" /> <Timezone34 str="GMT +06:30 (Rangoon)" /> <Timezone35 str="GMT +07 (Bangkok, Hanoi, D|akar * ta)" /> <Timezone36 str="GMT +08 (Pekin, Hong Kong, Szanghaj, Singapur, Taipei)" /> <Timezone37 str="GMT +09 (Seul, Osaka, Sapporo, Tokio)" /> <Timezone38 str="GMT +09:30 (Darwin)" /> <Timezone39 str="GMT +09:30 (Adelaide)" /> <Timezone40 str="GMT +10 (Hobart)" /> <Timezone41 str="GMT +10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT +11 (Solomon ISL.)" /> <Timezone43 str="GMT +11:30 (Norfolk)" /> <Timezone44 str="GMT +12 (Auckland, Wellington)" /> <Timezone45 str="GMT +12 (Fid|i)" /> <Timezone46 str="GMT +12 (Kamczatka)" /> <Timezone47 str="GMT +12 (Marshall ISL.)" /> <Timezone48 str="GMT +13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT +12:45 (Chatham Island)" /> <DST str="Czas Letni" /> <Disable str="WyBcz" /> <Enable str="WBcz" /> <DSTStart str="Pocztek czasu letniego" /> <DSTEnd str="Koniec czasu letniego" /> <DSTOffset str="Przesunicie czasu letniego" /> <AutoLogin str="Automatyczne logowanie" /> <UID str="Nazwa u|ytkownika" /> <PWD str="Has 0Bo" /> <System str="System" /> <AutoFullScreen str="Automatycznie PeBny Ekran" /> <Language str="Jzyk" /> <Audio str="Audio" /> <InputGain str="Wzmocnienie wej[cia" /> <OutputGain str="Wzmocnienie wyj[cia" /> <KeyinNTPAddr str="Prosz wprowadz adres serwera NTP!" /> <Success str="Powodzenie" /> <Fault str="Niepowodzenie" /> <OK str="OK" /> <Cancel str="Anuluj" /> <SetDateTime str="Ustaw czas i dat" /> <Date str="Data" /> <Time str="Czas" /> <AutoSetting str="Ustawienia Automatyczne" /> <CameraName str="Nazwa kamery" /> <ModelName str="Model urzdzenia" /> <IPAddress str="Adres IP" /> <HTTPPort str="Port HTTP" /> <RTSPPort str="Port RTSP" /> <Camera str="Kamera" /> <Schedule str="Harmonogram" /> <Network str="Sie" /> <User str="U|ytkownik" /> <MotionDetection str="Detekcja Ruchu" /> <Snapshot str="Zdjcie" /> <Maintenance str="Ustawienia" /> <Add str="Dodaj" /> <Delete str="UsuD" /> <Update str="Aktualizuj" /> <Clear str="Wyczy[" /> <Search st % r="Szukaj" /> <AutoDetect str="Autodetekcja" /> <Detect str="Wykryj" /> <MACAddress str="Adres MAC" /> <Configuration str="Konfiguracja" /> <Copy str="Kopiuj" /> <StartTime str="Czas startu" /> <EndTime str="Czas koDca" /> <RecordType str="Typ Nagrania" /> <PreAlarm str="PreAlarm" /> <PostAlarm str="Postalarm" /> <RTC str="CigBe" /> <DIDetect str="Detekcja DI" /> <TimeSelErr str="Zakres czasu jest nieprawidBowy!" /> <NoSelSch str="Prosz wybra jeden harmonogram!" /> <Warning str="Ostrze|enie" /> <WeekCopyToAll str="Wszystkie ustawienia tygodnia bd takie same jak obecnie wybrane" /> <DHCP str="Uzyskaj adres IP automatycznie (DHCP)" /> <SubnetMask str="Maska podsieci" /> <Gateway str="Brama" /> <DNS_DHCP str="Uzyskaj DNS z DHCP" /> <PrimaryDNS str="Pierwszy DNS" /> <SecondaryDNS str="Drugi DNS" /> <PPPoE str="PPPoE" /> <Status str="Status" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Serwer" /> <IPUsed str="Ten adres jest w u|yciu!" /> < & IPNoUsed str="Adres ten mo|na u|ywa!" /> <Group str="Grupa" /> <Description str="Opis" /> <ConfirmPWD str="Potwierdz hasBo" /> <LiveView str="Podgld na |ywo" /> <Playback str="Odtwarzanie" /> <Record str="Nagrania" /> <PTZ str="PTZ" /> <TwoWayAudio str="Dwukierunkowe Audio" /> <CheckConfirmPWD str="Prosz sprawdzi, potwierdzi hasBo." /> <UIDEmpty str="Prosz zmieni nazw u|ytkownika." /> <UIDRepeat str="DodaBe[ t sam nazw u|ytkownika. Prosz zmieD to!" /> <NoSelUID str="Wybierz konto!" /> <MotionID str="ID okna Detekcji" /> <Name str="Nazwa" /> <Included str="Wewntrz" /> <Excluded str="Na Zewntrz" /> <ObjectSize str="Rozmiar obiektu" /> <Sensitivity str="CzuBo[" /> <NoSelCamera str="Prosz wybra kamer!" /> <OverMaxMotion10 str="Maksymalna ilo[ to 10" /> <NoSelMotion str="Please select a motion." /> <MotionSettingEnpty str="Please fill motion setting first." /> <SourceSnapshotList str="Source Snapshot List" /> <SourceSnapshotPreview str="Source Snap 3shot Preview" /> <DestinationSnapshotList str="Destination Snapshot List" /> <DestinationSnapshotPreview str="Destination Snapshot Preview" /> <NoFindSD str="Prosz wBo|y kart SD!" /> <NoSelImg str="Prosz wybra obraz!" /> <SameSnapshotImgName str="Nazwa pliku istnieje na karcie SD. Plik zostanie nadpisany!" /> <IsAutoSetting str="Czy chcesz Automatycznie skonfigurowa kamer ? " /> <GetParamError str="BBd pobierania parametrw!" /> <CameraNameEmpty str="Prosz wprowadz nazw kamery!" /> <IPAddressEmpty str="Prosz wprowadz adres IP!" /> <UIDEmpty str="Prosz wprowadz Nazw u|ytkownika!" /> <HttpPortEmpty str="Prosz wprowadz port HTTP!" /> <CameraNameTheSame str="Nazwa kamery jest taka sama!" /> <CamParam str="Dane kamery" /> <Profile str="Profil" /> <FPS str="FPS" /> <Protocol str="ProtokB" /> <EnableAudio str="WBcz dzwik" /> <AudioRecord str="Nagrywaj dzwik" /> <InputError str="BBd wej[cia" /> <DefaultSetting str="Ustawienia domy[lne" /> <FactoryDefaultSe 3tting str="Ustawienia fabryczne" /> <Default str="Domy[lne" /> <BackupSetting str="Ustawienia Kopii Zapasowych" /> <Backup str="Tworzenie kopii zapasowych" /> <RestoreSetting str="Przywr ustawienia" /> <Restore str="Przywracaj" /> <FirmwareUpgrade str="Aktualizacja oprogramowania" /> <Upgrade str="Aktualizuj" /> <Browse str="Przegldaj" /> <SystemRestart str="Restart systemu" /> <Restart str="Restart" /> <HDInformation str="Informacje o Dysku Twardym" /> <SDInformation str="Informacje o karcie SD" /> <TotalCapacity str="CaBkowita pojemno[" /> <FreeCapacity str="Wolna Pojemno[" /> <UsedCapacity str="U|ywana Pojemno[" /> <UsedPercent str="Procent u|ywany" /> <Format str="Format" /> <NoFind str="Nie znaleziono" /> <NoMount str="Nie zamontowany" /> <IsDefaultSetting str="System przywrci wszystkie ustawienia do fabrycznych, prosz potwierdz wybr." /> <NoBackupDevice str="Prosz podBczy zewntrzny no[nik kopii." /> <NoFindConfigFile str="Nie mo|na odnalez pliku   & konfiguracyjnego." /> <ConfigFile str="Plik konfiguracyjny" /> <ConfigFileVerErr str="BBd wersji pliku konfiguracyjnego." /> <IsRestart str="System zostanie uruchomiony ponownie, prosz o potwierdzenie tej czynno[ci." /> <NoFindFirmware str="Nie mo|na znalez |adnego oprogramowania!" /> <FirmwareFile str="Plik Oprogramowania" /> <IsFormatHD str="Wszystkie dane zostan utracone, kontynuowa ? ." /> <OpenFirmwareUpgradeLogErr str="Nie mo|na otworzy pliku firmware_upgrade.log" /> <Playback str="Odtwarzanie" /> <PlaybackTime str="Czas odtwarzania" /> <Play str="Odtwarzaj" /> <Reverse str="Wstecz" /> <Pause str="Pauza" /> <Wait str="Prosz czeka!" /> <Mute str="Wyciszenie" /> <LiveAudio str="Obecny Dzwik" /> <PlaybackAudio str="Odtwarzanie dzwiku" /> <ConvertToAvi str="Konwersja do avi" /> <NoFindRecord str="Nie znaleziono zapisu" /> <TimePeriod str="Okres" /> <SaveTo str="Zapisz do" /> <BackupDeviceFull str="Urzdzenie Archiwizujce zdaje si by peBne, prosz to spr  % awdzi." /> <SavePath str="Zapisz [cie|k" /> <Login str="Zaloguj" /> <Logout str="Wyloguj" /> <PictureSet str="Ustawienia Obrazu" /> <Rotation str="Obrt" /> <Normal str="Normalny" /> <Mirror str="Lustro" /> <VerticaFlip str="Obrt w poziomie" /> <ColorLevel str="Poziom Kolorw" /> <Brightness str="Jasno[" /> <Contrast str="Kontrast" /> <Sharpness str="Ostro[" /> <RateControl str="Kontrola pasma" /> <Quality str="Jako[" /> <Bitrate str="Bitrate" /> <VideoOffset str="Przesunicie wideo" /> <De-Noise str="Odszumianie" /> <None str="Brak" /> <Method str="Metoda" /> <AutoMode str="Tryb automatyczny" /> <DayMode str="Tryb dzienny" /> <NightMode str="Tryb nocny" /> <Base str="Dane Podstawowe" /> <Picture str="Obraz" /> <OutOfRange str="Poza zakresem" /> <SystemClose str="Zamknij system ..." /> <On str="WBczony" /> <Off str="WyBczony" /> <Vendor str="Producent" /> <ModelName str="Nazwa modelu" /> <FriendlyName str="Przyjazna nazwa" /> <UPnPTravers  0al str="UPnP Traversal" /> <PortRange str="Zakres Portw" /> <ExternalIPAddress str="Zewntrzny adres IP" /> <Information str="Informacje" /> <SelOverPlayerMaxCam str="Wybierz na% d kamery!" /> <Event str="Zdarzenie" /> <Event_List str="Lista ZdarzeD" /> <Motion str="Ruch" /> <DI str="Wej[cie cyfrowe" /> <DO str="Wyj[cie cyfrowe" /> <Event_Schedule_List str="Lista harmonogramu zdarzeD" /> <Action_List str="Lista Akcji" /> <Alarm_Trigger_Type str="Typ Alarmu" /> <Alarm_Seconds str="Sekund alarmu" /> <Buzzer str="Brzczyk" /> <UnKnow str="Nieznane" /> <Display_On_CH str="Poka| na kanale" /> <Action_Type str="Rodzaj Akcji" /> <ERR_MSG_NO_CAM str="Prosz najpierw wybra kamer lub lokalizacj !" /> <ERR_MSG_NO_EVENT str="Prosz najpierw wybra zdarzenie!" /> <ERR_MSG_NO_EVENT_SCH str="Prosz najpierw wybra harmonogram zdarzeD !" /> <ERR_MSG_NO_ACTION str="Wybierz Najpierw akcj!" /> <ERR_MSG_TIME_PERIOD str="BBd czasokresu ;). Sprawdz konfiguracj!" /> <ERR_MSG_TIME  * _CONFILT str="Konflikt czasokresu ;). Sprawdz konfiguracj!" /> <WeekDays str="Dni Tygodnia" /> <AlarmSetting str="Ustawienia Alarmu" /> <AlarmCondition str="Stan Alarmu" /> <Alarm_True str="True" /> <Alarm_False str="False" /> <Alarm_Seconds str="Sekundy Alarmu" /> <Alarm_Manual_Stop str="Zatrzymanie rczne" /> <Local str="Lokalizacja" /> <DI_Setting str="Otoczenie DI" /> <System_Setting str="Ustawienia Systemu" /> <Log_Viewer str="Podgld Log" /> <Event_Log str="Log zdarzeD" /> <Device str="Urzdzenie" /> <Log_Type str="Typ Loga" /> <Motion_Alarm str="Alarm Ruchu" /> <DI_Alarm str="Alarm DI" /> <Input str="Wej[cie" /> <Limit_Record str="Limit Record" /> <Remark str="Uwagi" /> <Total str="Aczny" /> <HDD_Err_Alarm str="Alarm BBdu HDD" /> <Disconnect_Alarm str="Alarm odBczenia" /> <Schedule_Trigger str="Alarm wg Harmonogramu" /> <Block_Alarm str="Alarm blokowania" /> <Blur_Alarm str="Alarm rozmycia" /> <Camera_Move_Alarm str="Alarm przesunicia kamery" />  ? <Address_Book str="Ksi|ka adresowa" /> <Phone str="Telefon" /> <E_MAIL str="E-Mail" /> <Notification str="Powiadamianie" /> <SMTP_Config str="Ustawienie SMTP" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="Od" /> <SendMailWithoutPicture str="Wy[lij mail bez zdjcia" /> <ServerRequireAuthentication str="Serwer wymaga uwierzytelnienia" /> <SSL str="Server Wymagaj bezpiecznego poBczenia (SSL)" /> <Send_Test str="Wy[lij wiadomo[ testow" /> <FTP_Config str="Ustawianie FTP" /> <FTP_Server str="Serwer" /> <FTP_Port str="Port" /> <Retry str="Ponawiaj ilo[ razy" /> <RecycleDays str="Nadpisywanie DNI" /> <RecycleSize str="Nadpisywanie wielko[ci" /> <Path str="Zcie|ka" /> <AllowCreateFolder str="Zezwl na utworzenie folderu" /> <HTTP_Config str="Ustawienie HTTP" /> <HTTP_IP str="IP" /> <HTTP_UID str="Konto" /> <HTTP_PWD str="HasBo" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Adres Proxy " /> <Proxy_UID str="Konto Proxy" /> <Proxy_PWD st <r="HasBo Proxy" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="Ustawienie TCP" /> <TCP_Server str="Serwer" /> <TCP_Port str="Port" /> <Alarm_Config str="Ustawienia Alarmu" /> <frame str="Ramka" /> <SnapshotInterval str="InterwaB zdj" /> <SendInterval str="InterwaB wysyBania" /> <SnapshotTempFolder str="Folder Temp dla zdj" /> <Mail str="Poczta" /> <Subject str="Przedmiot" /> <body str="Tre[" /> <MS str="MS" /> <second str="Sekund" /> <EventDetect str="Detekcja zdarzeD" /> <EventForceRecord str="Event Force Record" /> <EventSetting str="Ustawienia zdarzeD" /> <MergeSeconds str="Powtarzaj Sekund" /> <Display str="Wy[wietl" /> <Division str="Sekcja" /> <FullScreen str="PeBny Ekran" /> <ResetDIVDefault str="Przywr do fabrycznych" /> <CancelFullScreen str="Anuluj PeBny Ekran" /> <Function str="Funkcja" /> <SystemManagement str="Zarzdzanie systemem" /> <PTZControl str="PTZControl" /> <Volume str="GBo[no[" /> <Monitor str="Monitor" /> <CancelMut ) e str="Anuluj wyciszenie" /> <TwoWayAudioON str="Uruchom Audio" /> <TwoWayAudioOFF str="Zatrzymaj Audio" /> <Resolution str="Rozdzielczo[" /> <Style str="Styl" /> <Simple str="Prosty" /> <Professional str="Profesjonalny" /> <Output str="Wyj[cie" /> <SettoOpen str="Ustaw by otworzy" /> <SettoClose str="Ustaw, aby zamkn" /> <Preset str="Preset" /> <Zoom str="Powiksz" /> <Wide str="Szeroki" /> <Tele str="Tele" /> <Advanced str="Zaawansowany" /> <IsDeletePreset str="Wci[nicie 'OK' usunie preset" /> <System_Log str="Log Systemu" /> <PTZ_SPEED str="Prdko[ PTZ" /> <PTZ_HOME str="PTZ Home" /> <PTZ_UP str="PTZ w gr" /> <PTZ_DOWN str="PTZ w dB" /> <PTZ_LEFT str="PTZ w lewo" /> <PTZ_RIGHT str="PTZ w prawo" /> <PTZ_UP_RIGHT str="PTZ gra prawo" /> <PTZ_UP_LEFT str="PTZ gra lewo" /> <PTZ_DOWN_LEFT str="PTZ dB lewo" /> <PTZ_DOWN_RIGHT str="PTZ dB prawo" /> <PTZ_TOUR_GO str="PTZ wBcz [cie|k" /> <PTZ_TOUR_STOP str="PTZ wyBcz [cie|k" /> <PTZ_FOCUS_UP   str="PTZ wyostrz plus" /> <PTZ_FOCUS_DOWN str="PTZ wyostrz minus" /> <PTZ_IRIS_UP str="PTZ przesBona plus" /> <PTZ_IRIS_DOWN str="PTZ przesBona minus" /> <PTZ_FOCUS_AUTO str="PTZ Auto ostro[" /> <PTZ_IRIS_AUTO str="PTZ Auto przesBona" /> <PTZ_AUTOPAN_START str="PTZ Navigation Start" /> <PTZ_AUTOPAN_STOP str="PTZ Navigation Stop" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="Inicjalizacja systemu" /> <SYS_LOG_SYSTEM_SHUTDOWN str="WyBczenie systemu" /> <SYS_LOG_USER_LOGIN str="Zaloguj u|ytkownika" /> <SYS_LOG_USER_LOGOUT str="Wyloguj u|ytkownika" /> <SYS_LOG_START_SCH_REC str="WBcz Harmonogram Nagrywania" /> <SYS_LOG_END_SCH_REC str="ZakoDcz Harmonogram Nagrywania" /> <SYS_LOG_START_SCH_ALARM str="WBcz Harmonogram Alarmw" /> <SYS_LOG_END_SCH_ALARM str="ZakoDcz Harmonogram Alarmw" /> <SYS_LOG_ENTER_SYS_SETUP str="Wejdz do programu konfiguracji systemu" /> <SYS_LOG_EXIT_SYS_SETUP str="Wyjdz z programu konfiguracji s  ystemu" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Wejdz do ustawieD harmonogramu nagrywania" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Wyjdz z ustawieD Harmonogramu nagrywania" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Wejdz do ustawieD harmonogramu alarmu" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Wyjdz z ustawieD harmonogramu alarmu" /> <SYS_LOG_RTSP_GET_CONNECT str="Nawi| poBczenie" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Utracono poBczenie" /> <SYS_LOG_SERVER_HTTP_START str="WBcz serwer HTTP" /> <SYS_LOG_SERVER_HTTP_STOP str="Zatrzymanie serwera HTTP" /> <SYS_LOG_SERVER_RTSP_START str="Acz serwer RTSP" /> <SYS_LOG_SERVER_RTSP_STOP str="Zatrzymaj serwer RTSP" /> <SYS_LOG_SERVER_RPB_START str="WBcz zdalny serwer odtwarzania" /> <SYS_LOG_SERVER_RPB_STOP str="WyBcz zdalny serwer odtwarzania" /> <DiskManagement str="Zarzdzanie dyskami" /> <DeviceType str="Typ urzdzenia" /> <Partition str="Partycja" /> <FileSystem str="System Plikw" /> <IsPartition str="System przebuduje partycje, prosz po  twierdz." /> <Image str="Obraz" /> <Brightness str="Jasno[" /> <Contrast str="Kontrast" /> <Saturation str="Nasycenie" /> <Sharpness str="Ostro[" /> <Hue str="Barwa" /> <NoSeldesti str="Please select Destination!" /> <NoSelSource str="Please select Source List!" /> <Time_Range str="Zakres czasowy pliku" /> <Event_Snapshot str="Event Snapshot" /> <EventSnapshotViewer str="Event Snapshot Viewer" /> <Event_Time str="Czas zdarzenia" /> <Event_Type str="Typ zdarzenia" /> <Change_Resolution str="Rozdzielczo[ ekranu zostaBa zmieniona, Czy chcesz zmiany?" /> <Select_All str="Zaznacz wszystko" /> <InitNetowrk str="Inicjowanie ModuBu Sieciowego" /> <InitSystemDate str="Inicjowanie moduBu czasu" /> <InitDisk str="Inicjowanie moduBu HDD" /> <InitRTSP str="Inicjowanie moduBu RTSP" /> <NoVideo str="Bez Video" /> <Modify str="Modyfikuj" /> <DisplayCount str="Wy[wietl licznik" /> <Mount str="Montuj" /> <Unmount str="Odinstaluj" /> <EditEmpty str="Prosz potwierdzi, czy us tawienia s poprawne!" /> <Account str="Konto" /> <FindListLog str="Znaleziono ponad% d rekordw, wy[wietl jako pierwsze% rekordw." /> <Trigger_Interval_Seconds str="Wyzwalanie w przedziale czasu" /> <Alarm_Always str="Zawsze Alarm" /> <LowFPS str="Niski strumieD Bitrate/FPS" /> <WithFPS str="Jak wy|ej" /> <ShowPW str="Poka| hasBo" /> <SelOverMaxPlayHours str="Wybrane przez% d godzin" /> <SelectedCamera str="Wybrana kamera" /> <Codec str="Kodek" /> <Switchto str="PrzeBcz na" /> <Filter str="Filtrowanie" /> <AutoSettingNote str="Wprowadz reguB filtrowania lub zachowa puste, aby znalez wszystkie" /> <TemplateSetting str="Ustawienie szablonu" /> <SearchByEvent str="Szukaj przez zdarzenie" /> <Control str="Sterowanie" /> <SwitchCamera str="PrzeBcz kamer" /> <Preview str="Podgld" /> <SequentialSearch str="Wyszukiwanie sekwencyjne" /> <Split str="Podziel" /> <PreSearch str="Przeszukaj" /> <SeekTo str="Szukaj do" /> <ShowInformation str="Poka| informacje" /> <B  itrate_Log str="Logi Bitrate" /> <Save str="Zapisz" /> <PlaybackControlPad str="Panel odtwarzania" /> <FormatFault str="BBd Formatu" /> <LowBitrateSetting str="Ustawienia niskiego Bitrate" /> <NotConfigured str="Nie skonfigurowano" /> <Application str="Aplikacja" /> <NameOrMailEmpty str="Nazwa lub E-Mail jest pusty" /> <ONVIF_Auth str="Uwierzytelnianie ONVIF" /> <PIR_Alarm str="Alarm PIR" /> <CameraTamper str="Sabota| Kamery" /> <AudioDetection str="Detekcja dzwiku" /> <AutoSwitch str="AutoprzeBczanie" /> <CancelAutoSwitch str="Anuluj autoprzeBczanie" /> <MailRepeat str="DodaBe[ ten sam e-mail. Prosz zmieD to!" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Over all" /> <PASSED str="Test OK" /> <FAILED str="Niepowodzenie" /> <Raw_Read_Error_Rate str="Ilo[ zmierzonych bBdw" /> <Throughput_Performance str="Wydajno[" /> <Spin_Up_Time str="Czas rozkrcania Talerzy ;) HDD" /> <Start_Stop_Count str="Licznik Start Stop" /> <Reallocated_Sector_Ct str="Reallocated Sec tors Count" /> <Seek_Error_Rate str="Seek Error Rate" /> <Seek_Time_Performance str="Czas wyszukiwania" /> <Power_On_Hours str="WBczony godzin" /> <Spin_Retry_Count str="Spin Retry Count" /> <Calibration_Retry_Count str="Calibration Retry Count" /> <Power_Cycle_Count str="Power Cycle Count" /> <Power_Off_Retract_Count str="Power Off Retract Count" /> <Load_Cycle_Count str="ZaBaduj Cycle Count" /> <Temperature_Celsius str="Temperatura Celsjusza" /> <Reallocated_Event_Count str="Reallocated Event Count" /> <Current_Pending_Sector str="Current Pending Sector" /> <Offline_Uncorrectable str="Offline Uncorrectable" /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="Multi Zone Error Rate" /> <SMART_RAW_VALUE str="Warto[ Raw" /> <SMART_WORST str="Referencje" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="WspBczynnik wy[wietlania" /> <FitWindow str="Dopasuj okno" /> <KeepRatio str="Utrzymaj proporcje" /> <Joystick str="Manipulator"  /> <Joystick_Information str="Informacje Manipulatora" /> <Joystick_Model str="Model Manipulatora" /> <Axis_Count str="Axis Count" /> <Button_Count str="Ilo[ przyciskw" /> <Axis_X str="O[ X Warto[" /> <Axis_Y str="Warto[ osi Y" /> <Axis_Z str="Warto[ osi Z" /> <Buttons_Status str="Status Przyciskw" /> <Joystick_Buttons_Setting str="Ustawienia przyciskw manipulatora" /> <Button str="Przycisk" /> <Next_Division str="Nastpna sekcja" /> <Previous_Division str="Poprzednia sekcja" /> <Next_Window str="Nastpne okno" /> <Previous_Window str="Poprzednie okno" /> <Switch_Division_One str="PrzeBcz pierwsz sekcj" /> <Axis_Z_ID str="O[ Z ID" /> <RAID_Err_Alarm str="Alarm bBdu RAID" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeW  in str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Lost Connect"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="Can't Get Setting Value!"/> <Refresh str="Please Refresh!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backuping, Please wait."/> <Converting str="Converting. Please wait."/> <ShowDate str="Show Date"/> <ShowTime str="Show Time"/> <Subtitle str="Subtitle"/> <PreSecond str="Pre Second"/> <PreFrame str="Pre Frame"/> <NextSecond str="Next Second"/> <NextFrame str="Next Frame"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Motion Search" /> <TimeSplit str="Time Split" /> <ShowDetailWindow str="Show Detail Window" /> <FirstPage str="First Page" /> <PrePage str="Pre Page" /> <NextPage str="Next Page" /> <LastPage str="Last Page" /> <DetailPicture str="Detail Picture" /> <SelectTime str="Select Time" />  <ErrStartEndTm str="Start or End Time Error" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Show Search Image" /> <ShowDetectMark str="Show Detect Mark" /> <DetectInterval str="Detect Interval" /> <Exit str="Exit" /> <Grayscale str="Grayscale" /> <Softness str="Softness" /> <Reset str="Reset" /> <Print str="Print" /> <RetryAgain str="Please try again later!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Two Way Audio Used!"/> <Weekly str="Weekly"/> <SAVEAS str="Save As..."/> <Send_To str="Send to"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Display Message on Live Preview"/> <ACTION_DESC_MAIL str="Send Notice Mail on Event Triggered"/> <ACTION_DESC_VOICE str="Play Alarm S ound on Event Triggered"/> <ACTION_DESC_DO str="Trigger Digital Output on Event Triggered"/> <ACTION_DESC_FTP str="Upload Images To FTP Site"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detect digital inuput change status"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarm Event Selection"/> <CREATE_NEW_FOLDER str ="Create New Folder"/> <CHANGE_NAME str="Change Name"/> <TIME_SET_ERROR str="Time setting error, please check time setting"/> <Export str="Export"/> <SEL_VIEW_CH str="Select View Channel"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Start Monitor All"/> <UPDATE_FAIL str="Can not upload setting , please try again later!"/> <DI_REC_TRIGGER str="DI Record trigger by:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="Camera name is empty, Do you want to use default name?"/> <ERR_SETUP str="Configuration data error, please re-check"/> <DEL_CAM_COFIRM str="Are you sure want to delete '%s' from list?"/> <ADD_CAM_ERR_AL  READY_HAS str="It's already has '%s' at list,please re-check Configuration"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Show Live Camera"/> <SHOW_PB_CAM str="Show Playback Camera"/> <DELETE_CAM str="Remove Camera display"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick  setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/>   <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root> lang_portuguese.xmlQjScSYjS &<root> <Font Name="DejaVu Sans" /> <LanguageName str="Portugus" /> <LanguageNameEng str="Portuguese" /> <Sch_Monitor str="Agendar Monitorizao" /> <Alarm_Monitor str="Alarme Monitorizao" /> <Week0 str="Domingo" /> <Week1 str="Segunda" /> <Week2 str="Tera" /> <Week3 str="Quarta" /> <Week4 str="Quinta" /> <Week5 str="Sexta" /> <Week6 str="Sbado" /> <WeekS0 str="Dom " /> <WeekS1 str="Seg " /> <WeekS2 str="Ter " /> <WeekS3 str="Qua " /> <WeekS4 str="Qui " /> <WeekS5 str="Sex " /> <WeekS6 str="Sb " /> <Disk_Free str="Livre" /> <Error str="Erro" /> <LoginError str="Erro Login, utilizador no corresponde ou senha incorrecta" /> <DeviceInfo str="Dispositivo Info" /> <DeviceTitle str="Ttulo do Dispositivo" /> <SoftwareVersion str="Verso do Software" /> <Characters str="Caracteres" /> <DateTimeInfo str="Info Data e Hora" /> <CurrentDate str="Data Actual" /> <CurrentTime str="Hora Actual" /> <Adjust str="Ajustar" /> <Manual str="Manual" /> <SyncNT )P str="Sincronizar com NTP" /> <Setting str="Definir" /> <NTPServer str="ServidorNTP" /> <Test str="Teste" /> <NTPSyncInterval str="NTP Sinc Intervalo" /> <Hour str="Hora " /> <Timezone str="Fuso horrio" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, So Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Cidade do Mexico, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguai)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brasilia, So Paulo)" /> <Timezone *16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Aores, Cabo Verde Isl.)" /> <Timezone18 str="GMT (Dublin, Lisboa, Londres, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdo, Berlim, Roma, Estocolmo, Varsvia)" /> <Timezone20 str="GMT+02 (Atenas, Helsinkia, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egipto)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Libano)" /> <Timezone24 str="GMT+02 (Siria)" /> <Timezone25 str="GMT+03 (Moscovo, Riade)" /> <Timezone26 str="GMT+03 (Iraque)" /> <Timezone27 str="GMT+03:30 (Iro)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombaim, Calcuta, Nova Deli)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Peq ? uim, Hong Kong, Xangai, Singapura, Taipei)" /> <Timezone37 str="GMT+09 (Seul, Osaka, Sapporo, Tokio)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+12:45 (Chatham Island)" /> <DST str="Horrio de Vero" /> <Disable str="Desactivar" /> <Enable str="Activar" /> <DSTStart str="Inicio da Hora de Vero" /> <DSTEnd str="Fim da Hora de Vero" /> <DSTOffset str="Compensar Hora de Vero" /> <AutoLogin str="Auto Login" /> <UID str="Nome utilizador" /> <PWD str="Senha" /> <System str="Sistema" /> <AutoFullScreen str="Aut %o Ecran Completo" /> <Language str="Idioma" /> <Audio str="udio" /> <InputGain str="Ganho Entrada" /> <OutputGain str="Ganho Sada" /> <KeyinNTPAddr str="Por favor digite Endereo Servidor NTP!" /> <Success str="Sucesso" /> <Fault str="Falha" /> <OK str="OK" /> <Cancel str="Cancelar" /> <SetDateTime str="Defina Data e Hora" /> <Date str="Data " /> <Time str="Hora" /> <AutoSetting str="Definio automtica" /> <CameraName str="Nome da Camera" /> <ModelName str="Nome do Modelo" /> <IPAddress str="Endereo IP" /> <HTTPPort str="Porta HTTP" /> <RTSPPort str="Porta RTSP" /> <Camera str="Camera" /> <Schedule str="Agendar " /> <Network str="Rede" /> <User str="Utilizador" /> <MotionDetection str="Deteco Movimento" /> <Snapshot str="Instantneo" /> <Maintenance str="Manuteno" /> <Add str="Adicionar" /> <Delete str="Eliminar" /> <Update str="Actualizar" /> <Clear str="Limpar" /> <Search str="Pesquisar" /> <AutoDetect str="Deteo Automtica" /> <De 0 tect str="Detectar" /> <MACAddress str="Endereo MAC" /> <Configuration str="Configurao" /> <Copy str="Copiar" /> <StartTime str="Hora Inicial" /> <EndTime str="Hora Final" /> <RecordType str="Tipo Gravao" /> <PreAlarm str="PrAlarme" /> <PostAlarm str="PsAlarme" /> <RTC str="O Tempo Todo" /> <DIDetect str="DI Deteco" /> <TimeSelErr str="Intervalo Tempo est incorrecto!" /> <NoSelSch str="Selecione por favor um agendamento!" /> <Warning str="Aviso" /> <WeekCopyToAll str="Todos agendamentos da semana sero os mesmos com os selecionados" /> <DHCP str="Obter automticamente endereo IP (DHCP)" /> <SubnetMask str="Mascara Sub-rede" /> <Gateway str="Gateway" /> <DNS_DHCP str="Obter DNS atravs do DHCP" /> <PrimaryDNS str="DNS Primrio" /> <SecondaryDNS str="DNS Secundrio" /> <PPPoE str="PPPoE" /> <Status str="Status (Estado)" /> <Start str="Comear" /> <Stop str="Parar" /> <Server str="Servidor" /> <IPUsed str="Este endereo est a ser usado!" /> <IPNoU 3 sed str="Pode usar este endereo!" /> <Group str="Grupo" /> <Description str="Descrio" /> <ConfirmPWD str="Confirme a Senha" /> <LiveView str="Ver ao Vivo" /> <Playback str="Reproduzir" /> <Record str="Gravar" /> <PTZ str="PTZ" /> <TwoWayAudio str="udio Bi-direcional" /> <CheckConfirmPWD str="Por favor verifique e confirme novamente a senha." /> <UIDEmpty str="Por favor edite o nome utilizador." /> <UIDRepeat str="Voc adicionou o mesmo nome utilizador. Por favor altere-o!" /> <NoSelUID str="Por favor seleccione a conta!" /> <MotionID str="Movimento ID" /> <Name str="Nome" /> <Included str="Includo" /> <Excluded str="Excludo" /> <ObjectSize str="Tamanho do Objeto" /> <Sensitivity str="Sensibilidade" /> <NoSelCamera str="Por favor seleccione a Camera!" /> <OverMaxMotion10 str="O movimento mximo 10," /> <NoSelMotion str="Por favor selecione um movimento." /> <MotionSettingEnpty str="Por favor preencha primeiro a configurao do movimento." /> <SourceSnapshot &List str="Lista Fonte Instantneo" /> <SourceSnapshotPreview str="Fonte Pr-visualizao Instantnea" /> <DestinationSnapshotList str="Lista Instantnea Destino" /> <DestinationSnapshotPreview str="Pr-visualizar Destino Instantneo" /> <NoFindSD str="Insira por favor o Carto SD!" /> <NoSelImg str="Por favor seleccione a imagem!" /> <SameSnapshotImgName str="Tem o mesmo nome do ficheiro no carto SD.Ir substituir o ficheiro!" /> <IsAutoSetting str="Pretende agora definir automticamente a camera?" /> <GetParamError str="Obter Erro dos Parmetros!" /> <CameraNameEmpty str="Digite por favor o Nome da Camera!" /> <IPAddressEmpty str="Digite por favor o Endereo IP!" /> <UIDEmpty str="Digite por favor o Nome Utilizador!" /> <HttpPortEmpty str="Digite por favor a Porta Http!" /> <CameraNameTheSame str="O Nome da Camara o mesmo!" /> <CamParam str="Parmetros da Camera" /> <Profile str="Perfil" /> <FPS str="FPS" /> <Protocol str="Protocolo" /> <EnableAudio str="Activar udio" & /> <AudioRecord str="Gravar udio" /> <InputError str="Erro Entrada" /> <DefaultSetting str="Configurao por Defeito" /> <FactoryDefaultSetting str="Configurao por Defeito de Fbrica" /> <Default str="Padro" /> <BackupSetting str="Configurar Backup" /> <Backup str="Backup" /> <RestoreSetting str="Restaurar as Configuraes" /> <Restore str="Restaurar " /> <FirmwareUpgrade str="Actualizar Firmware" /> <Upgrade str="Actualizar" /> <Browse str="Navegar" /> <SystemRestart str="Reiniciar o Sistema" /> <Restart str="Reiniciar " /> <HDInformation str="Hard Disk Informao" /> <SDInformation str="Carto SD Informao" /> <TotalCapacity str="Capacidade Total" /> <FreeCapacity str="Capacidade Livre" /> <UsedCapacity str="Capacidade Usada" /> <UsedPercent str="Percentagem Usada" /> <Format str="Formato" /> <NoFind str="No Encontra" /> <NoMount str="No Montada" /> <IsDefaultSetting str="Sistema ir definir a configurao padro incluindo a rede, confirme por favo  3 r este procedimento" /> <NoBackupDevice str="Por favor insira o dispositivo externo de backup." /> <NoFindConfigFile str="No foi possvel encontrar o ficheiro de Configurao." /> <ConfigFile str="Ficheiro de Configurao" /> <ConfigFileVerErr str="Erro de Configurao da Verso do Ficheiro." /> <IsRestart str="Sistema ir Reiniciar ,por favor confirme este procedimento." /> <NoFindFirmware str="No foi possvel encontrar qualquer firmware!" /> <FirmwareFile str="Ficheiro Firmware" /> <IsFormatHD str="Todos os dados sero perdidos , pretende continuar." /> <OpenFirmwareUpgradeLogErr str="No possvel abrir firmware_upgrade.log" /> <Playback str="Reproduzir" /> <PlaybackTime str="Tempo de Reproduo" /> <Play str="Play" /> <Reverse str="Reverso" /> <Pause str="Pausa" /> <Wait str="Aguarde por favor!" /> <Mute str="Mudo" /> <LiveAudio str="udio ao Vivo" /> <PlaybackAudio str="Reproduo de udio" /> <ConvertToAvi str="Converter Para Avi" /> <NoFindRecord str="No enco  0 ntra a Gravao" /> <TimePeriod str="Perodo de Tempo" /> <SaveTo str="Salvar Para" /> <BackupDeviceFull str="O dispositivo de Backup pode estar cheio, verifique-o por favor." /> <SavePath str="Salve o Caminho" /> <Login str="Login" /> <Logout str="Logout" /> <PictureSet str="Definir a Imagem" /> <Rotation str="Rotao" /> <Normal str="Normal" /> <Mirror str="Espelho" /> <VerticaFlip str="Vertical Flip" /> <ColorLevel str="Nvel de Cr" /> <Brightness str="Brilho" /> <Contrast str="Contraste" /> <Sharpness str="Nitidez" /> <RateControl str="Taxa Controle" /> <Quality str="Qualidade" /> <Bitrate str="Bitrate" /> <VideoOffset str="Vdeo Offset" /> <De-Noise str="De-Rudo" /> <None str="Nenhum" /> <Method str="Mtodo" /> <AutoMode str="Auto Modo" /> <DayMode str="Modo Dia" /> <NightMode str="Modo Noite" /> <Base str="Base" /> <Picture str="Figura" /> <OutOfRange str="Fora Do Intervalo" /> <SystemClose str="Desligar o Sistema ..." /> <On str="On (Ligado)  %" /> <Off str="Off (Desligado)" /> <Vendor str="Vendedor" /> <ModelName str="Nome do Modelo" /> <FriendlyName str="Nome Amigvel" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Intervalo da Porta" /> <ExternalIPAddress str="Endereo IP Externo" /> <Information str="Informao" /> <SelOverPlayerMaxCam str="Selecione mais %d camera!" /> <Event str="Evento" /> <Event_List str="Lista de Eventos" /> <Motion str="Movimento" /> <DI str="Entrada Digital" /> <DO str="Sada Digital" /> <Event_Schedule_List str="Lista Eventos Agendados" /> <Action_List str="Lista Aces" /> <Alarm_Trigger_Type str="Tipo Alarme" /> <Alarm_Seconds str="Alarme Segundos " /> <Buzzer str="Sirene" /> <UnKnow str="Desconhecido" /> <Display_On_CH str="Exibir no Canal" /> <Action_Type str="Tipo de Ao" /> <ERR_MSG_NO_CAM str="Escolha primeiro por favor uma camera ou local!" /> <ERR_MSG_NO_EVENT str="Selecione primeiro por favor um evento!" /> <ERR_MSG_NO_EVENT_SCH str="Selecione primei  ? ro por favor um evento agendado!" /> <ERR_MSG_NO_ACTION str="Selecione primeiro por favor uma ao!" /> <ERR_MSG_TIME_PERIOD str="Erro na configurao do perodo do tempo, verifique as configuraes por favor!" /> <ERR_MSG_TIME_CONFILT str="Conflito na configurao do perodo do tempo, verifique as configuraes por favor!" /> <WeekDays str="Dias da Semana" /> <AlarmSetting str="Configurar Alarme" /> <AlarmCondition str="Condio Alarme" /> <Alarm_True str="TRUE" /> <Alarm_False str="FALSE" /> <Alarm_Seconds str="Alarme Segundos" /> <Alarm_Manual_Stop str="Paragem Manual" /> <Local str="Local" /> <DI_Setting str="DI Configurao" /> <System_Setting str="Configurao Sistema" /> <Log_Viewer str="Visualizar o Log" /> <Event_Log str="Log de Eventos" /> <Device str="Dispositivo " /> <Log_Type str="Tipo Log" /> <Motion_Alarm str="Alarme Movimento" /> <DI_Alarm str="DI Alarme" /> <Input str="Entrada " /> <Limit_Record str="Limitar Gravao" /> <Remark str="Comentrio"   */> <Total str="Total" /> <HDD_Err_Alarm str="Alarme Erro HDD" /> <Disconnect_Alarm str="Desligar o Alarme" /> <Schedule_Trigger str="Agendamento Acionado" /> <Block_Alarm str="Bloquear Alarme" /> <Blur_Alarm str="Alarme Desfocagem" /> <Camera_Move_Alarm str="Alarme Movimento Camera" /> <Address_Book str="Livro de Endereos" /> <Phone str="Telefone" /> <E_MAIL str="E-Mail" /> <Notification str="Notificao" /> <SMTP_Config str="Configurar SMTP" /> <SMTP_Server str="Servidor" /> <SMTP_Port str="Porta" /> <From str="De" /> <SendMailWithoutPicture str="Enviar Mail Sem Imagem" /> <ServerRequireAuthentication str="Servidor Requer Autenticao" /> <SSL str="Servidor Requer Conexo Segura(SSL)" /> <Send_Test str="Enviar Test" /> <FTP_Config str="Configurar FTP" /> <FTP_Server str="Servidor" /> <FTP_Port str="Porta" /> <Retry str="Repetir" /> <RecycleDays str="Reciclar Dias" /> <RecycleSize str="Reciclar Tamanho" /> <Path str="Caminho" /> <AllowCreateFolder str="Pe )rmite Criar Pasta" /> <HTTP_Config str="Configurar HTTP" /> <HTTP_IP str="IP " /> <HTTP_UID str="Conta" /> <HTTP_PWD str="Senha" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Endereo" /> <Proxy_UID str="Proxy Conta" /> <Proxy_PWD str="Proxy Senha" /> <Proxy_Port str="Proxy Porta" /> <TCP_Config str="Configurar TCP" /> <TCP_Server str="Servidor" /> <TCP_Port str="Porta" /> <Alarm_Config str="Configurar Alarme" /> <frame str="Quadro" /> <SnapshotInterval str="Intervalo Instantneo" /> <SendInterval str="Enviar Intervalo" /> <SnapshotTempFolder str="Instantneo Pasta Temp" /> <Mail str="Mail" /> <Subject str="Assunto" /> <body str="Corpo" /> <MS str="MS" /> <second str="Segundo" /> <EventDetect str="Deteco Eventos" /> <EventForceRecord str="Forar Gravao Eventos" /> <EventSetting str="Configurar Eventos" /> <MergeSeconds str="Imergir Segundos" /> <Display str="Exibir " /> <Division str="Diviso" /> <FullScreen str="Ecr Completo" /> <ResetD < IVDefault str="Redefinir Diviso Padro" /> <CancelFullScreen str="Cancelar Ecr Completo" /> <Function str="Funo" /> <SystemManagement str="Gerir Sistema" /> <PTZControl str="PTZControl" /> <Volume str="Volume" /> <Monitor str="Monitor" /> <CancelMute str="Cancelar Mute" /> <TwoWayAudioON str="Iniciar udio Bi-direcional" /> <TwoWayAudioOFF str="Parar udio Bi-direcional" /> <Resolution str="Resoluo" /> <Style str="Estilo" /> <Simple str="Simples" /> <Professional str="Profissional" /> <Output str="Sada " /> <SettoOpen str="Configurar Abertura" /> <SettoClose str="Configurar Fecho" /> <Preset str="Predefinido" /> <Zoom str="Zoom" /> <Wide str="Ampla" /> <Tele str="Tele" /> <Advanced str="Avanado" /> <IsDeletePreset str="Prima 'OK' ir Eliminar Preset." /> <System_Log str="Log do Sistema" /> <PTZ_SPEED str="PTZ Velocidade" /> <PTZ_HOME str="PTZ Home" /> <PTZ_UP str="PTZ Cima" /> <PTZ_DOWN str="PTZ Baixo" /> <PTZ_LEFT str="PTZ Esquerda" /> <PTZ_R IGHT str="PTZ Direita" /> <PTZ_UP_RIGHT str="PTZ Cima Direita" /> <PTZ_UP_LEFT str="PTZ Cima Esquerda" /> <PTZ_DOWN_LEFT str="PTZ Baixo Esquerda" /> <PTZ_DOWN_RIGHT str="PTZ Baixo Direita" /> <PTZ_TOUR_GO str="PTZ Ir ao Tour" /> <PTZ_TOUR_STOP str="PTZ Parar o Tour" /> <PTZ_FOCUS_UP str="PTZ Focar em Cima" /> <PTZ_FOCUS_DOWN str="PTZ Focar em Baixo" /> <PTZ_IRIS_UP str="PTZ Iris em Cima" /> <PTZ_IRIS_DOWN str="PTZ Iris em Baixo" /> <PTZ_FOCUS_AUTO str="PTZ Auto Focus" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ Iniciar Navegao" /> <PTZ_AUTOPAN_STOP str="PTZ Parar Navegao" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="Inicializao do Sistema" /> <SYS_LOG_SYSTEM_SHUTDOWN str="Encerrar o Sistema" /> <SYS_LOG_USER_LOGIN str="Utilizador Login" /> <SYS_LOG_USER_LOGOUT str="Utilizador Logout" /> <SYS_LOG_START_SCH_REC str="Iniciar Agendamento de Gravao" /> <SYS_LOG_END_SCH_REC str="Termi  nar Agendamento de Gravao" /> <SYS_LOG_START_SCH_ALARM str="Iniciar Agendamento Alarme" /> <SYS_LOG_END_SCH_ALARM str="Terminar Agendamento Alarme" /> <SYS_LOG_ENTER_SYS_SETUP str="Entrar na Configurao do Sistema" /> <SYS_LOG_EXIT_SYS_SETUP str="Sar da Configurao do Sistema" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Entrar na Configurao Agendamento Gravao" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Sar da Configurao Agendamento Gravao" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Entrar na Configurao Agendamento Alarme" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Sar da Configurao Agendamento Alarme" /> <SYS_LOG_RTSP_GET_CONNECT str="Obter Conexo" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Perda Conexo" /> <SYS_LOG_SERVER_HTTP_START str="Iniciar Servidor HTTP" /> <SYS_LOG_SERVER_HTTP_STOP str="Parar Servidor HTTP" /> <SYS_LOG_SERVER_RTSP_START str="Iniciar Servidor RTSP" /> <SYS_LOG_SERVER_RTSP_STOP str="Parar Servidor RTSP" /> <SYS_LOG_SERVER_RPB_START str="Iniciar Servidor Reproduo Re  moto" /> <SYS_LOG_SERVER_RPB_STOP str="Parar Servidor Reproduo Remoto" /> <DiskManagement str="Gesto do Disco" /> <DeviceType str="Tipo do Dispositivo" /> <Partition str="Partio" /> <FileSystem str="FileSystem (Sistema Ficheiros)" /> <IsPartition str="O Sistema ir recrear a Partio, confirme por favor este procedimento." /> <Image str="Imagem" /> <Brightness str="Brilho" /> <Contrast str="Contraste" /> <Saturation str="Saturao" /> <Sharpness str="Nitidez" /> <Hue str="Tonalidade" /> <NoSeldesti str="Por favor selecione o Destino!" /> <NoSelSource str="Por favor selecione a Lista de Fontes!" /> <Time_Range str="Intervalo Ficheiro do Tempo" /> <Event_Snapshot str="Evento Instantneos" /> <EventSnapshotViewer str="Evento Visualizao Instantneos" /> <Event_Time str="Hora do Evento" /> <Event_Type str="Tipo de Evento" /> <Change_Resolution str="Resoluo do Ecr foi alterada , Pretende alterar?" /> <Select_All str="Selecionar Todos" /> <InitNetowrk str="Inicia lizar o Modulo de Rede" /> <InitSystemDate str="Inicializar Modulo Data e Hora" /> <InitDisk str="Inicializar Modulo Disco" /> <InitRTSP str="Inicializar Modulo RTSP" /> <NoVideo str="Nenhum Vdeo" /> <Modify str="Modificar" /> <DisplayCount str="Exibir Contagem" /> <Mount str="Montar" /> <Unmount str="Desmontar" /> <EditEmpty str="Confirme por favor se as configuraes esto corretas!" /> <Account str="Conta" /> <FindListLog str="Encontrada excesso %d registos , Exibir apenas primeiro %d registos." /> <Trigger_Interval_Seconds str="Acionar Intervalo em Segundos" /> <Alarm_Always str="Alarme Sempre" /> <LowFPS str="Baixo Bitrate FPS" /> <WithFPS str="Como acima" /> <ShowPW str="Mostrar Senha" /> <SelOverMaxPlayHours str="Selecionada maior %d horas" /> <SelectedCamera str="Camera Selecionada" /> <Codec str="Codec" /> <Switchto str="Mudar para" /> <Filter str="Filtro" /> <AutoSettingNote str="Entre por favor a regra de filtragem ou mantenha vazia para pesquisar todos"  /> <TemplateSetting str="Definir o Padro" /> <SearchByEvent str="Pesquisar Por Evento" /> <Control str="Control" /> <SwitchCamera str="Mudar a Camera" /> <Preview str="Pr-visualizar" /> <SequentialSearch str="Pesquisa Sequncial" /> <Split str="Dividir" /> <PreSearch str="Pesquisa Prvia" /> <SeekTo str="Procurar Para" /> <ShowInformation str="Mostrar Informao" /> <Bitrate_Log str="Bitrate Log" /> <Save str="Salvar " /> <PlaybackControlPad str="Pad Controle Reproduo" /> <FormatFault str="Falha a Formatar" /> <LowBitrateSetting str="Definir Baixo Bitrate" /> <NotConfigured str="No Configurado" /> <Application str="Aplicao" /> <NameOrMailEmpty str="Nome ou E-Mail est em branco" /> <ONVIF_Auth str="ONVIF Autenticao" /> <PIR_Alarm str="PIR Alarme" /> <CameraTamper str="Adulterao da Camera" /> <AudioDetection str="Deteco udio" /> <AutoSwitch str="Auto Switch" /> <CancelAutoSwitch str="Cancelar Auto Switch" /> <MailRepeat str="Voc adicionou o mes mo E-Mail. Altere-o por favor!" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Sobre tudo" /> <PASSED str="PASSOU" /> <FAILED str="FALHOU" /> <Raw_Read_Error_Rate str="Erro Taxa Matria Leitura" /> <Throughput_Performance str="Desempenho do Rendimento" /> <Spin_Up_Time str="Tempo Acelarao" /> <Start_Stop_Count str="Comear e Parar a Contagem" /> <Reallocated_Sector_Ct str="Contagem Sectores Realocados" /> <Seek_Error_Rate str="Taxa Erro de Busca" /> <Seek_Time_Performance str="Desempenho do Tempo de Busca" /> <Power_On_Hours str="Horas Ligadas" /> <Spin_Retry_Count str="Contagem Tentativas Rotao" /> <Calibration_Retry_Count str="Contagem Tentativas Calibrao" /> <Power_Cycle_Count str="Contagem Ciclos Energia" /> <Power_Off_Retract_Count str="Contagem Desligar Retrair" /> <Load_Cycle_Count str="Contagem Ciclos de Carga" /> <Temperature_Celsius str="Temperatura Celsius" /> <Reallocated_Event_Count str="Contagem Eventos Realocados" /> <Current_Pending_Sector str="Sector  Actual Pendente" /> <Offline_Uncorrectable str="Desligado Irrecupervel" /> <UDMA_CRC_Error_Count str="Erro Contagem UDMA CRC" /> <Multi_Zone_Error_Rate str="Erro Taxa Multi Zona" /> <SMART_RAW_VALUE str="Valor Raw" /> <SMART_WORST str="Referncia" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Exibir o Rcio" /> <FitWindow str="Caber na Janela" /> <KeepRatio str="Manter o Rcio" /> <Joystick str="Joystick" /> <Joystick_Information str="Informao do Joystick" /> <Joystick_Model str="Modelo do Joystick" /> <Axis_Count str="Axis Contagem" /> <Button_Count str="Boto Contagem" /> <Axis_X str="Axis X Valor" /> <Axis_Y str="Axis Y Valor" /> <Axis_Z str="Axis Z Valor" /> <Buttons_Status str="Boto Status" /> <Joystick_Buttons_Setting str="Configurar Botes Joystick" /> <Button str="Boto" /> <Next_Division str="Prxima Diviso" /> <Previous_Division str="Diviso Anterior" /> <Next_Window str="Prxima Janela" /> <Previous_Window str="Janela Anterior" /> <  Switch_Division_One str="Mudar Uma Diviso" /> <Axis_Z_ID str="Axis Z ID" /> <RAID_Err_Alarm str="RAID Alarme de Erro" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Finanlizar conexo"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="O sistema no pode carregar as informaes de configurao."/> <Refresh str="Por favor atualize!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Fazendo Backup, aguarde..."/> <Converting str="Convertendo, aguarde..."/> <ShowDate str="Mostrar Data"/> <ShowTime str="Mostrar Horrio"/> <Subtitle str="Subtitle"/> <PreSecond str="Segundo anterior"/> <  PreFrame str="Quadro anterior"/> <NextSecond str="Segundo posterior"/> <NextFrame str="Quadro posterior"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Zoom digital" /> <MotionSearch str="Busca por movimento" /> <TimeSplit str="Intervalo de tempo" /> <ShowDetailWindow str="Mostrar Janela de Detalhe" /> <FirstPage str="Primeira pgina" /> <PrePage str="Pgina anterior" /> <NextPage str="Pgina seguinte" /> <LastPage str="ltima pgina" /> <DetailPicture str="Detalhe da imagem" /> <SelectTime str="Selecione horrio" /> <ErrStartEndTm str="Erro na configurao do tempo inicial ou final."/> <SearchSet str="Estabelecer busca" /> <ShowSearchImage str="Mostrar imagem" /> <ShowDetectMark str="Mostrar deteco" /> <DetectInterval str="Intervalo de Deteco" /> <Exit str="Sair" /> <Grayscale str="Escala monocromtica cinza" /> <Softness str="Suave" /> <Reset str="Restaurar" /> <Print str="Imprimir" /> <RetryAgain str="Por favor tente novamente mais tarde!" /> <Firm wareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="udio bidirecional em uso!"/> <Weekly str="Semanal"/> <SAVEAS str="Save As..."/> <Send_To str="Enviar para"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Mostrar mensagem na imagem ao vivo"/> <ACTION_DESC_MAIL str="Enviar e-mail quando houver um evento"/> <ACTION_DESC_VOICE str="Soar alarme quando houver um evento"/> <ACTION_DESC_DO str="Acionar Sada I/O quando houver um evento"/> <ACTION_DESC_FTP str="Carregar as imagens para um servidor FTP"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <E VENT_DESC_MOTION str="Detectar situao da Deteco de Movimento"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detectar situao de mudana na Entrada I/O"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Seleo de eventos de alarme"/> <CREATE_NEW_FOLDER str="Criar uma nova pasta"/> <CHANGE_NAME str="Trocar nome"/> <TIME_SET_ERROR str="Horrio incorreto, verifique a configurao."/> <Export str="Exportar"/> <SEL_VIEW_CH str="Selecionar canal de exibio"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Iniciar todos os   monitoramentos"/> <UPDATE_FAIL str="Configuraes no puderam ser carregadas, tente novamente!"/> <DI_REC_TRIGGER str="Gravao por I/O de entrada acionada por:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Falha ao acessar parametros no equipamento. O sistema ir usar os parametros padres"/> <NO_CAM_NAME str="Voc no inseriu um ttulo para esta cmera. O sistema deve utilizar o ttulo padro?"/> <ERR_SETUP str="Informaes de configurao incorretas. Reconfigure com os dados corretos."/> <DEL_CAM_COFIRM str="Voc tem certeza que quer deletar o equipamento '%s' da lista?"/> <ADD_CAM_ERR_ALREADY_HAS str="J existe um equipamento com nome '%s' na lista. Reconfigure com outro nome."/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Exibir camer a ao vivo"/> <SHOW_PB_CAM str="Exibir reproduo da cmera"/> <DELETE_CAM str="Remover exibiao ao vivo"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str  ="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/>   <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root> 3 lang_greece.xmlQjScSYjS%<root> <Font Name="unifont" /> <LanguageName str="" /> <LanguageNameEng str="Greece" /> <Sch_Monitor str=" " /> <Alarm_Monitor str=" " /> <Week0 str="" /> <Week1 str="" /> <Week2 str="" /> <Week3 str="" /> <Week4 str="" /> <Week5 str="" /> <Week6 str="" /> <WeekS0 str="" /> <WeekS1 str="" /> <WeekS2 str="" /> <WeekS3 str="" /> <WeekS4 str="" /> <WeekS5 str="" /> <WeekS6 str="" /> <Disk_Free str="" /> <Error str="" /> <LoginError str=" ,        " /> <DeviceInfo str=" " /> <DeviceTitle str=" " /> <SoftwareVersion str=" " /> <Characters str="" /> <DateTimeInfo str="  " /> <CurrentDate str=" " /> <CurrentTime str=" " /> <Adjust str="" /> <Manua*l str="" /> <SyncNTP str="  NTP" /> <Setting str="" /> <NTPServer str="NTPServer" /> <Test str="" /> <NTPSyncInterval str="NTP Sync " /> <Hour str="" /> <Timezone str=" " /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, )" /> <Timezone3 str="GMT-11 (Midway Isl., )" /> <Timezone4 str="GMT-10 (, Aleutian Isl.)" /> <Timezone5 str="GMT-09 ()" /> <Timezone6 str="GMT-08 ( ,  , )" /> <Timezone7 str="GMT-07 (Calgary, ,   )" /> <Timezone8 str="GMT-06 (, , Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 ()" /> <Timezone10 str="GMT-05 ( , , , DC)" /> <Timezone11 str="GMT-04 ()" /> <Timezone12 str="GMT-04 ()" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, ) )" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (,    Isl.)" /> <Timezone18 str="GMT (, , , Reykjavik)" /> <Timezone19 str="GMT +01 (, , , , )" /> <Timezone20 str="GMT +02 (, , , )" /> <Timezone21 str="GMT +02 ()" /> <Timezone22 str="GMT +02 ()" /> <Timezone23 str="GMT +02 ()" /> <Timezone24 str="GMT +02 ()" /> <Timezone25 str="GMT +03 (, )" /> <Timezone26 str="GMT +03 ()" /> <Timezone27 str="GMT +03:30 ()" /> <Timezone28 str="GMT +04 (Abu , )" /> <Timezone29 str="GMT +04:30 ()" /> <Timezone30 str="GMT +05 (, , )" /> <Timezone31 str="GMT +05:30 (, ,  )" /> <Timezone32 str="GMT +05:45 ()" /> <Timezone33 str="GMT +06 (, )" /> <Timezone34 str="GMT +06:30 (Rangoon)" /> <Timezone35< str="GMT +07 (, , )" /> <Timezone36 str="GMT +08 (,   ,  ,  , )" /> <Timezone37 str="GMT +09 (, , , )" /> <Timezone38 str="GMT +09:30 (Darwin)" /> <Timezone39 str="GMT +09:30 ()" /> <Timezone40 str="GMT +10 (Hobart)" /> <Timezone41 str="GMT +10 (, , )" /> <Timezone42 str="GMT +11 (Solomon Isl.)" /> <Timezone43 str="GMT +11:30 (Norfolk)" /> <Timezone44 str="GMT +12 (Auckland, Wellington)" /> <Timezone45 str="GMT +12 ()" /> <Timezone46 str="GMT +12 ()" /> <Timezone47 str="GMT +12 (Marshall Isl.)" /> <Timezone48 str="GMT +13 (Tongatapu, )" /> <Timezone49 str="GMT +12:45 (Chatham Island)" /> <DST str=" " /> <Disable str="" /> <Enable str="" /> <DSTStart str="  " /> <DSTEnd str="  " /> <DSTOffset str="  Offset" /> <AutoLogin str=" " /> <UID str="& " /> <PWD str="" /> <System str="" /> <AutoFullScreen str="  " /> <Language str="" /> <Audio str="" /> <InputGain str="Gain " /> <OutputGain str="Gain " /> <KeyinNTPAddr str=" Keyin   NTP!" /> <Success str="" /> <Fault str="" /> <OK str="OK" /> <Cancel str="" /> <SetDateTime str="  " /> <Date str="" /> <Time str="" /> <AutoSetting str=" " /> <CameraName str=" " /> <ModelName str=" " /> <IPAddress str=" IP" /> <HTTPPort str=" HTTP" /> <RTSPPort str=" RTSP" /> <Camera str="" /> <Schedule str="" /> <Network str="" /> <User str="" /> <MotionDetection str=" " /> <Snapshot str="" /> <Maintenance str="" /> <Add str="" /> <Delete str="" /> <Update str="" /> <Clear3 str="" /> <Search str="" /> <AutoDetect str=" " /> <Detect str="" /> <MACAddress str=" MAC" /> <Configuration str="" /> <Copy str="" /> <StartTime str=" " /> <EndTime str=" " /> <RecordType str=" " /> <PreAlarm str="" /> <PostAlarm str="PostAlarm" /> <RTC str="" /> <DIDetect str="DI " /> <TimeSelErr str="    !" /> <NoSelSch str="   !" /> <Warning str="" /> <WeekCopyToAll str="          " /> <DHCP str="   IP (DHCP)" /> <SubnetMask str=" " /> <Gateway str="" /> <DNS_DHCP str=" DNS   DHCP" /> <PrimaryDNS str=" DNS" /> <SecondaryDNS str=" DNS" /> <PPPoE str="PPPoE" /> <Status str="" /> <Start str="" /> <S0 top str="" /> <Server str="" /> <IPUsed str="     !" /> <IPNoUsed str="     !" /> <Group str="" /> <Description str="" /> <ConfirmPWD str=" " /> <LiveView str=" " /> <Playback str="" /> <Record str="" /> <PTZ str="PTZ" /> <TwoWayAudio str="  " /> <CheckConfirmPWD str="     ." /> <UIDEmpty str="   ." /> <UIDRepeat str="    .    !" /> <NoSelUID str="  !" /> <MotionID str="ID " /> <Name str="" /> <Included str="" /> <Excluded str="" /> <ObjectSize str=" " /> <Sensitivity str="" /> <NoSelCamera str="  !" /> <OverMaxMotion10 str="    10." /> <NoSel%Motion str="   ." /> <MotionSettingEnpty str="     ." /> <SourceSnapshotList str="  Snapshot" /> <SourceSnapshotPreview str="  Snapshot" /> <DestinationSnapshotList str="  Snapshot" /> <DestinationSnapshotPreview str="  Snapshot" /> <NoFindSD str="    SD!" /> <NoSelImg str="  !" /> <SameSnapshotImgName str="      SD .    !" /> <IsAutoSetting str="     ;" /> <GetParamError str="  !" /> <CameraNameEmpty str=" keyin  !" /> <IPAddressEmpty str=" keyin  IP!" /> <UIDEmpty str=" keyin  !" /> <HttpPortEmpty str=" keyin Http !" /> <CameraNameTheSame str="    !" /> <CamParam str=" " />% <Profile str="" /> <FPS str="FPS" /> <Protocol str="" /> <EnableAudio str=" " /> <AudioRecord str=" " /> <InputError str=" " /> <DefaultSetting str=" " /> <FactoryDefaultSetting str=" " /> <Default str="" /> <BackupSetting str="  " /> <Backup str="  " /> <RestoreSetting str=" " /> <Restore str="" /> <FirmwareUpgrade str=" Firmware" /> <Upgrade str="" /> <Browse str="" /> <SystemRestart str="  " /> <Restart str="" /> <HDInformation str="  " /> <SDInformation str="SD Card " /> <TotalCapacity str=" " /> <FreeCapacity str=" " /> <UsedCapacity str=" " /> <UsedPercent str=" " /> <Format str="" /> 0 <NoFind str=" " /> <NoMount str=" " /> <IsDefaultSetting str="       :  ,      " /> <NoBackupDevice str="    backup." /> <NoFindConfigFile str="      ." /> <ConfigFile str="  " /> <ConfigFileVerErr str="   ." /> <IsRestart str="   ,      ." /> <NoFindFirmware str="     firmware!" /> <FirmwareFile str=" Firmware" /> <IsFormatHD str="    ,     contiue." /> <OpenFirmwareUpgradeLogErr str="    firmware_upgrade.log" /> <Playback str="" /> <PlaybackTime str=" " /> <Play str="" /> <Reverse str="" /> <Pause str="" /> <Wait str="  3 !" /> <Mute str="" /> <LiveAudio str="LiveAudio" /> <PlaybackAudio str=" " /> <ConvertToAvi str="  AVI" /> <NoFindRecord str="  Record" /> <TimePeriod str=" " /> <SaveTo str=" " /> <BackupDeviceFull str="   ,   ." /> <SavePath str="Save Path" /> <Login str="" /> <Logout str="" /> <PictureSet str="Set Picture" /> <Rotation str="" /> <Normal str="" /> <Mirror str="" /> <VerticaFlip str="Vertica Flip" /> <ColorLevel str=" " /> <Brightness str="" /> <Contrast str="" /> <Sharpness str="" /> <RateControl str="   " /> <Quality str="" /> <Bitrate str="Bitrate" /> <VideoOffset str="Offset " /> <De-Noise str="De-Noise" /> <None str="" /> <Method str="" /> <AutoMode str=" Auto" /> <DayMode str=" " />  & <NightMode str=" " /> <Base str="" /> <Picture str="" /> <OutOfRange str="Out Of Range" /> <SystemClose str="    ..." /> <On str="" /> <Off str=" " /> <Vendor str="" /> <ModelName str=" " /> <FriendlyName str=" " /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str=" " /> <ExternalIPAddress str=" IP Address" /> <Information str="" /> <SelOverPlayerMaxCam str=" % d !" /> <Event str="" /> <Event_List str=" " /> <Motion str="" /> <DI str=" " /> <DO str=" " /> <Event_Schedule_List str="Event List " /> <Action_List str=" " /> <Alarm_Trigger_Type str=" " /> <Alarm_Seconds str=" " /> <Buzzer str="" /> <UnKnow str="" /> <Display_On_CH str="  " /> <Action_Type str="  < " /> <ERR_MSG_NO_CAM str="       !" /> <ERR_MSG_NO_EVENT str="    !" /> <ERR_MSG_NO_EVENT_SCH str="      !" /> <ERR_MSG_NO_ACTION str="    !" /> <ERR_MSG_TIME_PERIOD str="    ,     !" /> <ERR_MSG_TIME_CONFILT str="    ,   !" /> <WeekDays str=" " /> <AlarmSetting str=" " /> <AlarmCondition str=" " /> <Alarm_True str="" /> <Alarm_False str="FALSE" /> <Alarm_Seconds str=" " /> <Alarm_Manual_Stop str=" " /> <Local str="" /> <DI_Setting str="DI " /> <System_Setting str=" " /> <Log_Viewer str="Log Viewer" /> <Event_Log str=" " /> <Device str="" /> <Log_Type str="  )" /> <Motion_Alarm str=" " /> <DI_Alarm str="DI " /> <Input str="" /> <Limit_Record str=" " /> <Remark str="" /> <Total str="" /> <HDD_Err_Alarm str="HDD  " /> <Disconnect_Alarm str=" " /> <Schedule_Trigger str=" Trigger" /> <Block_Alarm str=" Block" /> <Blur_Alarm str="Blur " /> <Camera_Move_Alarm str="  Move" /> <Address_Book str=" " /> <Phone str="" /> <E_MAIL str="E-Mail" /> <Notification str="" /> <SMTP_Config str=" SMTP" /> <SMTP_Server str="" /> <SMTP_Port str="" /> <From str="" /> <SendMailWithoutPicture str=" Mail  " /> <ServerRequireAuthentication str="   " /> <SSL str="Server  Conntion Secure (SSL)" /> <Send_Test str=" Test" /> <FTP_Config str="FTP " /> <F*TP_Server str="" /> <FTP_Port str="" /> <Retry str="" /> <RecycleDays str="RecycleDays" /> <RecycleSize str="RecycleSize" /> <Path str="" /> <AllowCreateFolder str="  " /> <HTTP_Config str="HTTP " /> <HTTP_IP str="IP" /> <HTTP_UID str="" /> <HTTP_PWD str="" /> <HTTP_CGI str="CGI" /> <Proxy_Address str=" " /> <Proxy_UID str=" " /> <Proxy_PWD str=" " /> <Proxy_Port str=" " /> <TCP_Config str=" TCP" /> <TCP_Server str="" /> <TCP_Port str="" /> <Alarm_Config str=" " /> <frame str="" /> <SnapshotInterval str=" Snapshot" /> <SendInterval str=" " /> <SnapshotTempFolder str="  Temp" /> <Mail str="" /> <Subject str="" /> <body str="" /> <MS str="MS" /> <second str="" /> <EventDetect str="?  Event" /> <EventForceRecord str="  Force" /> <EventSetting str=" Event" /> <MergeSeconds str=" " /> <Display str="" /> <Division str="" /> <FullScreen str=" " /> <ResetDIVDefault str="  Division" /> <CancelFullScreen str=" Full Screen" /> <Function str="" /> <SystemManagement str=" " /> <PTZControl str="PTZControl" /> <Volume str="" /> <Monitor str="" /> <CancelMute str="  " /> <TwoWayAudioON str="   " /> <TwoWayAudioOFF str="   " /> <Resolution str="" /> <Style str="" /> <Simple str="" /> <Professional str="" /> <Output str="" /> <SettoOpen str=" " /> <SettoClose str="  " /> <Preset str="Preset" /> <Zoom str="Zoom" /> <Wide str="" /> <Tele str="Tele" /> <Advanced str="" /> <IsDeletePreset str=" OK   Preset." /> <System_Log str=" " /> <PTZ_SPEED str="PTZ " /> <PTZ_HOME str="PTZ " /> <PTZ_UP str="PTZ Up" /> <PTZ_DOWN str="PTZ Down" /> <PTZ_LEFT str="PTZ " /> <PTZ_RIGHT str="PTZ " /> <PTZ_UP_RIGHT str="PTZ  " /> <PTZ_UP_LEFT str="PTZ  " /> <PTZ_DOWN_LEFT str="PTZ  " /> <PTZ_DOWN_RIGHT str="PTZ  " /> <PTZ_TOUR_GO str="PTZ Tour Go" /> <PTZ_TOUR_STOP str="PTZ Tour " /> <PTZ_FOCUS_UP str="PTZ Focus Up" /> <PTZ_FOCUS_DOWN str="PTZ Focus Down" /> <PTZ_IRIS_UP str="PTZ Iris Up" /> <PTZ_IRIS_DOWN str="PTZ Iris Down" /> <PTZ_FOCUS_AUTO str="PTZ  " /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ  " /> <PTZ_AUTOPAN_STOP str="PTZ Navigation " /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="   " /> <SYS_LOG_SYSTEM_SHUTDOWN str="   " /> <SYS_LOG_USER_LOGIN str=" " /> <SYS_LOG_USER_LOGOUT str=" " /> <SYS_LOG_START_SCH_REC str="  " /> <SYS_LOG_END_SCH_REC str="  " /> <SYS_LOG_START_SCH_ALARM str="  " /> <SYS_LOG_END_SCH_ALARM str="  " /> <SYS_LOG_ENTER_SYS_SETUP str="   " /> <SYS_LOG_EXIT_SYS_SETUP str="    " /> <SYS_LOG_ENTER_SCH_REC_SETUP str="   " /> <SYS_LOG_EXIT_SCH_REC_SETUP str="   " /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="   " /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="   " /> <SYS_LOG_RTSP_GET_CONNECT str=" " /> <SYS_LOG_RTSP_LOSE_CONNECT str="  " /> <SYS_LOG_SERVER_HTTP_START str="HTTP   " /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP  " /> <SYS_LOG_SERVER_RTSP_START str="RTSP  " /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP  " /> <SYS_LOG_SERVER_RPB_START str="   " /> <SYS_LOG_SERVER_RPB_STOP str="Remote   " /> <DiskManagement str=" " /> <DeviceType str=" " /> <Partition str="" /> <FileSystem str="FileSystem" /> <IsPartition str="   - Partition,      ." /> <Image str="" /> <Brightness str="" /> <Contrast str="" /> <Saturation str="" /> <Sharpness str="" /> <Hue str="" /> <NoSeldesti str="   !" /> <NoSelSource str="   !" /> <Time_Range str="  " /> <Event_Snapshot str=" Event" /> <EventSnapshotViewer str=" Snapshot Viewer" /> <Event_Time str=" Event" /> <Event_Type str=" " /> <Change_Resolution str="    ,   ;" /> <Select_All str=" All" /> <InitNetowrk str="  " /> <InitSystemDate str="Module   " /> <InitDisk str=" Disk " /> <InitRTSP str="RTSP  " /> <NoVideo str="  " /> <Modify str="" /> <DisplayCount str=" " /> <Mount str="" /> <Unmount str="" /> <EditEmpty str="       !" /> <Account str="" /> <FindListLog str="  % d ,   % d ." /> <Trigger_Interval_Seconds str="Trigger  " /> <Alarm_Always str=" " /> <LowFPS str="Low FPS Bitrate" /> <WithFPS str=" " /> <ShowPW str="  " /> <Sel OverMaxPlayHours str=" % d " /> <SelectedCamera str=" " /> <Codec str="Codec" /> <Switchto str=" " /> <Filter str="" /> <AutoSettingNote str="            " /> <TemplateSetting str=" " /> <SearchByEvent str="  " /> <Control str="" /> <SwitchCamera str="  " /> <Preview str="" /> <SequentialSearch str=" " /> <Split str="" /> <PreSearch str=" " /> <SeekTo str=" " /> <ShowInformation str=" " /> <Bitrate_Log str=" bitrate" /> <Save str="" /> <PlaybackControlPad str="  Pad" /> <FormatFault str=" Format" /> <LowBitrateSetting str="  Bitrate" /> <NotConfigured str="  " /> <Application str="" /> <NameOrMailEmpty str="  E-Mail  " /> <ONVIF_Auth str="Authentication ONVIF" /> <PIR_Alarm str=" PIR" /> <CameraTamper str="Tamper " /> <AudioDetection str=" " /> <AutoSwitch str=" Auto" /> <CancelAutoSwitch str=" Switch Auto" /> <MailRepeat str="     e-mail.    !" /> <SMART str="S.M.A.R.T" /> <OVERALL str="  " /> <PASSED str="PASSED" /> <FAILED str="" /> <Raw_Read_Error_Rate str="   " /> <Throughput_Performance str=" Throughput" /> <Spin_Up_Time str="Spin Up " /> <Start_Stop_Count str="Start Stop Count" /> <Reallocated_Sector_Ct str="  " /> <Seek_Error_Rate str="  " /> <Seek_Time_Performance str="  " /> <Power_On_Hours str="Power On " /> <Spin_Retry_Count str="Spin  Count" /> <Calibration_Retry_Count str="  " /> <Power_Cycle_Count str=" Count " /> <Power_Off_Retract_Count str="Power Off  " /> <Load_Cycle_Count str="Load Cycle Count" /> <Temperature_Celsius str=" " /> <Reallocated_Event_Count str=" Count Event" /> <Current_Pending_Sector str="  " /> <Offline_Uncorrectable str="  " /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="   " /> <SMART_RAW_VALUE str=" Value" /> <SMART_WORST str="" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str=" " /> <FitWindow str="  " /> <KeepRatio str=" " /> <Joystick str="" /> <Joystick_Information str=" Joystick" /> <Joystick_Model str=" Joystick" /> <Axis_Count str=" Count" /> <Button_Count str="Count Button" /> <Axis_X str=" X Value" /> <Axis_Y str=" Y Value" /> <Axis_Z str="  Z Value" /> <Buttons_Status str=" " /> <Joystick_Buttons_Setting str="Joystick  " /> <Button str="" /> <Next_Division str=" Division" /> <Previous_Division str=" Division" /> <Next_Window str=" " /> <Previous_Window str=" " /> <Switch_Division_One str=" Division One" /> <Axis_Z_ID str=" Z ID" /> <RAID_Err_Alarm str="RAID  " /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str=" "/> <ConnectFail str=" "/> <GetSettingValueErr str="  "/> <Refresh str=" !"/> <IE_Protected_Open st r="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="  .  ."/> <Converting str="  .  ."/> <ShowDate str=" "/> <ShowTime str=" "/> <Subtitle str=""/> <PreSecond str=". ."/> <PreFrame str=". "/> <NextSecond str=". ."/> <NextFrame str=". "/> <LowBitrate str=" "/> <DigitalZoom str=" " /> <MotionSearch str=" " /> <TimeSplit str=" " /> <ShowDetailWindow str=" " /> <FirstPage str="" /> <PrePage str="" /> <NextPage str="" /> <LastPage str="" /> <DetailPicture str="" /> <SelectTime str=" " /> <ErrStartEndTm str="    !" /> <SearchSet str=" " /> <ShowSearchImage str="  " /> <ShowDetectMark str="  " /> <DetectInterval str=" .:" /> <Exit str="" /> <Grayscale str=" " /> <Softness str="" /> <Reset str="" /> <Print str="" /> <RetryAgain str="  !" /> <FirmwareUpgrade_msg str=" ,   "/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="  !"/> <Weekly str=""/> <SAVEAS str=" "/> <Send_To str=" "/> <ACTION_DESC_SNAPSHOT str="  "/> <ACTION_DESC_RECORD str="  "/> <ACTION_DESC_DISPLAY str="     "/> <ACTION_DESC_MAIL str="   "/> <ACTION_DESC_VOICE str="    "/> <ACTION_DESC_DO str="    "/> <ACTION_DESC_FTP str="    FTP"/> <ACTION_DESC_BUZZER str="  "/> <ACTION_DESC_TCP str="    TCP"/> <ACTION_DESC_HTTP str="    HTTP"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="    "/> <EVENT_DESC_BLOCK str="      "/> <EVENT_DESC_BLUR str="    "/> <EVENT_DESC_CAM_MOVE str="    "/> <EVENT_DESC_DI str="     "/> <EVENT_DESC_HDD_ERR str="   "/> <EVENT_DESC_DISCONNECT str="  "/> <EVENT_DESC_FORCE str=" / "/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="   "/> <CREATE_NEW_FOLDER str=" "/> <CHANGE_NAME str=" "/> <TIME_SET_ERROR str="  ,  "/> <Export str=""/> <SEL_VIEW_CH str=" "/> <SYSTEM_UPDATEMESSAGE str="     40 ."/> <START_MONITOR_ALL str="  "/> <UPDATE_FAIL str="   ,   !"/> <DI_REC_TRIGGER str="   :"/> <PASTE str=""/> <PASTE_MON_FRI str="    "/> <PASTE_SAT_SUN str="    "/> <PASTE_ALL_CAM str="     "/> <APPLY_ALL str="  "/> <UN_SELECT_ALL str=" "/> <GET_PARAM_FAIL_USE_DEFAULT str="  ,    !"/> <NO_CAM_NAME str="   ,    ;"/> <ERR_SETUP str="  ,  "/> <DEL_CAM_COFIRM str="       '%s'   ;"/> <ADD_CAM_ERR_ALREADY_HAS str=" '%s'    ,   "/> <MOTION_GET_DATA_ERR str="  "/> <SHOW_LIVE_CAM str="  "/> <SHOW_PB_CAM str=" "/> <DELETE_CAM str="  "/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Siz e"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str= "File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root>? lang_czech.xmlQjScSYjS0<root> <Font Name="unifont" /> <LanguageName str=" esko" /> <LanguageNameEng str="Czech" /> <Sch_Monitor str="Plny" /> <Alarm_Monitor str="Alarmy" /> <Week0 str="Nedle" /> <Week1 str="Pondl" /> <Week2 str="ter" /> <Week3 str="StYeda" /> <Week4 str=" tvrtek" /> <Week5 str="Ptek" /> <Week6 str="Sobota" /> <WeekS0 str="Ne" /> <WeekS1 str="Po" /> <WeekS2 str="t" /> <WeekS3 str="St" /> <WeekS4 str=" t" /> <WeekS5 str="P" /> <WeekS6 str="So" /> <Disk_Free str="Voln" /> <Error str="Chyba" /> <LoginError str="Chyba pYihlaen. `patn jmno nebo heslo." /> <DeviceInfo str="Info zdroje" /> <DeviceTitle str="Jmno zdroje" /> <SoftwareVersion str="SW verze" /> <Characters str="Znako" /> <DateTimeInfo str="Date Time Info" /> <CurrentDate str="Aktuln datum" /> <CurrentTime str="aktuln as" /> <Adjust str="Upravit" /> <Manual str="Ru n" /> <SyncNTP str="Synchronizovat s NTP" /> <Setting str="Nastaven" /> <NTPServer str="NTPServer" /> <Tes?t str="Test" /> <NTPSyncInterval str="NTP Sync Interval" /> <Hour str="Hodin" /> <Timezone str=" asov psmo" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Azores, Cap Verde Isl.)" /> <Timezo<ne18 str="GMT (Dublin, Lisbon, London, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berlin, Rome, Stockholm, Warsaw)" /> <Timezone20 str="GMT+02 (Athens, Helsinki, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="GMT+03 (Moscow, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)" /> <Timezone37 str="GMT+09 (Seoul, Osaka, Sapporo, Tokyo)" /> <) Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+12:45 (Chatham" /> <DST str="Daylight Saving Time" /> <Disable str="Vypnout" /> <Enable str="Zapnout" /> <DSTStart str="Daylight Saving Time Start" /> <DSTEnd str="Daylight Saving Time Konec" /> <DSTOffset str="Daylight Saving Time Offset" /> <AutoLogin str="Auto Login" /> <UID str="U~ivatelsk jmno" /> <PWD str="Heslo" /> <System str="System" /> <AutoFullScreen str="Auto Full Screen" /> <Language str="Jazyk" /> <Audio str="Audio" /> <InputGain str="Vstupn zeslen3" /> <OutputGain str="Vstupn zeslen" /> <KeyinNTPAddr str="Prosm vlo~te NTP server adresu" /> <Success str="span" /> <Fault str="Chyba" /> <OK str="OK" /> <Cancel str="Zruait" /> <SetDateTime str="Nastaven data a asu" /> <Date str="Datum" /> <Time str=" as" /> <AutoSetting str="Auto nastaven" /> <CameraName str="Jmno kamery" /> <ModelName str="Model" /> <IPAddress str="IP adresa" /> <HTTPPort str="HTTP Port" /> <RTSPPort str="RTSP Port" /> <Camera str="kamera" /> <Schedule str="Plnovn" /> <Network str="Se" /> <User str="U~ivatel" /> <MotionDetection str="Detekce pohybu" /> <Snapshot str="Snmek" /> <Maintenance str="Maintenance" /> <Add str="PYidat" /> <Delete str="Vymazat" /> <Update str="Update" /> <Clear str="Vy istit" /> <Search str="Hledat" /> <AutoDetect str="Auto detekce" /> <Detect str="Detekce" /> <MACAddress str="MAC Address" /> <Configuration str="Konfigurace" /> <Copy str="Koprovat" /> <StartTime str="Po te n as"& /> <EndTime str="Koncov as" /> <RecordType str="Druh nahrvn" /> <PreAlarm str="PreAlarm" /> <PostAlarm str="PostAlarm" /> <RTC str="Round Clock" /> <DIDetect str="DI detekce" /> <TimeSelErr str=" asov rozsah je neplatn!" /> <NoSelSch str="Prosm, zvolte pln." /> <Warning str="Varovn" /> <WeekCopyToAll str="Tdenn pln bude stejn jako zvolen." /> <DHCP str="Zskat IP adresu automaticky (DHCP)." /> <SubnetMask str="Subnet Mask" /> <Gateway str="Gateway" /> <DNS_DHCP str="Zskat IP adresu z DHCP." /> <PrimaryDNS str="Primary DNS" /> <SecondaryDNS str="Secondary DNS" /> <PPPoE str="PPPoE" /> <Status str="Stav" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Server" /> <IPUsed str="Tato adresa se pou~v." /> <IPNoUsed str="Tuto adresu mo~ete pou~t." /> <Group str="Skupina" /> <Description str="Popis" /> <ConfirmPWD str="Potvrzen hesla" /> <LiveView str="Live View" /> <Playback str="playback" /> <Record str="nahrvn" /> <PTZ st% r="PTZ" /> <TwoWayAudio str="Obousmrn audio" /> <CheckConfirmPWD str="Prosm, znovu zkontrolujte heslo." /> <UIDEmpty str="ZmHte u~ivatelsk jmno" /> <UIDRepeat str="PYidali jste stejn jmno. Prosm, zmHte ho." /> <NoSelUID str="Prosm, zvolte pYstup." /> <MotionID str="Motion ID" /> <Name str="Jmno" /> <Included str="V etn" /> <Excluded str="Mimo" /> <ObjectSize str="Velikost objektu" /> <Sensitivity str="Citlivost" /> <NoSelCamera str="Prosm, zvolte kameru" /> <OverMaxMotion10 str="Maximum detekc je 10." /> <NoSelMotion str="Prosm, zvolte detekci." /> <MotionSettingEnpty str="Nejprve nastavte detekci" /> <SourceSnapshotList str="Seznam zdrojo snapshoto" /> <SourceSnapshotPreview str="Snapshot Preview" /> <DestinationSnapshotList str="Destination Snapshot List" /> <DestinationSnapshotPreview str="Destination Snapshot Preview" /> <NoFindSD str="Prosm, vlo~te SD kartu" /> <NoSelImg str="Prosm, zvolte obraz." /> <SameSnapshotImgName str="Stejn jmno sou0boru. Bude pYehrn." /> <IsAutoSetting str="Chcete automaticky nastavit kameru?" /> <GetParamError str="Get Parameter Error!" /> <CameraNameEmpty str="Vlo~te jmno kamery." /> <IPAddressEmpty str="Vlo~te IP adresu" /> <UIDEmpty str="Vlo~te jmno" /> <HttpPortEmpty str="Vlo~te HTTP port" /> <CameraNameTheSame str="Stejn jmno kamery" /> <CamParam str="Parametry kamery" /> <Profile str="Profil" /> <FPS str="FPS" /> <Protocol str="Protokol" /> <EnableAudio str="zapnout audio" /> <AudioRecord str="nahrvn zvuku" /> <InputError str="Input Error" /> <DefaultSetting str="Doporu en nastaven" /> <FactoryDefaultSetting str="Tovrn nastaven" /> <Default str="Doporu en" /> <BackupSetting str="Nastaven zlohy" /> <Backup str="Zloha" /> <RestoreSetting str="nastaven obnoven" /> <Restore str="obnoven" /> <FirmwareUpgrade str="Firmware Upgrade" /> <Upgrade str="Upgrade" /> <Browse str="Prochzet" /> <SystemRestart str="System Restart" /> <Restart str="Restart" 0/> <HDInformation str="Informace o HDD" /> <SDInformation str="informace o SD kart" /> <TotalCapacity str="celkov kapacita" /> <FreeCapacity str="Voln kapacita" /> <UsedCapacity str="Pou~it kapacita" /> <UsedPercent str="Vyu~ito %" /> <Format str="Format" /> <NoFind str="nenalezeno" /> <NoMount str="nenalezeno" /> <IsDefaultSetting str="Systm se nastav do tovrnho nastaven. Potvrte." /> <NoBackupDevice str="Prosm, vlo~te extern zaYzen." /> <NoFindConfigFile str="Nenalezen konfigura n soubor." /> <ConfigFile str="Konfigura n soubor" /> <ConfigFileVerErr str="Verze konfigura nho souboru" /> <IsRestart str="Restart, potvrte." /> <NoFindFirmware str="Nenalezen firmware!" /> <FirmwareFile str="Soubor firmwaru" /> <IsFormatHD str="vaechna data budou smazna. Potvrte" /> <OpenFirmwareUpgradeLogErr str="Nejde otevYt firmware_upgrade.log" /> <Playback str="Playback" /> <PlaybackTime str="Playback Time" /> <Play str="Play" /> <Reverse str="Reverse" /> < % Pause str="Pause" /> <Wait str="prosm, ekejte" /> <Mute str="Mute" /> <LiveAudio str="LiveAudio" /> <PlaybackAudio str="Playback Audio" /> <ConvertToAvi str="Konvertovat do AVI" /> <NoFindRecord str="nenalezen zznam" /> <TimePeriod str=" asov obdob" /> <SaveTo str="Ulo~it do" /> <BackupDeviceFull str="Zlohovac zaYzen je pln. Zkontrolujte." /> <SavePath str="Cesta ulo~en" /> <Login str="Login" /> <Logout str="Logout" /> <PictureSet str="nastaven obrazu" /> <Rotation str="Rotace" /> <Normal str="Normal" /> <Mirror str="Zrcadlo" /> <VerticaFlip str="Vertikln oto en" /> <ColorLevel str="roveH barev" /> <Brightness str="Jas" /> <Contrast str="Kontrast" /> <Sharpness str="Ostrost" /> <RateControl str="Vzdlen ovldn" /> <Quality str="Kvalita" /> <Bitrate str="Bitrate" /> <VideoOffset str="Video Offset" /> <De-Noise str="De-Noise" /> <None str="None" /> <Method str="Metoda" /> <AutoMode str="Auto md" /> <DayMode str="Denn md" /> <Nig & htMode str="no n md" /> <Base str="Base" /> <Picture str="Obraz" /> <OutOfRange str="Mimo rozsah" /> <SystemClose str="System Shutdown ..." /> <On str="On" /> <Off str="Off" /> <Vendor str="Vrobce" /> <ModelName str="Model" /> <FriendlyName str="Jmno" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Rozsah porto" /> <ExternalIPAddress str="Extern IP adresa" /> <Information str="Informace" /> <SelOverPlayerMaxCam str="Bylo zvoleno mnoho kamer" /> <Event str="Udlost" /> <Event_List str="Seznam udlost" /> <Motion str="Motion" /> <DI str="Digitln vstup" /> <DO str="Digitln vstup" /> <Event_Schedule_List str="Pln udlost" /> <Action_List str="Seznam akc" /> <Alarm_Trigger_Type str="Typ alarmu" /> <Alarm_Seconds str="VteYiny alarmu" /> <Buzzer str="Bodk" /> <UnKnow str="neznm" /> <Display_On_CH str="Zobrazit na kanlu" /> <Action_Type str="Typ akce" /> <ERR_MSG_NO_CAM str="Nejprve zvolte kameru" /> <ERR_MSG_NO_EVENT str="nejprve z 3volte udlost" /> <ERR_MSG_NO_EVENT_SCH str="nejprve zvolte pln." /> <ERR_MSG_NO_ACTION str="nejprve zvolte akci" /> <ERR_MSG_TIME_PERIOD str="Zkontrolujte nastaven periody." /> <ERR_MSG_TIME_CONFILT str="Konflikt nastaven periody." /> <WeekDays str="Dny tdne" /> <AlarmSetting str="Nastaven alarmu" /> <AlarmCondition str="nastaven podmnek" /> <Alarm_True str="Pravda" /> <Alarm_False str="Nepravda" /> <Alarm_Seconds str="VteYiny alarmu" /> <Alarm_Manual_Stop str="Manual Stop" /> <Local str="Local" /> <DI_Setting str="DI nastaven" /> <System_Setting str="Nastaven systmu" /> <Log_Viewer str="Log Viewer" /> <Event_Log str="Log udlost" /> <Device str="Zdroj" /> <Log_Type str="Typ logu" /> <Motion_Alarm str="Pohybov alarm" /> <DI_Alarm str="DI alarm" /> <Input str="Vstup" /> <Limit_Record str="Limit nahrvn" /> <Remark str="Poznmka" /> <Total str="celkem" /> <HDD_Err_Alarm str="HDD Error Alarm" /> <Disconnect_Alarm str="Alarm odpojen" /> <Sched ) ule_Trigger str="Plnovan spouat " /> <Block_Alarm str="Alarm blokovn" /> <Blur_Alarm str="Alarm rozostYen" /> <Camera_Move_Alarm str="Alarm pohybu kamery" /> <Address_Book str="AdresY" /> <Phone str="Telefon" /> <E_MAIL str="E-Mail" /> <Notification str="Potvrzen" /> <SMTP_Config str="Nastaven SMTP" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="Z (od)" /> <SendMailWithoutPicture str="Poslat mail bez obrazu" /> <ServerRequireAuthentication str="Server vy~aduje ovYen" /> <SSL str="Server Require Secure Conntion(SSL)" /> <Send_Test str="Poslat test" /> <FTP_Config str="FTP nastaven" /> <FTP_Server str="Server" /> <FTP_Port str="Port" /> <Retry str="Retry" /> <RecycleDays str="RecycleDays" /> <RecycleSize str="RecycleSize" /> <Path str="Cesta ulo~en" /> <AllowCreateFolder str="Umo~nit vytvoYen adresYe" /> <HTTP_Config str="HTTP nastaven" /> <HTTP_IP str="IP" /> <HTTP_UID str=" et" /> <HTTP_PWD str="heslo" /> <HTTP_CGI s <tr="CGI" /> <Proxy_Address str="Proxy Address" /> <Proxy_UID str="Proxy Account" /> <Proxy_PWD str="Proxy Password" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="TCP nastaven" /> <TCP_Server str="Server" /> <TCP_Port str="Port" /> <Alarm_Config str="nastaven alarmu" /> <frame str="Frame" /> <SnapshotInterval str="Snapshot Interval" /> <SendInterval str="Zaslat interval" /> <SnapshotTempFolder str="Snapshot Temp Folder" /> <Mail str="Poata" /> <Subject str="PYedmt" /> <body str="tlo" /> <MS str="MS" /> <second str="Druh" /> <EventDetect str="Event Detection" /> <EventForceRecord str="Event Force Record" /> <EventSetting str="Event Setting" /> <MergeSeconds str="Merge Seconds" /> <Display str="Display" /> <Division str="Division" /> <FullScreen str="Cel obrazovka" /> <ResetDIVDefault str="Reset Division Default" /> <CancelFullScreen str="Zruait celou obrazovku" /> <Function str="Funkce" /> <SystemManagement str="System Management" /> <PTZCont?rol str="Ovldn PTZ" /> <Volume str="Hlasitost" /> <Monitor str="Dohled" /> <CancelMute str="Zruait mute" /> <TwoWayAudioON str="za t obousmrn audio" /> <TwoWayAudioOFF str="zkon it obousmrn audio" /> <Resolution str="Rozliaen" /> <Style str="Styl" /> <Simple str="Jednoduch" /> <Professional str="profesionln" /> <Output str="Vstup" /> <SettoOpen str="Nastavit na otevYeno" /> <SettoClose str="nastavit na zavYeno" /> <Preset str="pYednastaven" /> <Zoom str="Zoom" /> <Wide str="Wide" /> <Tele str="Tele" /> <Advanced str="Pokro il" /> <IsDeletePreset str="OK zrua pYednastaven" /> <System_Log str="System Log" /> <PTZ_SPEED str="PTZ rychlost" /> <PTZ_HOME str="PTZ home pozice" /> <PTZ_UP str="PTZ nahoru" /> <PTZ_DOWN str="PTZ dolo" /> <PTZ_LEFT str="PTZ doleva" /> <PTZ_RIGHT str="PTZ doprava" /> <PTZ_UP_RIGHT str="PTZ doprava nahoru" /> <PTZ_UP_LEFT str="PTZ doleva nahoru" /> <PTZ_DOWN_LEFT str="PTZ doleva dolo" /> <PTZ_DOWN_RIGHT str="PTZ do* prava dolo" /> <PTZ_TOUR_GO str="PTZ Tour Go" /> <PTZ_TOUR_STOP str="PTZ Tour Stop" /> <PTZ_FOCUS_UP str="PTZ Focus Up" /> <PTZ_FOCUS_DOWN str="PTZ Focus Down" /> <PTZ_IRIS_UP str="PTZ Iris Up" /> <PTZ_IRIS_DOWN str="PTZ Iris Down" /> <PTZ_FOCUS_AUTO str="PTZ Auto Focus" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ navigace Start" /> <PTZ_AUTOPAN_STOP str="PTZ navigace Stop" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="Spouatn systmu" /> <SYS_LOG_SYSTEM_SHUTDOWN str="vypnut systmu" /> <SYS_LOG_USER_LOGIN str="User Login" /> <SYS_LOG_USER_LOGOUT str="User Logout" /> <SYS_LOG_START_SCH_REC str="Pln za tku nahrvn" /> <SYS_LOG_END_SCH_REC str="Pln konce nahrvn" /> <SYS_LOG_START_SCH_ALARM str="Start Alarm Schedule" /> <SYS_LOG_END_SCH_ALARM str="End Alarm Schedule" /> <SYS_LOG_ENTER_SYS_SETUP str="Enter System Setup" /> <SYS_LOG_EXIT_SYS_SETUP str="Exit System Setup" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Enter Record Schedule Setup" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Exit Record Schedule Setup" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Enter Alarm Schedule Setup" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Exit Alarm Schedule Setup" /> <SYS_LOG_RTSP_GET_CONNECT str="Zskat spojen" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Ztraceno spojen" /> <SYS_LOG_SERVER_HTTP_START str="HTTP Server Start" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP Server Stop" /> <SYS_LOG_SERVER_RTSP_START str="RTSP Server Start" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP Server Stop" /> <SYS_LOG_SERVER_RPB_START str="Remote Playback Server Start" /> <SYS_LOG_SERVER_RPB_STOP str="Remote Playback Server Stop" /> <DiskManagement str="Disk Management" /> <DeviceType str="Druh zdroje" /> <Partition str="Partition" /> <FileSystem str="FileSystem" /> <IsPartition str="Systm znovu vytvoY partition. Potvrte." /> <Image str="Obraz" /> <Brightness str="Jas" /> <Contrast str="kontrast" /> <Saturation s tr="Saturace" /> <Sharpness str="Ostrost" /> <Hue str="Odstn" /> <NoSeldesti str="Prosm, zvolte umstn" /> <NoSelSource str="Prosm, zvolte zrdoj." /> <Time_Range str="File Time Range" /> <Event_Snapshot str="Event Snapshot" /> <EventSnapshotViewer str="Event Snapshot Viewer" /> <Event_Time str="Event Time" /> <Event_Type str="Event Type" /> <Change_Resolution str="Zmna rozliaen. Opravdu chcete zmnit?" /> <Select_All str="Zvolit vae" /> <InitNetowrk str="Network Module Initialize" /> <InitSystemDate str="Date Time Module Initialize" /> <InitDisk str="Disk Module Initialize" /> <InitRTSP str="RTSP Module Initialize" /> <NoVideo str="No Video" /> <Modify str="Zmnit" /> <DisplayCount str="Po et zznamo" /> <Mount str="Mount" /> <Unmount str="Unmount" /> <EditEmpty str="Prosm, potvrte nastaven." /> <Account str=" et" /> <FindListLog str="Nalezeno %d zznamo. Zobrazit jen %d zznam." /> <Trigger_Interval_Seconds str="Interval spouat e (vteYiny)" /> <Al arm_Always str="Alarm v~dy" /> <LowFPS str="Low Bitrate FPS" /> <WithFPS str="Jako nahoYe" /> <ShowPW str="Ukzat heslo" /> <SelOverMaxPlayHours str="Zvoleno pYes %d hodin" /> <SelectedCamera str="Zvolen kamera" /> <Codec str="Kodek" /> <Switchto str="Switch to" /> <Filter str="Filtr" /> <AutoSettingNote str="Zvolte filtr nebo bude zobrazeno vae." /> <TemplateSetting str="Template Setting" /> <SearchByEvent str="Vyhledvn podle udlosti" /> <Control str="Ovldn" /> <SwitchCamera str="Zmnit kameru" /> <Preview str="Nhled" /> <SequentialSearch str="Sekven n vyhledvn" /> <Split str="Rozdlit" /> <PreSearch str="Pre Search" /> <SeekTo str="Skok na" /> <ShowInformation str="Ukzat informace" /> <Bitrate_Log str="Bitrate Log" /> <Save str="Ulo~it do" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting" /> <NotConfigured str="nenakonfigurovno" /> <Application str="Aplikace"  /> <NameOrMailEmpty str="Jmno nebo email je przdn" /> <ONVIF_Auth str="ONVIF Authentication" /> <PIR_Alarm str="PIR Alarm" /> <CameraTamper str="Camera Tamper" /> <AudioDetection str="Audio detekce" /> <AutoSwitch str="Auto Switch" /> <CancelAutoSwitch str="Zruait auto switch" /> <MailRepeat str="Zadali jste existujc email. Prosm, zmHte." /> <SMART str="S.M.A.R.T" /> <OVERALL str="Over all" /> <PASSED str="PASSED" /> <FAILED str="FAILED" /> <Raw_Read_Error_Rate str="Raw Read Error Rate" /> <Throughput_Performance str="Throughput Performance" /> <Spin_Up_Time str="Spin Up Time" /> <Start_Stop_Count str="Start Stop Count" /> <Reallocated_Sector_Ct str="Reallocated Sectors Count" /> <Seek_Error_Rate str="Seek Error Rate" /> <Seek_Time_Performance str="Seek Time Performance" /> <Power_On_Hours str="Power On Hours" /> <Spin_Retry_Count str="Spin Retry Count" /> <Calibration_Retry_Count str="Calibration Retry Count" /> <Power_Cycle_Count str="Power Cycle Count" / > <Power_Off_Retract_Count str="Power Off Retract Count" /> <Load_Cycle_Count str="Load Cycle Count" /> <Temperature_Celsius str="Temperature Celsius" /> <Reallocated_Event_Count str="Reallocated Event Count" /> <Current_Pending_Sector str="Current Pending Sector" /> <Offline_Uncorrectable str="Offline Uncorrectable" /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="Multi Zone Error Rate" /> <SMART_RAW_VALUE str="Raw Value" /> <SMART_WORST str="Reference" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Pomr stran" /> <FitWindow str="Fit Window" /> <KeepRatio str="Keep Ratio" /> <Joystick str="Joystick" /> <Joystick_Information str="Joystick Information" /> <Joystick_Model str="Joystick Model" /> <Axis_Count str="Po et os" /> <Button_Count str="Po et tla tek" /> <Axis_X str="Hodnota osy X" /> <Axis_Y str="Hodnota osy Y" /> <Axis_Z str="Hodnota osy Z" /> <Buttons_Status str="Stav tla tek" /> <Joystick_Buttons_Setting str="Nastaven tla tek" /> <Button str="Tla tko" /> <Next_Division str="Dala divize" /> <Previous_Division str="PYedchoz divize" /> <Next_Window str="Dala okno" /> <Previous_Window str="PYedchoz okno" /> <Switch_Division_One str="Zmnit divizi 1" /> <Axis_Z_ID str="ID osy Z" /> <RAID_Err_Alarm str="RAID Error Alarm" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Lost Connect"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="Can't Get Setting Value!"/> <Refresh str="Please Refresh!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backuping, Please wait."/> <Converting str="Converting. Please wait."/> <ShowDate str="Show Date"/> <ShowTime str="Show Time"/> <Subtitle str="Subtitle"/> <PreSecond str="Pre Second"/> <PreFrame str="Pre Frame"/> <NextSecond str="Next Second"/> <NextFrame str="Next Frame"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Motion Search" /> <TimeSplit str="Time Split" /> <ShowDetailWindow str="Show Detail Window" /> <FirstPage str="First Page" /> <PrePage str="Pre Page" /> <NextPage str="Next Page" /> <LastPage str="Last Page" /> <DetailPicture str="Detail Picture" /> <SelectTime str="Select Time" /> <ErrStartEndTm str="Start or End Time Error" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Show Search Image" /> <ShowDetectMark str="Show Detect Mark" /> <DetectInterval str="Detect Interval" /> <Exit str="Exit" /> <Grayscale str="Grayscale" /> <Softness str="Softness" /> <Reset str="Reset" /> <Print str="Print" /> <RetryAgain str="Please try agai n later!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Two Way Audio Used!"/> <Weekly str="Weekly"/> <SAVEAS str="Save As..."/> <Send_To str="Send to"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Display Message on Live Preview"/> <ACTION_DESC_MAIL str="Send Notice Mail on Event Triggered"/> <ACTION_DESC_VOICE str="Play Alarm Sound on Event Triggered"/> <ACTION_DESC_DO str="Trigger Digital Output on Event Triggered"/> <ACTION_DESC_FTP str="Upload Images To FTP Site"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MO TION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detect digital inuput change status"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarm Event Selection"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="Change Name"/> <TIME_SET_ERROR str="Time setting error, please check time setting"/> <Export str="Export"/> <SEL_VIEW_CH str="Select View Channel"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Start Monitor All"/> <UPDATE_FAIL str="Can not upload setting , please try again later!"/> <DI_REC_TRIGGER str="DI Record trigger by:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="Camera name is empty, Do you want to use default name?"/> <ERR_SETUP str="Configuration data error, please re-check"/> <DEL_CAM_COFIRM str="Are you sure want to delete '%s' from list?"/> <ADD_CAM_ERR_ALREADY_HAS str="It's already has '%s' at list,please re-check Configuration"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Show Live Camera"/> <SHOW_PB_CAM str="Show Playback Camera"/> <DELETE_CAM str="Remove Camera display"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <Gr oupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </roo t>lang_english.xmlQjScSYjS~<root> <Font Name="wenquanyi" /> <LanguageName str="English" /> <LanguageNameEng str="English" /> <Sch_Monitor str="Schedule Monitoring" /> <Alarm_Monitor str="Alarm Monitoring" /> <Week0 str="Sunday" /> <Week1 str="Monday" /> <Week2 str="Tuesday" /> <Week3 str="Wednesday" /> <Week4 str="Thursday" /> <Week5 str="Friday" /> <Week6 str="Saturday" /> <WeekS0 str="Sun" /> <WeekS1 str="Mon" /> <WeekS2 str="Tue" /> <WeekS3 str="Wed" /> <WeekS4 str="Thu" /> <WeekS5 str="Fri" /> <WeekS6 str="Sat" /> <Disk_Free str="Free" /> <Error str="Error" /> <LoginError str="Login error, no match user or incorrect password" /> <DeviceInfo str="Device Info" /> <DeviceTitle str="Device Title" /> <SoftwareVersion str="Software Version" /> <Characters str="Characters" /> <DateTimeInfo str="Date Time Info" /> <CurrentDate str="Current Date" /> <CurrentTime str="Current Time" /> <Adjust str="Adjust" /> <Manual str="Manual" /> <SyncNTP str="Synchronize with NTP" /> <Setting str="Setting" /> <NTPServer str="NTPServer" /> <Test str="Test" /> <NTPSyncInterval str="NTP Sync Interval" /> <Hour str="Hour" /> <Timezone str="Timezone" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Azores, Cap Verde Isl.)" /> <Timezone18 str="GMT (Dublin, Lisbon, London, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berlin, Rome, Stockholm, Warsaw)" /> <Timezone20 str="GMT+02 (Athens, Helsinki, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="GMT+03 (Moscow, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)" /> <Timezon e37 str="GMT+09 (Seoul, Osaka, Sapporo, Tokyo)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+13:45 (Chatham" /> <DST str="Daylight Saving Time" /> <Disable str="Disable" /> <Enable str="Enable" /> <DSTStart str="Daylight Saving Time Start" /> <DSTEnd str="Daylight Saving Time End" /> <DSTOffset str="Daylight Saving Time Offset" /> <AutoLogin str="Auto Login" /> <UID str="Username" /> <PWD str="Password" /> <System str="System" /> <AutoFullScreen str="Auto Full Screen" /> <Language str="Language" /> <Audio str="Audio" /> <InputGain str="Input Gain" /> <OutputGain str="Output Gain" /> <KeyinNTPAddr str="Please Keyin NTP Server Address!" /> <Success str="Success" /> <Fault str="Fault" /> <OK str="OK" /> <Cancel str="Cancel" /> <SetDateTime str="Set Date Time" /> <Date str="Date" /> <Time str="Time" /> <AutoSetting str="Auto Setting" /> <CameraName str="Camera Name" /> <ModelName str="Model Name" /> <IPAddress str="IP Address" /> <HTTPPort str="HTTP Port" /> <RTSPPort str="RTSP Port" /> <Camera str="Camera" /> <Schedule str="Schedule" /> <Network str="Network" /> <User str="User" /> <MotionDetection str="Motion Detection" /> <Snapshot str="Snapshot" /> <Maintenance str="Maintenance" /> <Add str="Add" /> <Delete str="Delete" /> <Update str="Update" /> <Clear str="Clear" /> <Search str="Search" /> <AutoDetect str="Auto Detect" /> <Detect str="Detect" /> <MACAddress str="MAC Address" /> <Configuration str="Configuration" /> <Copy str="Copy" /> <StartT ime str="Start Time" /> <EndTime str="End Time" /> <RecordType str="Record Type" /> <PreAlarm str="PreAlarm" /> <PostAlarm str="PostAlarm" /> <RTC str="Round the Clock" /> <DIDetect str="DI Detection" /> <TimeSelErr str="Time range is incorrect!" /> <NoSelSch str="Please select one schedule!" /> <Warning str="Warning" /> <WeekCopyToAll str="All week schedule will the same with selected" /> <DHCP str="Obtain IP address automatically (DHCP)" /> <SubnetMask str="Subnet Mask" /> <Gateway str="Gateway" /> <DNS_DHCP str="Obtain DNS from DHCP" /> <PrimaryDNS str="Primary DNS" /> <SecondaryDNS str="Secondary DNS" /> <PPPoE str="PPPoE" /> <Status str="Status" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Server" /> <IPUsed str="This address is in use!" /> <IPNoUsed str="This address can use!" /> <Group str="Group" /> <Description str="Description" /> <ConfirmPWD str="Confirm Password" /> <LiveView str="Live View" /> <Playback str="Playback" /> <Reco rd str="Record" /> <PTZ str="PTZ" /> <TwoWayAudio str="Two Way Audio" /> <CheckConfirmPWD str="Please check confirm password again." /> <UIDEmpty str="Please edit username." /> <UIDRepeat str="You add the same user name. Please change it!" /> <NoSelUID str="Please select account!" /> <MotionID str="Motion ID" /> <Name str="Name" /> <Included str="Included" /> <Excluded str="Excluded" /> <ObjectSize str="Object Size" /> <Sensitivity str="Sensitivity" /> <NoSelCamera str="Please select Camera!" /> <OverMaxMotion10 str="The maximum motions is 10." /> <NoSelMotion str="Please select a motion." /> <MotionSettingEnpty str="Please fill motion setting first." /> <SourceSnapshotList str="Source Snapshot List" /> <SourceSnapshotPreview str="Source Snapshot Preview" /> <DestinationSnapshotList str="Destination Snapshot List" /> <DestinationSnapshotPreview str="Destination Snapshot Preview" /> <NoFindSD str="Please insert the SD Card!" /> <NoSelImg str="Please select Image!" /> <SameSnapshotImgName str="Have the same file name in SD card.Will replace the file!" /> <IsAutoSetting str="Do you want to auto setting the carmea now?" /> <GetParamError str="Get Parameter Error!" /> <CameraNameEmpty str="Please keyin Camera Name!" /> <IPAddressEmpty str="Please keyin IP Address!" /> <UIDEmpty str="Please keyin Username!" /> <HttpPortEmpty str="Please keyin Http Port!" /> <CameraNameTheSame str="Camera Name is the same!" /> <CamParam str="Camera Parameter" /> <Profile str="Profile" /> <FPS str="FPS" /> <Protocol str="Protocol" /> <EnableAudio str="Enable Audio" /> <AudioRecord str="Audio Record" /> <InputError str="Input Error" /> <DefaultSetting str="Default Setting" /> <FactoryDefaultSetting str="Factory Default Setting" /> <Default str="Default" /> <BackupSetting str="Backup Setting" /> <Backup str="Backup" /> <RestoreSetting str="Restore Setting" /> <Restore str="Restore" /> <FirmwareUpgrade str="Firmware Upgrade" /> <Upgrade str="Upgrade" /> <Browse str="Browse" /> <SystemRestart str="System Restart" /> <Restart str="Restart" /> <HDInformation str="Hard Disk Information" /> <SDInformation str="SD Card Information" /> <TotalCapacity str="Total Capacity" /> <FreeCapacity str="Free Capacity" /> <UsedCapacity str="Used Capacity" /> <UsedPercent str="Used Percent" /> <Format str="Format" /> <NoFind str="No Find" /> <NoMount str="No Mount" /> <IsDefaultSetting str="System will set the default setting include network ,please confirm this procedure" /> <NoBackupDevice str="Please insert external backup device." /> <NoFindConfigFile str="Can't find Configuration file." /> <ConfigFile str="Configuration file" /> <ConfigFileVerErr str="Configuration File Version Error." /> <IsRestart str="System will Restart ,please confirm this procedure." /> <NoFindFirmware str="Can't find any firmware!" /> <FirmwareFile str="Firmware File" /> <IsFormatHD str="All data will be lost , are you want to contiue." /> <OpenFirmwar  eUpgradeLogErr str="Can't open firmware_upgrade.log" /> <Playback str="Playback" /> <PlaybackTime str="Playback Time" /> <Play str="Play" /> <Reverse str="Reverse" /> <Pause str="Pause" /> <Wait str="Please Wait!" /> <Mute str="Mute" /> <LiveAudio str="LiveAudio" /> <PlaybackAudio str="Playback Audio" /> <ConvertToAvi str="Convert To Avi" /> <NoFindRecord str="No Find Record" /> <TimePeriod str="Time Period" /> <SaveTo str="Save To" /> <BackupDeviceFull str="Backup device maybe full, please check it." /> <SavePath str="Save Path" /> <Login str="Login" /> <Logout str="Logout" /> <PictureSet str="Picture Set" /> <Rotation str="Rotation" /> <Normal str="Normal" /> <Mirror str="Mirror" /> <VerticaFlip str="Vertica Flip" /> <ColorLevel str="Color Level" /> <Brightness str="Brightness" /> <Contrast str="Contrast" /> <Sharpness str="Sharpness" /> <RateControl str="Rate Control" /> <Quality str="Quality" /> <Bitrate str="Bitrate" /> <VideoOffset str="Video O  ffset" /> <De-Noise str="De-Noise" /> <None str="None" /> <Method str="Method" /> <AutoMode str="Auto Mode" /> <DayMode str="Day Mode" /> <NightMode str="Night Mode" /> <Base str="Base" /> <Picture str="Picture" /> <OutOfRange str="Out Of Range" /> <SystemClose str="System Shutdown ..." /> <On str="On" /> <Off str="Off" /> <Vendor str="Vendor" /> <ModelName str="Model Name" /> <FriendlyName str="Friendly Name" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Port Range" /> <ExternalIPAddress str="External IP Address" /> <Information str="Information" /> <SelOverPlayerMaxCam str="Select over %d camera!" /> <Event str="Event" /> <Event_List str="Event List" /> <Motion str="Motion" /> <DI str="Digital Input" /> <DO str="Digital Output" /> <Event_Schedule_List str="Event Schedule List" /> <Action_List str="Action List" /> <Alarm_Trigger_Type str="Alarm Type" /> <Alarm_Seconds str="Alarm Seconds" /> <Buzzer str="Buzzer" /> <UnKnow str="UnKnow"  /> <Display_On_CH str="Display on Channel" /> <Action_Type str="Action Type" /> <ERR_MSG_NO_CAM str="Please select a camera or local first!" /> <ERR_MSG_NO_EVENT str="Please select a event first!" /> <ERR_MSG_NO_EVENT_SCH str="Please select a event schedule first!" /> <ERR_MSG_NO_ACTION str="Please select a action first!" /> <ERR_MSG_TIME_PERIOD str="Time periods setting error, please check setting!" /> <ERR_MSG_TIME_CONFILT str="Time periods setting conflict, please check setting!" /> <WeekDays str="Week Days" /> <AlarmSetting str="Alarm Setting" /> <AlarmCondition str="Alarm Condition" /> <Alarm_True str="True" /> <Alarm_False str="False" /> <Alarm_Seconds str="Alarm Seconds" /> <Alarm_Manual_Stop str="Manual Stop" /> <Local str="Local" /> <DI_Setting str="DI Setting" /> <System_Setting str="System Setting" /> <Log_Viewer str="Log Viewer" /> <Event_Log str="Event Log" /> <Device str="Device" /> <Log_Type str="Log Type" /> <Motion_Alarm str="Motion Alarm" />   <DI_Alarm str="DI Alarm" /> <Input str="Input" /> <Limit_Record str="Limit Record" /> <Remark str="Remark" /> <Total str="Total" /> <HDD_Err_Alarm str="HDD Error Alarm" /> <Disconnect_Alarm str="Disconnect Alarm" /> <Schedule_Trigger str="Schedule Trigger" /> <Block_Alarm str="Block Alarm" /> <Blur_Alarm str="Blur Alarm" /> <Camera_Move_Alarm str="Camera Move Alarm" /> <Address_Book str="Address Book" /> <Phone str="Phone" /> <E_MAIL str="E-Mail" /> <Notification str="Notification" /> <SMTP_Config str="SMTP Setting" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="From" /> <SendMailWithoutPicture str="Send Mail Without Picture" /> <ServerRequireAuthentication str="Server Require Authentication" /> <SSL str="Server Require Secure Conntion(SSL)" /> <Send_Test str="Send Test" /> <FTP_Config str="FTP Setting" /> <FTP_Server str="Server" /> <FTP_Port str="Port" /> <Retry str="Retry" /> <RecycleDays str="RecycleDays" /> <RecycleSize str="Rec ycleSize" /> <Path str="Path" /> <AllowCreateFolder str="Allow Create Folder" /> <HTTP_Config str="HTTP Setting" /> <HTTP_IP str="IP" /> <HTTP_UID str="Account" /> <HTTP_PWD str="Password" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Address" /> <Proxy_UID str="Proxy Account" /> <Proxy_PWD str="Proxy Password" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="TCP Setting" /> <TCP_Server str="Server" /> <TCP_Port str="Port" /> <Alarm_Config str="Alarm Setting" /> <frame str="Frame" /> <SnapshotInterval str="Snapshot Interval" /> <SendInterval str="Send Interval" /> <SnapshotTempFolder str="Snapshot Temp Folder" /> <Mail str="Mail" /> <Subject str="Subject" /> <body str="Body" /> <MS str="MS" /> <second str="Second" /> <EventDetect str="Event Detection" /> <EventForceRecord str="Event Force Record" /> <EventSetting str="Event Setting" /> <MergeSeconds str="Merge Seconds" /> <Display str="Display" /> <Division str="Division" /> <FullScreen str="Full Screen" /> <ResetDIVDefault str="Reset Division Default" /> <CancelFullScreen str="Cancel Full Screen" /> <Function str="Function" /> <SystemManagement str="System Management" /> <PTZControl str="PTZControl" /> <Volume str="Volume" /> <Monitor str="Monitor" /> <CancelMute str="Cancel Mute" /> <TwoWayAudioON str="Start Two Way Audio" /> <TwoWayAudioOFF str="Stop Two Way Audio" /> <Resolution str="Resolution" /> <Style str="Style" /> <Simple str="Simple" /> <Professional str="Professional" /> <Output str="Output" /> <SettoOpen str="Set to Open" /> <SettoClose str="Set to Close" /> <Preset str="Preset" /> <Zoom str="Zoom" /> <Wide str="Wide" /> <Tele str="Tele" /> <Advanced str="Advanced" /> <IsDeletePreset str="Press 'OK' will Delete Preset." /> <System_Log str="System Log" /> <PTZ_SPEED str="PTZ Speed" /> <PTZ_HOME str="PTZ Home" /> <PTZ_UP str="PTZ Up" /> <PTZ_DOWN str="PTZ Down" /> <PTZ_LEFT str="PTZ Left" /> <PTZ_RIGHT str="PTZ Right" />  <PTZ_UP_RIGHT str="PTZ Up Right" /> <PTZ_UP_LEFT str="PTZ Up Left" /> <PTZ_DOWN_LEFT str="PTZ Down Left" /> <PTZ_DOWN_RIGHT str="PTZ Down Right" /> <PTZ_TOUR_GO str="PTZ Tour Go" /> <PTZ_TOUR_STOP str="PTZ Tour Stop" /> <PTZ_FOCUS_UP str="PTZ Focus Up" /> <PTZ_FOCUS_DOWN str="PTZ Focus Down" /> <PTZ_IRIS_UP str="PTZ Iris Up" /> <PTZ_IRIS_DOWN str="PTZ Iris Down" /> <PTZ_FOCUS_AUTO str="PTZ Auto Focus" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ Navigation Start" /> <PTZ_AUTOPAN_STOP str="PTZ Navigation Stop" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="System Initialization" /> <SYS_LOG_SYSTEM_SHUTDOWN str="System Shutdown" /> <SYS_LOG_USER_LOGIN str="User Login" /> <SYS_LOG_USER_LOGOUT str="User Logout" /> <SYS_LOG_START_SCH_REC str="Start Record Schedule" /> <SYS_LOG_END_SCH_REC str="End Record Schedule" /> <SYS_LOG_START_SCH_ALARM str="Start Alarm Schedule" /> <SYS_LOG_END_SCH_AL*ARM str="End Alarm Schedule" /> <SYS_LOG_ENTER_SYS_SETUP str="Enter System Setup" /> <SYS_LOG_EXIT_SYS_SETUP str="Exit System Setup" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Enter Record Schedule Setup" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Exit Record Schedule Setup" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Enter Alarm Schedule Setup" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Exit Alarm Schedule Setup" /> <SYS_LOG_RTSP_GET_CONNECT str="Get Connection" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Lost Connection" /> <SYS_LOG_SERVER_HTTP_START str="HTTP Server Start" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP Server Stop" /> <SYS_LOG_SERVER_RTSP_START str="RTSP Server Start" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP Server Stop" /> <SYS_LOG_SERVER_RPB_START str="Remote Playback Server Start" /> <SYS_LOG_SERVER_RPB_STOP str="Remote Playback Server Stop" /> <DiskManagement str="Disk Management" /> <DeviceType str="Device Type" /> <Partition str="Partition" /> <FileSystem str="FileSystem" /> <IsPartition? str="System will re-creat Partition, please confirm this procedure." /> <Image str="Image" /> <Brightness str="Brightness" /> <Contrast str="Contrast" /> <Saturation str="Saturation" /> <Sharpness str="Sharpness" /> <Hue str="Hue" /> <NoSeldesti str="Please select Destination!" /> <NoSelSource str="Please select Source List!" /> <Time_Range str="File Time Range" /> <Event_Snapshot str="Event Snapshot" /> <EventSnapshotViewer str="Event Snapshot Viewer" /> <Event_Time str="Event Time" /> <Event_Type str="Event Type" /> <Change_Resolution str="Resolution has been changed, please click 'OK' to confirm." /> <Select_All str="Select All" /> <InitNetowrk str="Network Module Initialize" /> <InitSystemDate str="Date Time Module Initialize" /> <InitDisk str="Disk Module Initialize" /> <InitRTSP str="RTSP Module Initialize" /> <NoVideo str="No Video" /> <Modify str="Modify" /> <DisplayCount str="Display Count" /> <Mount str="Mount" /> <Unmount str="Unmount" /> <EditEmpt< y str="Please confirm the settings are correct!" /> <Account str="Account" /> <FindListLog str="Found over %d records , Display first %d record only." /> <Trigger_Interval_Seconds str="Trigger Interval Seconds" /> <Alarm_Always str="Always Alarm" /> <LowFPS str="Low Bitrate FPS" /> <WithFPS str="As above" /> <ShowPW str="Show Password" /> <SelOverMaxPlayHours str="Selected over %d hours" /> <SelectedCamera str="Selected Camera" /> <Codec str="Codec" /> <Switchto str="Switch to" /> <Filter str="Filter" /> <AutoSettingNote str="Please enter the filtering rule or keep empty to search all" /> <TemplateSetting str="Template Setting" /> <SearchByEvent str="Search By Event" /> <Control str="Control" /> <SwitchCamera str="Switch Camera" /> <Preview str="Preview" /> <SequentialSearch str="Sequential Search" /> <Split str="Split" /> <PreSearch str="Pre Search" /> <SeekTo str="Seek To" /> <ShowInformation str="Show Information" /> <Bitrate_Log str="Bitrate Log" /> <Save )str="Save" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting"/> <NotConfigured str="Not Configured"/> <Application str="Application"/> <NameOrMailEmpty str="Name or E-Mail is empty"/> <ONVIF_Auth str="ONVIF Authentication"/> <PIR_Alarm str="PIR Alarm"/> <CameraTamper str="Camera Tamper"/> <AudioDetection str="Audio Detection"/> <AutoSwitch str="Auto Switch"/> <CancelAutoSwitch str="Cancel Auto Switch"/> <MailRepeat str="You add the same E-Mail. Please change it!"/> <SMART str="S.M.A.R.T"/> <OVERALL str="Over all"/> <PASSED str="PASSED"/> <FAILED str="FAILED"/> <Raw_Read_Error_Rate str="Raw Read Error Rate"/> <Throughput_Performance str="Throughput Performance"/> <Spin_Up_Time str="Spin Up Time"/> <Start_Stop_Count str="Start Stop Count"/> <Reallocated_Sector_Ct str="Reallocated Sectors Count"/> <Seek_Error_Rate str="Seek Error Rate"/> <Seek_Time_Performance str="Seek Time Performan3 ce"/> <Power_On_Hours str="Power On Hours"/> <Spin_Retry_Count str="Spin Retry Count"/> <Calibration_Retry_Count str="Calibration Retry Count"/> <Power_Cycle_Count str="Power Cycle Count"/> <Power_Off_Retract_Count str="Power Off Retract Count"/> <Load_Cycle_Count str="Load Cycle Count"/> <Temperature_Celsius str="Temperature Celsius"/> <Reallocated_Event_Count str="Reallocated Event Count"/> <Current_Pending_Sector str="Current Pending Sector"/> <Offline_Uncorrectable str="Offline Uncorrectable"/> <UDMA_CRC_Error_Count str="UDMA CRC Error Count"/> <Multi_Zone_Error_Rate str="Multi Zone Error Rate"/> <SMART_RAW_VALUE str="Raw Value"/> <SMART_WORST str="Reference"/> <SMART_Event str="HDD S.M.A.R.T"/> <DisplayRatio str="Display Ratio"/> <FitWindow str="Fit Window"/> <KeepRatio str="Keep Ratio"/> <Joystick str="Joystick"/> <Joystick_Information str="Joystick Information"/> <Joystick_Model str="Joystick Model"/> <Axis_Count str="Axis Count"/> <Button_Count str="Butt&on Count"/> <Axis_X str="Axis X Value"/> <Axis_Y str="Axis Y Value"/> <Axis_Z str="Axis Z Value"/> <Buttons_Status str="Buttons Status"/> <Joystick_Buttons_Setting str="Joystick Buttons Setting"/> <Button str="Button"/> <Next_Division str="Next Division"/> <Previous_Division str="Previous Division"/> <Next_Window str="Next Window"/> <Previous_Window str="Previous Window"/> <Switch_Division_One str="Switch Division One"/> <Axis_Z_ID str="Axis Z ID"/> <RAID_Err_Alarm str="RAID Error Alarm"/> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Lost Connect"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="Can't Get Setting Value!"/> <Refresh str="Pl%ease Refresh!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backuping, Please wait."/> <Converting str="Converting. Please wait."/> <ShowDate str="Show Date"/> <ShowTime str="Show Time"/> <Subtitle str="Subtitle"/> <PreSecond str="Pre Second"/> <PreFrame str="Pre Frame"/> <NextSecond str="Next Second"/> <NextFrame str="Next Frame"/> <LowBitrate str="Low LowBitrate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Motion Search" /> <TimeSplit str="Time Split" /> <ShowDetailWindow str="Show Detail Window" /> <FirstPage str="First Page" /> <PrePage str="Pre Page" /> <NextPage str="Next Page" /> <LastPage str="Last Page" /> <DetailPicture str="Detail Picture" /> <SelectTime str="Select Time" /> <ErrStartEndTm str="Error Start Time or End Time!" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Show Search Image" /> <ShowDetectMark str="Show Detect Mark" /> <DetectInterval str0 ="Detect Interval" /> <Exit str="Exit" /> <Grayscale str="Grayscale" /> <Softness str="Softness" /> <Reset str="Reset" /> <Print str="Print" /> <RetryAgain str="Please try again later!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Two Way Audio Used!"/> <Weekly str="Weekly"/> <SAVEAS str="Save As..."/> <Send_To str="Send to"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Display Message on Live Preview"/> <ACTION_DESC_MAIL str="Send Notice Mail on Event Triggered"/> <ACTION_DESC_VOICE str="Play Alarm Sound on Event Triggered"/> <ACTION_DESC_DO str="Trigger Digital Output on Event Triggered"/> <ACTION_DESC_FTP str="Upload Images To FTP Site"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggere0 d"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detect digital inuput change status"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarm Event Selection"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="Change Name"/> <TIME_SET_ERROR str="Time setting error, please check time setting"/> <Export str="Export"/> <SEL_VIEW_CH str="Select View Channel"/> % <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Start Monitor All"/> <UPDATE_FAIL str="Can not upload setting , please try again later!"/> <DI_REC_TRIGGER str="DI Record trigger by:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="Camera name is empty, Do you want to use default name?"/> <ERR_SETUP str="Configuration data error, please re-check"/> <DEL_CAM_COFIRM str="Are you sure want to delete '%s' from list?"/> <ADD_CAM_ERR_ALREADY_HAS str="It's already has '%s' at list,please re-check Configuration"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Show Live Camera"/> <SHOW_PB_CAM str="Show P&layback Camera"/> <DELETE_CAM str="Remove Camera display"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live3 preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/> <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEnc)oder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"/> <ProfileSetting str="Profile Setting"/> </root> ~ lang_spanish.xmlQjScSYjSl<root> <Font Name="DejaVu Sans" /> <LanguageName str="Espaol" /> <LanguageNameEng str="Spanish" /> <Sch_Monitor str="Programacin de monitoreo" /> <Alarm_Monitor str="Monitoreo de alarma" /> <Week0 str="Domingo" /> <Week1 str="Lunes" /> <Week2 str="Martes" /> <Week3 str="Mircoles" /> <Week4 str="Jueves" /> <Week5 str="Viernes" /> <Week6 str="Sbado" /> <WeekS0 str="Domingo" /> <WeekS1 str="Lunes" /> <WeekS2 str="Martes" /> <WeekS3 str="Mircoles" /> <WeekS4 str="Jueves" /> <WeekS5 str="Viernes" /> <WeekS6 str="Sbado" /> <Disk_Free str="Gratuito" /> <Error str="Error" /> <LoginError str="Error de inicio de sesin, usuario o contrasea incorrectos" /> <DeviceInfo str="Informacin del dispositivo" /> <DeviceTitle str="Titulo del dispositivo" /> <SoftwareVersion str="Versin de software" /> <Characters str="Caracteres" /> <DateTimeInfo str="Fecha Hora Informacin" /> <CurrentDate str="Fecha actual" /> <CurrentTime str="Hora actual" /> <Adjust str="Ajustar" /> <Manual str="Manual" /> <SyncNTP str="Sincronizar con NTP" /> <Setting str="Ajuste" /> <NTPServer str="Servidor NTP" /> <Test str="Prueba" /> <NTPSyncInterval str="Intervalo NTP sincronizado " /> <Hour str="Hora" /> <Timezone str="Zona horaria" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutiana Isla.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mxico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (Nueva York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaos)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone 15 str="GMT-03 (Brasilia, San Pablo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Islas Azores, Cabo Verde)" /> <Timezone18 str="GMT (Dubln, Lisboa, Londres, Reikiavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berln, Roma, Estocolmo, Warsaw)" /> <Timezone20 str="GMT+02 (Atenas, Helsinki, Estambul, Riga)" /> <Timezone21 str="GMT+02 (Egipto)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lbano)" /> <Timezone24 str="GMT+02 (Siria)" /> <Timezone25 str="GMT+03 (Mosc, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Irn)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Katmand)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Han i, Yakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghi, Singapur, Taipei)" /> <Timezone37 str="GMT+09 (Sel, Osaka, Sapporo, Tokio)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaida)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+12:45 (Chatham Island)" /> <DST str="Tiempo de ahorro de luz" /> <Disable str="Habilitar" /> <Enable str="Deshabilitar" /> <DSTStart str="Comenzar tiempo de ahorro de luz" /> <DSTEnd str="Finalizar tiempo de ahorro de luz" /> <DSTOffset str="Offset tiempo de ahorro de luz" /> <AutoLogin str="Conexin automtica" /> <UID str="Nombre de usuario" /> <PWD str="Contrasea" /> <System str="Sistema" /> <AutoFullScreen str="Pantalla completa automtica" /> <Language str="Idioma" /> <Audio str="Audio" /> <InputGain str="Ganancia de entrada" /> <OutputGain str="Ganancia de salida" /> <KeyinNTPAddr str="Por favor reingrese la direccin del servidor NTP" /> <Success str="Exitosa" /> <Fault str="Fall" /> <OK str="OK" /> <Cancel str="Cancelar" /> <SetDateTime str="Establecer fecha y hora" /> <Date str="Fecha" /> <Time str="Hora" /> <AutoSetting str="Auto Ajuste" /> <CameraName str="Nombre de cmara" /> <ModelName str="Nombre de modelo" /> <IPAddress str="Direccin IP" /> <HTTPPort str="Puerto HTTP" /> <RTSPPort str="Puerto RTSP" /> <Camera str="Cmara" /> <Schedule str="Programa" /> <Network str="Red" /> <User str="Usuario" /> <MotionDetection str="Deteccin de movimientos" /> <Snapshot str="Instantnea" /> <Maintenance str="Mantenimiento" /> <Add str="Agregar" /> <Delete str="Borr ar" /> <Update str="Actualizar" /> <Clear str="Despejar" /> <Search str="Bsqueda" /> <AutoDetect str="Deteccin automtica" /> <Detect str="Detectar" /> <MACAddress str="Direccin MAC" /> <Configuration str="Configuracin" /> <Copy str="Copiar" /> <StartTime str="Hora de comienzo" /> <EndTime str="Hora de finalizacin" /> <RecordType str="Tipo de grabacin" /> <PreAlarm str="Alarma previa" /> <PostAlarm str="Alarma posterior" /> <RTC str="Todo el da" /> <DIDetect str="Deteccin DI" /> <TimeSelErr str="El rango de tiempo es incorrecto!" /> <NoSelSch str="Por favor seleccione una programacin!" /> <Warning str="Advertencia" /> <WeekCopyToAll str="Todos los programas semanales sern iguales al seleccionado" /> <DHCP str="Obtener la direccin IP automticamente (DHCP) " /> <SubnetMask str="Mscara de subred" /> <Gateway str="Gateway" /> <DNS_DHCP str="Obtener DNS desde DHCP" /> <PrimaryDNS str="DNS Primaria" /> <SecondaryDNS str="DNS Secundaria" /> <PPPoE st r="PPPoE" /> <Status str="Estado" /> <Start str="Comienzo" /> <Stop str="Detener" /> <Server str="Servidor" /> <IPUsed str="Esta direccin ya est en uso!" /> <IPNoUsed str="Esta direccin puede usarse!" /> <Group str="Grupo" /> <Description str="Descripcin" /> <ConfirmPWD str="Confirmar contrasea" /> <LiveView str="Visualizacin en vivo" /> <Playback str="Reproduccin" /> <Record str="Grabacin" /> <PTZ str="PTZ" /> <TwoWayAudio str="Audio doble va " /> <CheckConfirmPWD str="Por favor confirmar la contrasea nuevamente" /> <UIDEmpty str="Por favor editar el nombre de usuario" /> <UIDRepeat str="Usted agreg el mismo nombre de usuario. Por favor cmbielo!" /> <NoSelUID str="Por favor seleccione una cuenta!" /> <MotionID str="Identificacin de movimiento" /> <Name str="Nombre" /> <Included str="Incluido" /> <Excluded str="Excluido" /> <ObjectSize str="Tamao del objeto" /> <Sensitivity str="Sensibilidad" /> <NoSelCamera str="Por favor seleccione una cmara!" /> <OverMaxMotion10 str="El mximo de movimientos es 10" /> <NoSelMotion str="Por favor seleccione un movimiento" /> <MotionSettingEnpty str="Por favor complete el ajuste de movimiento primero" /> <SourceSnapshotList str="Lista de instantneas" /> <SourceSnapshotPreview str="Vista previa de instantneas" /> <DestinationSnapshotList str="Lista de destino de instantneas " /> <DestinationSnapshotPreview str="Destino de vista previa de instantneas" /> <NoFindSD str="Por favor inserte la tarjeta SD!" /> <NoSelImg str="Por favor seleccione una imagen!" /> <SameSnapshotImgName str="Tiene el mismo nombre de archivo en la tarjeta SD. Remplazar el archivo!" /> <IsAutoSetting str="Desea realizar el ajuste automtico de la cmara ahora?" /> <GetParamError str="Obtuvo error en el parmetro!" /> <CameraNameEmpty str="Por favor ingrese el nombre de cmara!" /> <IPAddressEmpty str="Por favor ingrese la direccin IP!" /> <UIDEmpty str="Por favor ingrese el nombre de usuario!" />  <HttpPortEmpty str="Por favor ingrese el puerto HTTP!" /> <CameraNameTheSame str="El nombre de la cmara es el mismo!" /> <CamParam str="Parmetro de cmara" /> <Profile str="Perfil" /> <FPS str="FPS" /> <Protocol str="Protocolo" /> <EnableAudio str="Habilitar audio" /> <AudioRecord str="Grabacin de audio" /> <InputError str="Error de ingreso" /> <DefaultSetting str="Configuracin predeterminada" /> <FactoryDefaultSetting str="Configuracin predeterminada de fbrica" /> <Default str="Predeterminada" /> <BackupSetting str="Configuracin de respaldo" /> <Backup str="Respaldo" /> <RestoreSetting str="Restaurar configuracin " /> <Restore str="Restaurar" /> <FirmwareUpgrade str="Actualizacin de firmware" /> <Upgrade str="Actualizacin" /> <Browse str="Navegar" /> <SystemRestart str="Reinicio de sistema" /> <Restart str="Reiniciar" /> <HDInformation str="Informacin de disco rgido" /> <SDInformation str="Informacin de tarjeta SD" /> <TotalCapacity str="Capacida  d total" /> <FreeCapacity str="Capacidad libre" /> <UsedCapacity str="Capacidad utilizada" /> <UsedPercent str="Porcentaje utilizado" /> <Format str="Formato" /> <NoFind str="No encontrado" /> <NoMount str="Sin montaje" /> <IsDefaultSetting str="El sistema establecer la configuracin predeterminada incluyendo la red, por favor confirme este procedimiento" /> <NoBackupDevice str="Por favor inserte el dispositivo de respaldo externo" /> <NoFindConfigFile str="No se puede encontrar el archivo de configuracin" /> <ConfigFile str="Archivo de configuracin" /> <ConfigFileVerErr str="Error en la versin del archivo de configuracin " /> <IsRestart str="El sistema se reiniciar, por favor confirme este procedimiento" /> <NoFindFirmware str="No se puede encontrar el firmware!" /> <FirmwareFile str="Archivo de firmware" /> <IsFormatHD str="Se perdern todos los datos, desea continuar?" /> <OpenFirmwareUpgradeLogErr str="No se puede abrir firmware_upgrade.log" /> <Playback str="Repr  oduccin" /> <PlaybackTime str="Tiempo de reproduccin" /> <Play str="Reproducir" /> <Reverse str="Marcha atrs" /> <Pause str="Pausa" /> <Wait str="Aguarde por favor!" /> <Mute str="Silencio" /> <LiveAudio str="Audio en vivo" /> <PlaybackAudio str="Reproduccin de audio" /> <ConvertToAvi str="Convertir a AVI" /> <NoFindRecord str="No se encontr la grabacin" /> <TimePeriod str="Perodo de tiempo" /> <SaveTo str="Guardar a" /> <BackupDeviceFull str="Dispositivo de respaldo posiblemente completo, por favor revselo" /> <SavePath str="Guardar la ruta" /> <Login str="Conectarse" /> <Logout str="Desconectarse" /> <PictureSet str="Establecer imagen" /> <Rotation str="Rotacin" /> <Normal str="Normal" /> <Mirror str="Espejo" /> <VerticaFlip str="Voltear verticalmente" /> <ColorLevel str="Nivel de color" /> <Brightness str="Brillo" /> <Contrast str="Contraste" /> <Sharpness str="Nitidez" /> <RateControl str="Control de la frecuencia" /> <Quality str="Calidad" / > <Bitrate str="Promedio de bit" /> <VideoOffset str="Video Offset" /> <De-Noise str="De-ruido" /> <None str="Ninguno" /> <Method str="Mtodo" /> <AutoMode str="Modo automtico" /> <DayMode str="Modo da" /> <NightMode str="Modo noche" /> <Base str="Base" /> <Picture str="Imagen" /> <OutOfRange str="Fuera de rango" /> <SystemClose str="Apagando sistema& " /> <On str="Encendido" /> <Off str="Apagado" /> <Vendor str="Fabricante" /> <ModelName str="Nombre de modelo" /> <FriendlyName str="Nombre amigable" /> <UPnPTraversal str="UPnP Trasversal" /> <PortRange str="Rango de puerto" /> <ExternalIPAddress str="Direccin IP externa" /> <Information str="Informacin" /> <SelOverPlayerMaxCam str="Seleccione ms %d cmaras!" /> <Event str="Evento" /> <Event_List str="Lista de eventos" /> <Motion str="Movimiento" /> <DI str="Entrada digital" /> <DO str="Salida digital" /> <Event_Schedule_List str="Lista de programa de eventos" /> <Action_List str="Lista de acciones  " /> <Alarm_Trigger_Type str="Tipo de alarma" /> <Alarm_Seconds str="Segundos de alarma" /> <Buzzer str="Zumbador" /> <UnKnow str="Desconocido" /> <Display_On_CH str="Mostrar en canal" /> <Action_Type str="Tipo de accin" /> <ERR_MSG_NO_CAM str="Por favor seleccione una cmara o local primero! " /> <ERR_MSG_NO_EVENT str="Por favor seleccione un evento primero!" /> <ERR_MSG_NO_EVENT_SCH str="Por favor seleccione un programa de eventos primero!" /> <ERR_MSG_NO_ACTION str="Por favor seleccione una accin primero!" /> <ERR_MSG_TIME_PERIOD str="Error en la configuracin de perodos de tiempo, por favor revise la configuracin!" /> <ERR_MSG_TIME_CONFILT str="Conflicto en la configuracin de perodos de tiempo, por favor revsela!" /> <WeekDays str="Das de la semana" /> <AlarmSetting str="Configuracin de alarma" /> <AlarmCondition str="Condicin de alarma" /> <Alarm_True str="VERDADERO" /> <Alarm_False str="FALSO" /> <Alarm_Seconds str="Segundos de alarma" /> <Alarm_Manu  al_Stop str="Detencin manual" /> <Local str="Local" /> <DI_Setting str="Configuracin DI" /> <System_Setting str="Configuracin de sistema" /> <Log_Viewer str="Visualizador de sesin" /> <Event_Log str="Registro de eventos" /> <Device str="Dispositivo" /> <Log_Type str="Tipo de registro" /> <Motion_Alarm str="Alarma de movimiento" /> <DI_Alarm str="Alarma DI" /> <Input str="Ingreso" /> <Limit_Record str="Grabacin limitada" /> <Remark str="Observacin" /> <Total str="Total" /> <HDD_Err_Alarm str="Alarma de error HDD" /> <Disconnect_Alarm str="Alarma desconectada" /> <Schedule_Trigger str="Programacin de disparos" /> <Block_Alarm str="Bloqueo de alarma" /> <Blur_Alarm str="Alarma de borroneo" /> <Camera_Move_Alarm str="Alarma de movimiento de cmara" /> <Address_Book str="Libro de direcciones" /> <Phone str="Telfono" /> <E_MAIL str="E-Mail" /> <Notification str="Notificacin" /> <SMTP_Config str="Configuracin SMTP" /> <SMTP_Server str="Servidor" /> <SMTP_Port str="Puerto" /> <From str="Desde" /> <SendMailWithoutPicture str="Enviar mail sin imagen" /> <ServerRequireAuthentication str="El servidor requiere autenticacin" /> <SSL str="El servidor requiere una conexin segura (SSL)" /> <Send_Test str="Enviar prueba" /> <FTP_Config str="Configuracin FTP" /> <FTP_Server str="Servidor" /> <FTP_Port str="Puerto" /> <Retry str="Reintentar" /> <RecycleDays str="Das de reciclado" /> <RecycleSize str="Tamao de reciclado" /> <Path str="Camino" /> <AllowCreateFolder str="Permitir la creacin de carpeta" /> <HTTP_Config str="Configuracin HTTP" /> <HTTP_IP str="IP" /> <HTTP_UID str="Cuenta" /> <HTTP_PWD str="Contrasea" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Direccin de Proxy" /> <Proxy_UID str="Cuenta de Proxy" /> <Proxy_PWD str="Contrasea de Proxy" /> <Proxy_Port str="Puerto de Proxy" /> <TCP_Config str="Configuracin de TCP" /> <TCP_Server str="Servidor" /> <TCP_Port str="Puerto " /> <Alarm_Config str="Conf iguracin de alarma" /> <frame str="Cuadro" /> <SnapshotInterval str="Intervalo de instantnea" /> <SendInterval str="Enviar intervalo" /> <SnapshotTempFolder str="Carpeta de instantneas temporarias" /> <Mail str="Mail" /> <Subject str="Asunto" /> <body str="Cuerpo" /> <MS str="MS" /> <second str="Segundo" /> <EventDetect str="Deteccin de evento" /> <EventForceRecord str="Forzar grabacin de eventos" /> <EventSetting str="Configuracin de evento" /> <MergeSeconds str="Combinar segundos" /> <Display str="Mostrar" /> <Division str="Divisin" /> <FullScreen str="Pantalla completa" /> <ResetDIVDefault str="Restablecer divisin por defecto" /> <CancelFullScreen str="Cancelar pantalla completa" /> <Function str="Funcin" /> <SystemManagement str="Administracin de sistema" /> <PTZControl str="Control de PTZ" /> <Volume str="Volumen" /> <Monitor str="Monitor" /> <CancelMute str="Cancelar silencio" /> <TwoWayAudioON str="Iniciar audio doble va" /> <TwoWayAudioOFF? str="Detener audio doble va" /> <Resolution str="Resolucin" /> <Style str="Estilo" /> <Simple str="Simple" /> <Professional str="Profesional" /> <Output str="Salida" /> <SettoOpen str="Configurar al abrir" /> <SettoClose str="Configurar al cerrar" /> <Preset str="Preajuste" /> <Zoom str="Zoom" /> <Wide str="Ancho" /> <Tele str="Tele" /> <Advanced str="Avanzado" /> <IsDeletePreset str="Si presiona OK borrar la configuracin " /> <System_Log str="Registro del sistema" /> <PTZ_SPEED str="Velocidad de PTZ" /> <PTZ_HOME str="Inicio PTZ" /> <PTZ_UP str="PTZ arriba" /> <PTZ_DOWN str="PTZ abajo" /> <PTZ_LEFT str="PTZ izquierda" /> <PTZ_RIGHT str="PTZ derecha" /> <PTZ_UP_RIGHT str="PTZ arriba derecha" /> <PTZ_UP_LEFT str="PTZ arriba izquierda" /> <PTZ_DOWN_LEFT str="PTZ abajo izquierda" /> <PTZ_DOWN_RIGHT str="PTZ abajo derecha" /> <PTZ_TOUR_GO str="Ir a Tour PTZ" /> <PTZ_TOUR_STOP str="Detener Tour PTZ" /> <PTZ_FOCUS_UP str="PTZ enfoque arriba" /> <PTZ_FOCU* S_DOWN str="PTZ enfoque abajo" /> <PTZ_IRIS_UP str="PTZ Iris arriba" /> <PTZ_IRIS_DOWN str="PTZ Iris abajo" /> <PTZ_FOCUS_AUTO str="PTZ autoenfoque" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="Comenzar navegacin PTZ" /> <PTZ_AUTOPAN_STOP str="Detener navegacin PTZ" /> <PTZ_ZOOM_IN str="PTZ Zoom de acercamiento" /> <PTZ_ZOOM_OUT str="PTZ Zoom de alejamiento" /> <SYS_LOG_SYSTEM_INIT str="Inicializacin de sistema" /> <SYS_LOG_SYSTEM_SHUTDOWN str="Apagar sistema" /> <SYS_LOG_USER_LOGIN str="Usuario conectado" /> <SYS_LOG_USER_LOGOUT str="Usuario desconectado" /> <SYS_LOG_START_SCH_REC str="Iniciar programa de grabacin" /> <SYS_LOG_END_SCH_REC str="Finalizar programa de grabacin" /> <SYS_LOG_START_SCH_ALARM str="Iniciar alarma programada" /> <SYS_LOG_END_SCH_ALARM str="Finalizar alarma programada" /> <SYS_LOG_ENTER_SYS_SETUP str="Ingresar a configuracin de sistema" /> <SYS_LOG_EXIT_SYS_SETUP str="Salir de configuracin de sistema" /> <SYS_LOG_ENTER_S) CH_REC_SETUP str="Ingresar a configuracin de programa de grabacin" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Salir de configuracin de programa de grabacin" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Ingresar a configuracin de programa de alarma" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Salir de configuracin de programa de alarma" /> <SYS_LOG_RTSP_GET_CONNECT str="Obtener conexin" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Conexin perdida" /> <SYS_LOG_SERVER_HTTP_START str="Iniciar servidor HTTP" /> <SYS_LOG_SERVER_HTTP_STOP str="Detener servidor HTTP" /> <SYS_LOG_SERVER_RTSP_START str="Iniciar servidor RTSP" /> <SYS_LOG_SERVER_RTSP_STOP str="Detener servidor RTSP" /> <SYS_LOG_SERVER_RPB_START str="Iniciar servidor de reproduccin remoto" /> <SYS_LOG_SERVER_RPB_STOP str="Detener servidor de reproduccin remoto" /> <DiskManagement str="Administracin de disco" /> <DeviceType str="Tipo de dispositivo" /> <Partition str="Particin" /> <FileSystem str="Sistema de archivo" /> <IsPartition str="El< sistema recrear una particin, por favor confirmar este procedimiento" /> <Image str="Imagen" /> <Brightness str="Brillo" /> <Contrast str="Contraste" /> <Saturation str="Saturacin" /> <Sharpness str="Nitidez" /> <Hue str="Matiz" /> <NoSeldesti str="Por favor seleccione un destino!" /> <NoSelSource str="Por favor seleccione una lista fuente!" /> <Time_Range str="Rango de tiempo del archivo" /> <Event_Snapshot str="Instantnea de evento" /> <EventSnapshotViewer str="Visualizador de instantneas de evento" /> <Event_Time str="Hora del evento" /> <Event_Type str="Tipo de evento" /> <Change_Resolution str="La resolucin de la pantalla fue cambiada, Desea cambiarla?" /> <Select_All str="Seleccionar todo" /> <InitNetowrk str="Inicializar el mdulo de red" /> <InitSystemDate str="Inicializar el mdulo de fecha y horario" /> <InitDisk str="Inicializar el mdulo de disco" /> <InitRTSP str="Inicializar el mdulo RTSP" /> <NoVideo str="Sin video" /> <Modify str="Modificar"& /> <DisplayCount str="Mostrar contador" /> <Mount str="Montar" /> <Unmount str="Desmontar" /> <EditEmpty str="Por favor confirme que la configuracin es correcta!" /> <Account str="Cuenta" /> <FindListLog str="Se encontraron ms de %d grabaciones, desplegar primero %d grabacin solamente" /> <Trigger_Interval_Seconds str="Disparar segundos de intervalo" /> <Alarm_Always str="Siempre alarma" /> <LowFPS str="Baja de tasa de bits FPS" /> <WithFPS str="Como el anterior" /> <ShowPW str="Mostrar contrasea" /> <SelOverMaxPlayHours str="Seleccionar ms de %d horas" /> <SelectedCamera str="Cmara seleccionada" /> <Codec str="Cdec" /> <Switchto str="Cambiar a" /> <Filter str="Filtro" /> <AutoSettingNote str="Por favor introduzca la regla de filtrado o mantngala vaca para buscar todo" /> <TemplateSetting str="Plantilla de ajuste" /> <SearchByEvent str="Buscar por evento" /> <Control str="Control" /> <SwitchCamera str="Cambiar cmara" /> <Preview str="Vista previa" /> <3SequentialSearch str="Bsqueda secuencial" /> <Split str="Dividida" /> <PreSearch str="Pre bsqueda" /> <SeekTo str="Buscar a" /> <ShowInformation str="Mostrar informacin" /> <Bitrate_Log str="Registro de promedio de bit" /> <Save str="Guardar" /> <PlaybackControlPad str="Pad de control de reproduccin" /> <FormatFault str="Falla en formateo" /> <LowBitrateSetting str="Configuracin de promedio de bit baja" /> <NotConfigured str="No configurada" /> <Application str="Aplicacin " /> <NameOrMailEmpty str="El nombre o e-mail est vaco" /> <ONVIF_Auth str="Autenticacin ONVIF" /> <PIR_Alarm str="Alarma PIR" /> <CameraTamper str="Cmara bloqueada" /> <AudioDetection str="Deteccin de audio" /> <AutoSwitch str="Cambio automtico" /> <CancelAutoSwitch str="Cancelar switch automtico" /> <MailRepeat str="Usted agreg el mismo e-mail. Por favor cmbielo!" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Por encima de todo" /> <PASSED str="PASADO" /> <FAILED str="FALL" /> <0Raw_Read_Error_Rate str="Error en disco rgido" /> <Throughput_Performance str="Rendimiento de volumen de informacin" /> <Spin_Up_Time str="Tiempo de giro" /> <Start_Stop_Count str="Iniciar contador de paradas " /> <Reallocated_Sector_Ct str="Contar sectores reasignados" /> <Seek_Error_Rate str="Buscar promedio de errores" /> <Seek_Time_Performance str="Buscar tiempo de rendimiento" /> <Power_On_Hours str="Horas de encendido" /> <Spin_Retry_Count str="Girar recuento de intentos" /> <Calibration_Retry_Count str="Calibracin recuento de reintentos" /> <Power_Cycle_Count str="Contador de ciclo de energa" /> <Power_Off_Retract_Count str="Contador de apagado retraccin" /> <Load_Cycle_Count str="Contador de ciclos de carga" /> <Temperature_Celsius str="Temperatura en Celsius" /> <Reallocated_Event_Count str="Contador de eventos reasignados" /> <Current_Pending_Sector str="Sector pendiente actual" /> <Offline_Uncorrectable str="Desconexin incorregible" /> <UDMA_CRC_Error_Count s% tr="Error en contador UDMA CRC " /> <Multi_Zone_Error_Rate str="Error en promedio multizona" /> <SMART_RAW_VALUE str="Valor RAW" /> <SMART_WORST str="Referencia" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Desplegar promedio" /> <FitWindow str="Ajustar la ventana" /> <KeepRatio str="Mantener promedio" /> <Joystick str="Joystick" /> <Joystick_Information str="Informacin de joystick" /> <Joystick_Model str="Modelo de joystick" /> <Axis_Count str="Cuenta Axis" /> <Button_Count str="Contador de botones" /> <Axis_X str="Valor X Axis" /> <Axis_Y str="Valor Y Axis" /> <Axis_Z str="Valor Z Axis" /> <Buttons_Status str="Botones de estado" /> <Joystick_Buttons_Setting str="Botones de ajuste de joystick" /> <Button str="Botn" /> <Next_Division str="Divisin siguiente" /> <Previous_Division str="Divisin previa" /> <Next_Window str="Prxima ventana" /> <Previous_Window str="Ventana previa" /> <Switch_Division_One str="Cambiar Divisin Uno" /> <Axis_Z_ID str=% "ID Axis Z" /> <RAID_Err_Alarm str="Alarma de error RAID" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Conexin perdida"/> <ConnectFail str="Falla la conexin"/> <GetSettingValueErr str="No se puede obtener el valor de configuracin!"/> <Refresh str="Por favor Refresque!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Haciendo Backup, por favor espere."/> <Converting str="Convirtiendo. Por favor espere"/> <ShowDate str="Mostrar Fecha"/> <ShowTime str="Mostrar Hora"/> <Subtitle str="Subtitle"/> <PreSecond str="Segundo anterior"/> <PreFrame str="Cuadro Previo"/> <NextSecond str="Segundo P0rximo"/> <NextFrame str="Prximo Cuadro"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Zoom Digital" /> <MotionSearch str="Buscar deteccin de movimiento" /> <TimeSplit str="Tiempo parcial" /> <ShowDetailWindow str="Mostrar Ventana de Detalles" /> <FirstPage str="Primer Pgina" /> <PrePage str="Pgina Previa" /> <NextPage str="Prxima Pgina" /> <LastPage str="ltima Pgina" /> <DetailPicture str="Detalle de la Imagen" /> <SelectTime str="Seleccionar Hora" /> <ErrStartEndTm str="Error en las horas de inicio o final!" /> <SearchSet str="Bsqueda" /> <ShowSearchImage str="Mostrar bsqueda de imagen" /> <ShowDetectMark str="Mostrar marca de deteccin" /> <DetectInterval str="Intervalo Deteccin:" /> <Exit str="Salir" /> <Grayscale str="Escala de grises" /> <Softness str="Suavizar" /> <Reset str="Resetear" /> <Print str="Imprimir" /> <RetryAgain str="Por favor intente luego!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SY3STEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Usar Audio dos vias!"/> <Weekly str="Semanal"/> <SAVEAS str="Save As..."/> <Send_To str="Enviar a"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Muestra un mensaje en la pantalla"/> <ACTION_DESC_MAIL str="Enva un e-mail sobre el evento accionado"/> <ACTION_DESC_VOICE str="Reproduce un sonido de alarma "/> <ACTION_DESC_DO str="Acciona una salida digital segn el evento accionado"/> <ACTION_DESC_FTP str="Subir imgenes a sitio FTP"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Mostrar estado deteccin de movimiento"/> <EVENT_DESC_BLOCK str="& Detectar cmara bloqueada"/> <EVENT_DESC_BLUR str="Detectar cmara desenfocada"/> <EVENT_DESC_CAM_MOVE str="Detectar cmara movida de direccin"/> <EVENT_DESC_DI str="Detecta cambio en el estado de la entrada digital"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Seleccin Eventos de Alarma"/> <CREATE_NEW_FOLDER str="Crear Nueva Carpeta"/> <CHANGE_NAME str="Cambiar Nombre"/> <TIME_SET_ERROR str="Error del seteo de hora, por favor verificar"/> <Export str="Exportar"/> <SEL_VIEW_CH str="Seleccionar Vista Canal"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Inicio Monitoreo Todo"/> <UPDATE_FAIL str= "No se puede subir la configuracin, intente lueg<o!"/> <DI_REC_TRIGGER str="Grabacin DI disparada por:"/> <PASTE str="Pegar"/> <PASTE_MON_FRI str="Pegar en Lunes a Viernes"/> <PASTE_SAT_SUN str="Pegar en Sbado y Domingo"/> <PASTE_ALL_CAM str="Pegar en todas las cmaras"/> <APPLY_ALL str="Aplicar todo"/> <UN_SELECT_ALL str="Cancelar todo"/> <GET_PARAM_FAIL_USE_DEFAULT str= "Falla la obtencin de parmetros, el sistema usar los valores por defecto"/> <NO_CAM_NAME str="No indic el nombre de cmara, usar uno por defecto?"/> <ERR_SETUP str="Error de configuracin de datos, por favor verifique"/> <DEL_CAM_COFIRM str="Esta seguro que quiere borrar '%s' de la lista?"/> <ADD_CAM_ERR_ALREADY_HAS str="Ya tiene '%s' en la lista, por favor revise la configuracin "/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Mostrar Cmara en Vivo"/> <SHOW_PB_CAM str="Mostrar reproduccin de cmara"/> <DELETE_CAM str="Quitar visin de la cmara"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRE) SET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> <DDNS str="DDNS"/> <DDNS_Server str="Server Name"/> <DDNS_Host str="Host Name"/> <DDNS_UID str="Account"/> <DDNS_PWD str="Password"/> <DDNS_Status str="Current IP"/> <DDNS_Test str="Test"/> <UIStyle str="UI Style"/> <UIS_Overlap str="Title Overlap"/> <UIS_ScaleLv str="Scale Level"/> <UIS_AutoScale str="Auto Scale Size"/> <UIS_RecStatus str="Record Status"/> <UIS_TxtShaow str="Text Shadow"/> <REMOVE_ALL str="Remove all"/> <QUICK_SETUP str="Quick setup"/> <Primary str="Primary"/> <Secondary str="Secondary"/> <Setup str="Setup"/> <GroupPreview str="Group Preview"/> <Action_Popup str="Popup"/> <Action_Popup_Desc str="Switch live preview group"/> <ToolBox_Setting str="ToolBox Setting"/> <ToolBox_List str="ToolBox List"/> <DivGroup str="Division Group"/>* <AddDivGrp str="Add New Division Group"/> <GroupName str="Group Name"/> <Management str="Management"/> <MaxGroups str="Max Groups"/> <IVS str="Intelligent Video Analysis"/> <EVENT_DESC_IVS str="Receive Intelligent Video Analysis Result"/> <CopyTo str="Copy To"/> <CopyToAll str="Copy To All"/> <EMap str="EMap"/> <Map str="Map"/> <Change_Map str="Change Map"/> <File_MaxSize str="Maximum file size"/> <File_List str="File List"/> <File_Name str="File Name"/> <File_Size str="File Size"/> <File_Type str="File Type"/> <File_Open str="Open"/> <File_Save str="Save"/> <File_SaveAs str="Save as"/> <MainStream str="Main Stream"/> <SecondStream str="Second Stream"/> <VideoSetting str="Video Setting"/> <DeleteItemConfirm str="Deleting %s , Please confirm this procedure."/> <AudioSource str="Audio Source"/> <AudioEncoder str="Audio Encoder"/> <SampleRate str="Sample Rate"/> <VideoSource str="Video Source"/> <VideoEncoder str="Video Encoder"?/> <ProfileSetting str="Profile Setting"/> </root> l* sysA^jSjSjSsbinA^jSjSjSrouteSjSjSjS../bin/busybox suloginSjSjSjS../bin/busyboxarpSjSjSjS../bin/busyboxvconfigSjSjSjS../bin/busyboxslattachSjSjSjS../bin/busyboxstart-stop-daemonSjSjSjS../bin/busyboxsetconsoleSjSjSjS../bin/busyboxacpidSjSjSjS../bin/busybox lspciSjSjSjS../bin/busyboxloadkmapSjSjSjS../bin/busyboxifupSjSjSjS../bin/busyboxifdownSjSjSjS../bin/busyboxrmmodSjSjSjS../bin/busybox hwclockSjSjSjS../bin/busybox!ifconfigSjSjSjS../bin/busybox"insmodSjSjSjS../bin/busybox#findfsSjSjSjS../bin/busybox$watchdogSjSjSjS../bin/busybox%logreadSjSjSjS../bin/busybox&initSjSjSjS../bin/busybox' blkidSjSjSjS../bin/busybox( klogdSjSjSjS../bin/busybox)manSjSjSjS../bin/busybox*adjtimexSjSjSjS../bin/busybox+makedevsSjSjSjS../bin/busybox,ifenslaveSjSjSjS../bin/busybox-tune2fsSjSjSjS../bin/busybox.pivot_rootSjSjSjS../bin/busybox/hdparmSjSjSjS../bin/busybox03switch_rootSjSjSjS../bin/busybox1&sysctlSjSjSjS../bin/busybox2%automount.shSjSXRjSw30#!/bin/sh LD_LIBRARY_PATH=/lib:/envr:/sbin:/bin export LD_LIBRARY_PATH /envr/StorageManager "$ACTION"_"$DEVNAME" 3w losetupSjSjSjS../bin/busybox4*swaponSjSjSjS../bin/busybox5?inotifydSjSjSjS../bin/busybox6<tunctlSjSjSjS../bin/busybox7)gettySjSjSjS../bin/busybox8)raidautorunSjSjSjS../bin/busybox9<fsck.minixSjSjSjS../bin/busybox:?haltSjSjSjS../bin/busybox;*mke2fsSjSjSjS../bin/busybox<0mkswapSjSjSjS../bin/busybox=%lsusbSjSjSjS../bin/busybox>&runlevelSjSjSjS../bin/busybox?3syslogdSjSjSjS../bin/busybox@poweroffSjSjSjS../bin/busyboxA mkdosfsSjSjSjS../bin/busyboxBdepmodSjSjSjS../bin/busyboxCmodprobeSjSjSjS../bin/busyboxDmkfs.vfatSjSjSjS../bin/busyboxEmkfs.ext2SjSjSjS../bin/busyboxFfreeramdiskSjSjSjS../bin/busyboxGnameifSjSjSjS../bin/busyboxHfdiskSjSjSjS../bin/busyboxIswapoffSjSjSjS../bin/busyboxJrebootSjSjSjS../bin/busyboxKmdevSjSjSjS../bin/busyboxLfbsplashSjSjSjS../bin/busyboxMdevmemSjSjSjS../bin/busyboxN zcipSjSjSjS../bin/busyboxOlsmodSjSjSjS../bin/busyboxP<udhcpcSjSjSjS../bin/busyboxQ)mkfs.minixSjSjSjS../bin/busyboxR*binA^jS[jS[jSS?SprintenvZjSjSjSbusyboxT%SpartedZjSZjSZjSU0ELF(Ț44 (pll l 444tt,YQtd/lib/ld-uClibc.so.0EYjt.v3V#Rosc\47ikpXWT5nK2[a^_y?eJw~bz|,LufH:q{r%>Sxd}Q&mOgI](8hl"  ' 1BD<=@-6FG 09!U+*)CM/ $P;N`AZHT`ldxhl _nؕ̕Q, ,(8DP\ht8Z{PvȖԖ@sU?/(v4$@ELXdMp5|pcI[,0!ȚP ė)З'ܗ0< $0<BHT`lqx D6̘Xؘ,Jj , 8kD5P\Uhot;f,"a}!ș"ԙ[DȒ(4@L,Xd7pb|K=Wgetenvmallocstderrfree__data_startmemcpyabortcallocreallocmemsetraiselibc.so.0strlenvfprintfsrandomstrncasecmpvasprintfiswprintclosedirfflushstrdupfgetsvsnprintfforkreadlinkgetppidlseek64fcntllstat64ftello64__errno_locationopendirstdinmemmovegetpagesize_exitreadfseeko64fsyncaccessfdopenstrcatisattyfopen64__fpendinggetcwdsigactionfeof__fpurgefscanfstrtollmemcmpconnectsscanfmbrtowcusleepunamewaitpidstrchrioctlstrcasecmpsysconf__xpg_strerror_r__uClibc_mainferrorfputcfputsgetpid__sigsetjmpstrncmptolowerftruncatestrcmp__ctype_b_stdlib_mb_cur_maxsyscalU<lstrtolfilenoposix_memalignreaddir64rewind__assertsocket__fputc_unlocked__freadingstrncpylocaltimeexeclsigfillset__glibc_strerror_rstrcpygettimeofdayjrand48gmtimestrstrumaskfclosembsinitstrnlenstrrchrstatgetuidatoi__stdoutfwritesiglongjmp__cxa_atexit_edata__bss_start__bss_start____bss_end____end___end:^g      $(,048<@DHLPTX\` d!h"l#p$t%x&|()*+,-./012345678;đ=ȑ>̑?Б@ԑAؑBܑCDEFGHIJKLMN OQRST U$V(W,X0Z4[8\<]@_D`HaLbPcTdXe\i`jdkhllmpntoxp|qrstuwxyz{|}~ -L-Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌU) Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌ  --- 0c(gD$GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/H-M   0 00 0S  000 0000  0  0  0  0KH-M 00000 0K-M  00 000 0!000S0!00  00!00 Ћ/H-M  0 0 00 0S0700 #0!0000T0S S0!000 0S  0s0 0 0 0 00 000 0!000S 0s0 0!000KH-M 00 0 0 000c0w00 00 0 00S0KH-M 00 0@h0 0x000 0H0S 0 00R*00  0   ~K8gH- M 0 0S @ @00 n0 @-0 0K  00S 00` 00P+ 0 1Y8u+ 0@P00  "?c0t0#0"? c020b1 c  0$00 Kp m(mH-M 80S 800 @$ 0!*00KHmH-M 00I&0S X00S 00  `, 0)0 S000KmH-M 000 )0S00KmH-M !K0 K0SHHH H0$!KK0S0!K 0K4nhn ~H-0MK0 40 0"K 0!K00S 00s "2$000S  0 0000S 0 000 ? 0!K4!KK0S K"K P0"K00 0 000S 000 ? 0!K4!KcK0S K!K P0!K00 0 00 000S* 000S% K"KPK"KQP00S00 K!KPK"KQP00s00  0C$000S 00 000S 00 0S 0S"K 0!K  0Ktnhn-}nM0H- `MP T X \0 P0 "KP0!#K 0#K 0$K0L0 L0H0 "KX@0 0 #KX@00 0 00!QP000 T0S T0 ,K\0S 0U& H0 T0!4K0S 0L0 0RH00H0 L00L0 "KHK <K \000 #KLKDK 000 #KR$KR\\\"\2#0S> 0S;0S8K#KPH00H0 "KHK <K \000 #KR!1w#L00L0 #KLKDK 000 $KRlTh!T1]#0S 0! 0S 0 0 0"K"K0S0 0 00S0"#K#K"K\J0S 0.##K J0Sl l0##"KKPtDj/D0#"KCKK@TPPH K0nhn}nnnoLoH- M   D0<00"   0@L0KhH-M 0=00 0S K$H-M00  001000  01SK$H-M00 \ X010 D0!80 1$000  01SK\o0iH-M 0S 00 0S M0KH-M 0 0 '00 300 0S '' 0KR0S6 0S /0S& 00SK0S 50 0400 0S 50S 500 0S P0 0 40Kto H-pM` X(0@0 0$K 0%K0X0 0\0 0 0 00 00 00 00 `002080 80S 870S 70S008 570S 800Y60S0<0 <0Kd8 U% 0S 800F60S 800000S<0S 00 0 0$0 <0S $0S 6 $000000S 0@0 @0KT0Sp $g`0L KX0Kh 0Sg `0T K\0KH0S` <@K%K 8 :040 40SS 40 X0\8 \`0X \0 q000 00S%5f!l50S`00%0,0 @50S`00$0,0 `00k$0,0 ,0S$ %5B!0,K0(0 0#L,!L(0S &84( A0S00 0K(L 0[0#0S &`00N00 84 A0S00 0KK 0[0#0SX40!G0S \40"G0SB`0$K--00 `0%K&-00 `040!-00 `040"-00 30S   t30S @00XQ D  #0%0S{20S84 k00#0S 20S84 ^00#0S 20S 0`0|"|%0@SR%;% 0S 4 ;0S$ "1| ?0 0 @04A;0SE 4:0S 4 N:830S8 8%3X0S X0E\0S \0E`00 0S D1 0484rA49  82X0S X0E\0S \0E0KoВoooooooohna}okp4ppp H-M 00 0000 0 0S3 0K  WU00S# 0j;0 000 0S 0;0S  730S 20 ~ v20KqoH-$M(  (00 0 0 0 00 D00 6(90S, 0S 00 0 0 00 K' 00 0C00 0 0  @000 K' 00 jC00 0S0Kq- M 0Ћ/H-M 0S 0A0H0 0 00   ?A+00 |00S p 0 0 00 H 0 0 00Kqhn?}(q8q0H- xMh l `2dK H0 h 00+00 (00 h0h0! B 0 0Q Q R0h*00 l0S l00010 10S( 0S Sl}dz\wXAh0h0 W0! PK 0h0h0!hPP 00P  0#h0 h0 W0 K 00  h00  h0!h IG(0S (0Sh*(00S80 K0|}qqqqqqqq r0H- M 00 0t0 0p0 0l0 0h0 0d0 d0S> d e0SP0D0 D0t0 -d` V0SA0@0 @0p0 d( G0S d @0S+0<0 <0l0 : d000000h0 dt0Sl0S00.00 0S 30S `:0S00 530S~ t0SC 040 y4040! B U00 04)0\0 )400\ O\41040 40S000080 Y8d 0 00S0K000S0B8o0>l0S X080S h0S 00 000 0K 0S 06000 N00000t0S |80Sp80,0 ,0H0S ,0 ,00R*,00  ,0  ,+ ,0010|0 0010x0 70SN'0S'0 0(0 00'7 0(0 |0S (h (` x0S (L (D (L0o00 (90H0 p0SH60S H0400Sn%0P0 H000S&H000P b6PT&\P 0$0 0H0!)0`0 0H0 000! B 0 0 0(0\0 0H0"(0X0 &0S$`5 $\2 $`. $\+ $X( H0400S+|0S H040@0T0 $T H080S H08004$ x0S H80T0 $T H0 0 $  E|0S $h $ x0S $D $8 $$U P+`)\'X%HW80H0 H0S=0L0 LL(5 B80H0 p0SH60S H0400SH000St#H000\#\30 0H0!P(00 (30H0 000! B 0 0 0'00 2s%0S 0H0"(00 \2aH040U % 0SYH080S "H0800O100 0H0S 0 00R*00:  0 ::+x0S AH?70((100 0H0S 0 00R*00:  0 :Y:H00 0H7Hw70H0 H0S27.02.00 K0$r,rg4rВ8roDrLrTrXr`rhrtr|rrrrrrrrrH-M0 0  0K000 0H0S 0 00R*00  0    00 0 0S0KH-M 00H-M !K600 0S 00!KA0S00KH-4M( (00"0$0 $0S0j(00$!0 0 0S0^(00 MA0S t@0R G00 (0 0 0! ( <0SE0;E 0 0 &00 0 0!&00 $0@(040>000000Ft 0y00 4@RP0S @S0 0($L5(00-0KrpH-M  00! 0OP 00b Q00 000"dK 0L?p20#`20X$0 "Kv<2`0 K P0 @P0!  0  0!0#0DK 0 "K?1@100"PKDKdK! 0 C0!K  7300 0S0KD#T0K :0S V0S S s# 0KD0'U & ;An30KDK 0 0"K0"KPH00Hc#0 :R30KD0Kp$sh?H-pMx 0"K 0#Kx00;*0 0 0S x0 ,0K 00S x0 40K 00S K"K P0 0" 0@Px000 ?T K"K P0 0" 0@Px000@_x0002 ?R*K"K P0 0z" 0@Px00i0 ?T K"K P0 0c" 0x00S0 ?x00K02 ?!Kx0K!K P0R 0xBKaKV`p`pK@PTTK =x0K!K P0R 0xBKaKV`p`pK@PTtK =T Kt0K  S0S +x00 0S H0 0  y+0Koo H-M 0 0 008)00 0S% 0K 0S 0C0S 09+K+00 0S <0 0<+0Kq H-M 000 0Kts0S000S0 00 0 000K0sH- M  0 0R  07000 0S00 0 0S0 0 l\h \00 0 G! 0 QP000K 0[K@3000#340  p0L E@!0  0\0pl 1P` @300 0 C0z P@\200  *04a P@200  0Hlh P\@1H2 D20 00  0T) P@1 10 0  0  P@100 d 0LH ` H0mS mShS lS aS -vS  S% sS &00 &00 #T1 H1 0 0 01 ,1,U <! 1!1 1 00 0 00 0! 0S{D0S>0Se8 0 t00 c 0 $0 X001 $0 0K{g$xg {dgВ{(H-M  00S 000%00 0S0$00 C0 00 0 00 0SP@ F0S 00S00K|H-M  0S; 5.0S( 00S{0S"0S 00S00 0S || t0 l00S X0 0 0K|`($H-M 080S 0 0S l h00S \00SP00S < F000zKT| |$H-M  00 K0Kn0 0 0S00Sp00S  0 KT00  0K8 00 00S00K@$H-M &0KH-M 0 0K 0[$0KH-M   0KH-M     J0KH-M e0KH-M [0KH-M  P00 0S  0R 00 0KH-M  00 0K~H-M00 0 0KH-M 0S 00KH-M 000 KH-M 00 00 0 0KH- M 0U?S @00000K-M  00 000 0S 00S0S 0  00Ћ/H-M  0S 00 000 00Sy 0 000 q00 00 0  0KH-M  '00KH-M  00 0 0  00S 000S#0 00 0 0S0KH-M  0v0K-H-M00 0S 00  0  0 0 0S0KHЍ/-H-M00 0S 00  0  0 0 0S0KHЍ/H-M 000KH- M 00 00 0 0 00 %00S 0000 n 000 0 0 0   0 0700C0 000 0S 0K~H-M 00 00S 00q000 0SK-M  00K00  000 [R0000  0R0Ћ/- M00K\0 0[000;S 80 0[000;S00Ћ/- M00K0[ S00Ћ/H-8M0 4 8 <0 4 <00c Sddo/`3A4 800c0 00(0 (00S (00$0 $0 0 0 0 0 C00CR000   0R0 $0000S 000 00C0 0S  $0000S 00C0 0S  $0000S00$ O00 0s 00C0 0 0 0S 0U* 0 00 000   0R $000l0S0S00$0$ 0$0 00c 0 4 <00c0 (00S$00S 1<!& 0S 000 0H0S 0 00R*00  0  T   0RU$ 0SO$G$0 0c0 (00(0 (0S2K~4~H~@~~H- M  000S00@0 0S00KH-M  0 0  00 0KH-M  00 0 0 00  00  0R00 000 0S 0KH-M  00 0 0 00 00 0S S 00S 0 0 00 000 0S 0S00K-M 0 0 00  00 0 000 0S 0Ћ/- M00 H00S<00S 90SP00 0Ћ/H-000S$ $00L -Ћ/H-M 00 0 0  0S# 000 0H0S 0 00R*00  0  0 0S +K`pH-M   0S (0 0 K脠0H-M   00 0S0  i 00S S  003 ppY/l0h T00< L 4002 , 0܂L `oH-M   10lZ 0Sl1 " 000CSUG$Dd$!$10, L> !10& D6 00* <. 00$ 4& 00% , 00* $ d00- d D002 H $000 u܂ă@hĄH-M   10 0SXl1 000CSG$Dd$!$10# > !10$ 6 00, . 00! & 00&  00(  d00& d D00) H $000 ܂,Px̅ HtH-M  81  ,1  1  0S 0;L0000 @00 00 0S 00S  00yx0000S `0 C00 00 0  0K`p-M  0S00 000  00S 0000  0R0Ћ/H-M 00S0000 0900 00 00L <0(00 0 0 JK܂H-M 0000 000S0200S0S00S0#0 00c00 0S 0SP00S D00S 400S $0 00 0K0H-M 00t 0 K4H-Mp00Sddd d0 L000 0 40000 $0U 00  0K44H-000 4H-,00S 00004H-0004- M 000 D0 00000 0S00S00Ћ/H-FM  00 0 0K101 10 S 00 G10 S 0S1SB0S?0S 10L0S 00 10 0K$0S 10 [R00 0S 10\S100S 101 1 0K0 000 101 10S0S1S  D0K 0 >K10S 1SKІH-M  @0000 0"00 0KH- M  /00 0S 0S 0S/1 0SI 0SD00S 00 0 0 /  0R |00 0S p0SH00 00 $00 00 00 \ 00 0 0S00 $0S 00S r00 |m00 h00 `c00 00S <Y00 0KԆ  H- M  $0 0 0 00 0S  p0S C0 0 00 00S 0S6 3  <00  !00 0S0 00S 0S $W0S 0S 0S K0H-M   0 >0S$ 0 0 0S 0& 00 0SU x 0J 0S 0H00S 0  0n0S0KH- M $ $00K A$00S 0K0  00 0 0S0 ,0$ 00 Y0K,H-(M  $0 0 00 0  00 0y0 0 0S$ 0  0S$0S 0 {. $0 $00S00  0 0S   0 $0S $0 0  $000 0KH-M  00S 00!0 0 000 0 00  000 0S0L000S 0 0 0K<@DH-M  00S 00000  00 0 0S0 y 00 0S00  0KH-M  00S 0000 0 0K0S000Shhh h0C00 0R 0000 0S00  0K0H-M   00S 00000 0 0K0S@` R 0 0 %00 0S@( C 00  0K8XH-M  00S 0000 0A0 0 0S@p  0 00 0S@@ 0 0 0  0KTtH-M  00S 0000 000 0S@\ 0 0 00S$$$ $00KXԇWU H- M  00 00 \"0S +00 >00 H00 >,00 0S 00 0  0S 6, 0 j00KH-M 00 9$0S0 000  0R0KH-M 0S0000S0G#0S 00KH-M 000S0.#0S00KH-M   0 0 0S 0 0 0 0 0S 0 0 0 0 0S \0 0 H0 0 0S@(! 0A 0 00 0S@ 0/[0S U0S0 L0S pF0S0 P=0S 870S0 0K$H-M  00  0 0   0800  0000  0 0 0S 000 0S0!~0 0  00S  00S  0 0 7 0KH-M  00S 00a0 0 00Z0 0 00  0T00 0S0D000S 00 00KHLPH-M  00 00 000 000 0 S000  00 0  0S  0 00KH-M10 0 0S0 0 0K !00 0K,0H-U M00  030 @ P 0 \0! P01S0 000  03@S 00 K0<H-M00  001000  01SK<H- |x t l0 hd m X0 H00@<000 0 0@<D@DH-,00Y 00U00Q<@DH- |x : l0 hd 3 X0 H00g@<00b0v 0 0HHPLPH-,00 0000HLPH-M0 0 0 0 00 0 00S0#  0 0 0S 00 d0 00 D0 <00S0 00 0S0KTH-M0 00 d0 00 D0 <00S000 0S0KX-0Ћ/H-M0S 0S H0S ~0S 0S0Wd( 0KT1T! P1P! L1L! H1H! <1 K0 1!1 0 ( 0 0  0 0 0 0 0 0 |0 t0 d0 \0  P0 D0 80 0K$| xH-0000TXH-M,2 (20200 0H0S 0 00R*00  0   w!10 v100 0H0S 0 00R*00  0   UT 10 0 0H0S 0 00R* 00  0   7 00 6000 0H0S 0 00R*00  0  i $0  XdpH-M  00K蘈H- M $ $$00 1$  1 10 00|10&00 0 0 H+<100S $100 0H0S 0 00R*00  0   0K 0w0S 200 0S T000 0  0S  00S@=8H- M  $0 $1  00 0!$000a000   0R'00 0S& 00>0 0  0S 000Sl l00: FP 0S 0S00K8H-M 0S\\= X0F<00  0 0  0  0 0KlxH-M 0SN 1#00SO 00 0 !00 0 010 0100,000 0 0R0 0100 00 0 0 0R000 0  K耉x- M  0R00Ћ/0H- M 0Sh 100Sthi d10 0S0010 0 00 0 010 000 0 0R00 -00 "0 01@0 010P0 010 010 |00U000000 0 0R000 0 0R K0耉x`H-M  0S 0T0 0001V0 0 0 0010  00 0 eK耉x܉H-M  01 00 00 0!0@00000!000S000 000 0SKH-0@0S 0@00#0S  00@0S 0@00#0S x t0 :00 0S0 0  0  0 0 ,i0K( P?<ZH-M 0S 00nvKH-M 0S 0 0 0 0R0 0 00  3/KH-M 0S 0 0 0 0 0 0  0 KH- M  0S$ 0 0  tO0S0@0 000c400U0 0 KH-M  0S 0  KH-MK!KK!K 0 0!K? 0K- M 0  Ћ/,-00Ћ/,0H- M  0L0 P  ?!K0 SX(`4`@`L`U \`h`8a```t````0!L 0I/0F=) -0BE? ?> <+09&06!03 <00!B 00"0!00! B 0 0d 0 0 @@ s 000 ,0 K0ʚ;@- M  01Ћ/0H-M 00  H010S0000 0 S0K0H-M 0000 0S00KI-M +K0! K` 0#K0SPP L4$0S:0H0 0 0 00 ?KH 0 00 ?? 0`p 00 ?K5 0 00 ?,@P 00 ?K$K`@!d {0K00S 0S 0S0c 0 K 0@PU 0K@ d W0Ks00S&+KP00+K&P00+KP00 +K' P0000 Kx@P 0n 0 0 56y 0#K0@K 1 70S 0@0S > 0@K 1Y80S 0@0S >  56#K` 0"K0@K 1 70S 0@0S @ @K 1Y80S @$@ @K#K $00 d 0K0KrN T{Gzt??$H-M !K0S444 400000!K0K  ,0H- M !K0S``` `00!U B 000 K00H- M !K0SddJ/`00!B 00(s0 K0,H-M   0 ,00    0w0K,-M 0 0 $0 000000 0S 000 0 C00  000  000S 00 0 000SЋ/H-M 000 00S P0 000000S00$0S0K(-M 00 00 l0 000000;S  00 000  000SЋ/-M 0 0 00 00 |0 000000;S00 0 0 000  000S 0S00Ћ/0H- 8M0 4 8 <0 40L04 P  ?!K000 0S07( K(0K0(K0S @!0`$ 40L0R40L00C@!S 40P0R40P00C@l!F(0 ?B 00$4P 0 ? 08 8040"PP4000@ 00S<0S 80 4 <0 "<0S <00S 00 8 0 <0S <0 0 K0,8`-M !K!KR 00 0!KP0 0 0!KЋ/H-(M "KK  P0 0!KK 0 0 KK K P0PK"K P0P0 K!KP 0 0 !K0KH-U M  r0S&0000iS000g0C S񟗂pprprprpprpprprprprprprp 0 0~ 0| 0z00Si 00h0%0COS`hrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtr8r`rtrtrtrPrtrtrtr@rtrHrtrtrtrtrtr0rXr0000000 0 0S,00S000 0K,- MKK 0 K 00S000Ћ/0H- 8M0 4 8 <0 00S 04< 0)000$0 $0S $p$0 0 8080 0 $ ",0K %0S @!i48 0!K40!K 0 0!K!KR 0!KK0S 0!KK"K 0@P40! 0J 0 0< $00-S<040" 0< 0S <0 K4| 0 00S4000@ 00n <0 4E 0< $B0$>< 0 0S 0 0 K0БԑH-M 0SxxF t0Y00S`TG P0P00S@0H ,0G00 0 0  KThp@H-M 00 00ST 0)0SU 0!00 0  00 00 0 0S 0R 0SXHZ D0 0S 0 0 0 0 K@hܢT- M 0S 0000Ћ/@H-M 0U0 0Sttz p000 000S 00 0S0KĒhȢH-M 00 0S 00S0100 50S 0 00 00=0003/0S00 0S@00S '0KԒh,H-M 0S 0\0S, 0 0 0S00@ 0 z00 0S 0003/0S 0  0 0KԒhH-M  000,03/0 0 0S% 0  X0S   00 x0S 0S 3 0S 0  0KH-M 0S 100S xl h1000 0SP@,<1000,0S($!1000 03/0 0 0S1 0S&  00 j0S {0S  00 0S 0S 0 0 0 D0K h4LtH-M v00 000S0g00 0S0K0H- 8M8 80S!1H8t0Sk 040 40S!17400083/0S00-0K- [0"K80! V 0 0 0"K"K!K80BK"K 0P80"K P0!K!K 8"K0S% 8080"BKT"K 0 P0!KK"KP"K!K80!K P0 8!Kَ0S 8HU  08A0 K0Ԓh7=H-M  0S@@@!@10S0 ]/ 1000S !00H00 00S 000S^/00003/0 0 0S 0S 00S lDh D0 0  0 <0KԒhslȓuwH-M  00 0S 0  0  0  0 00KH-M KH-M 0SPPP P0.00S <,.,0%00003/K,hX<H-M 0S 0 0060S p00003/0S 00a000Z0K,h@(H-M 0S,,,!,100S !10000S000@ ,000S$ 00S 00_0S 0  00003/0S 00 0 000K,h(<PH-M 000S 0S `0S 000 000KH-M 0S444 40W000003/0K訔h/(H-M 0S444 40<000003/0K訔h;(H-@M8 80S@@/<2!80 000 0080,0 00So ,0Sn 000,0(0 (0Sf 00"(0!00cS0c ?"K00" @P 00"d 0 0*0!K000([0S U! "KKP000K80(0!00 (q0[0#0S 8000"0 0 0000    ` 00 vt00 0 S 0k80000 00Sz0K,h- M  0 00S00Ћ/H-M 00 0S 0r0 0 0  30S 0400S000  \0 0 0S0K,hH-M 00 0Slll l0C0 0 0 00 0R 0000  20 0 0S0K,hH-M  0Sddd d0000`0SH8D 80000`0 3/0K,htH-M 000d0S800d0000d03/0KhH-M 00S``/\0000\0S@4< 00000\03/0K$hH8H- M   0S 00000 0S0$O0Sn0   @l x000 3/0 0 0S0 0K,h4tH-M  0S``` `0i0000 0S00 03/0K,h H-M  0SXXX X0C0000 0$0S00$03/0K,h/H-M 0S$0@ 00K訕H-M 0 0  00 (0S "0S 0 0 0 0S0K- M 000Ћ/H-M  0SU"  0000s9.000S 00000 0S 000L0S\/\0000S\4X 4000L03/0K訔hԕT H-M 0S 000S:.0}0000 0SlXh X0q00P0SL0H 00g00P03/0K訔hؠT8H-M 0S!1I00 0 0  00 0S 0S0# 00 0 0R0 00 0S 000s0S000 0S0K,hH-M 0 0 0S/0 00 0 0 00 0S 0400S 0400S  N 0S0K,hH-M 0SLL/H000S000X03/0K,hH-M 0 0  00 0400S  A .0 0 0S0K0H- 0M( (e00 0S0V0!"K00 0<00 (0!BKPK 00A 0 0 ( 00 ( w00 0""K000 0S0"KPK 00" ( o00 0S ( 00 < 0 K00H- 0M( (p0S0g(0S0`00 0"K(0 00 (0!BKPK 00A 0 0 ( '00 (  00 0""K000 0S(00U# 0 0KPK 0(00B 0 0 ( 00 0S ( &0(0  0 K0H-M 00S0S000 0 0S000 0 0KH-M 00S 0|00S0S000 C0 >0S000 C0 0Kdh{pH- M   0S 0DH00 0S. 0 0  0  00 P 0 0    0S 0 0 0 4 0 < 0 8 0Կ0K,hXH-M ĿKH- M   =0 0  0S 00 00 0S 00  } 0 0KH-(M   0S<<0S 06!K0S 0 0 00R 00!K0  P0 K KR0 KP 0 KKT l`H-M   0 0SC 10SD 00SE 0 PF 0!PG 0 ? 0 : 0  0  0  !!!0Kĥإ H-0M   0 00 0S 00 ! 00S 0L0K0H- XMP T P0SDD @1tT0S0$ 1lTP0S 0aP0T0 P@T@TP,K FP0P0!TAP@TPLK 3`0PX0@P0T0!,KLK  00 K00إ<HhH-0M( (0STT P0(0(00"$K 0$0K(0K0إ|H-M 0SXX T0P0H00!   0;0K<U,إ`h0H- M 0Shh d00P0@00 00!  00 K0ĥإDH-@M0 4 00S 40S0m00 400l0,0 ,0S_ 00 400`0(0 (0SO 00 4000$0 $0S? 00 40 00 0 0S/ 40!0R 0!K40!0P 0!K!K !K ,($  000 0S ,($ 0 $(,0KH-M 0STTB/P0,0000000 0Kĥإ0H-M 0S ѭKH-PMH H0!HP0gH0H0 H0 0  0"KH0H0 H0 0! 0!KK 0QP K 0QP "KKPH0!KP08H0!KP 0 0!K!KR 0!KH0!KP 0 0 K KR0H00K!KP 0 0DK  !KH00D K0KH- M "K00 0S 0 00"K 0 K KK0H- PMH %KH0 00 0 H0%K 0 0 BP09H0%K 0 0!KH0%K 0 0!K 0 0!KP 0 0 0!KK!KP 0 0DK  !KH0 0D K0 K0H- M "K"K00 0S 0 00 ^ 0 K KKH-(M $ 0S0T$0SLLi/H1 00 $00R (U- $!1$0 D 0!KK 0QP01$0! !K 0!KK 0QP0 $0K!KP 0 0 !K00 0S0 40S0, 00Klإ|H-8M0 00S000000 0 0 0,K  0n,0K0x0KH-M  0S<< !K B>!KPL 004 0$J!K  I> !K 00$ B> !K 00$0(4 $ 0$0K谨 ,H- M  W00 0S+ 0 0 0 00S 00S 00$0 00 T 00 q0j0KH-M 0K00 0S 0S00KH-M 0K00 0S 0S00KH- tH- tH- 褓ԓH- 褓ԓH-|xt}p{lyhwdu`s\qXoTmPkLiHgܖ$Hlؗ U0) 8PhȘH-}{yw|uxstqpolmhkdi`g\eXcTaP_L]H[ܖ$Hlؗ 8PhȘH-"M( (20!S R 0C(2!@P`0:K 0 (@ 00S0-?K 㒥0S$ 2/ S04 ?"K|0pK !K(2(2@ 0 0$ $ 0c 00  0p00KdH-H-0H- (M( , (00!S R 0K,0S S s B( 0 0 (n0 0 (0 0 0S/ 0 00 00S 000 0 B 0 0!K!K(0!!K(0(0 K 00 0S 0 0 K0H-,M( , (0 00 {0/ S04 ?!(000! 00 0  c00KܩH-,M( (00 0S= 0! w0 00 000! 0P0S# 00@0 0C00  X0S0  0  0$0K ܢ00K$0K@0 0K(H-M 0KH-M 0KH-M 0KH-M 0KH-Dg@e<c,4 (   dtH-8844(,pnld tH-xM  \K 0  0 0S0\0X0 X0#L3RX000 3 ?%KX00 0$KX0 0 0$KX05 0#KX00 0#KX0L0(0 0$0 0 0 X0\00S00$0 $0S& X0d00SX0d00SX0d0 0SX0`0@0S X0`00SX0`0<S 00 0 0S 0$0 X0S$0S 0S 0m0S$0S0e0S 0S0](0S?#KP@90@@0< 80D D <0c 00P#K P0!K!KRp060H0T P0L L T0C 00|K  !K|0K4000@H0T P0L L T0c 0U2?0  00X嚢0KSH-M  0KH-M 0KH-M 0KH-'% #DTH-HF DDTH-M 00 0 0R 0*00 0 0 S0" 0 0 X400 p R400 0 0 0 0c0C D400 0 0R00K44PH-0M(   (K(Q P 0R! 1 0 1 0 K 0 ( 00S 00 $K 0 ( K|0S $00 0S 0S 0S x0SСΡ0K 0 0!Kġ¡(0(0 K 0KH-iДH-ДH-!M K 0  00S0?K0T 0S 22 K( 00KH-2H-YH-M 000 0Sll+ h00SXL, H00!S R @,  10(0 ^( 1!002!P`N( 1!0 K0 0SA ?K40P 㠛0S ?K400 㗛0S ?K40 ㎛0S'0pK048#8 0"K(2 0!K0202@ 0 0$ $ 0c 00  0l0(00(0 ( 80!0 0QP0KЫܫH-0 00T(H- 00TH-cMM@ @6!P`0c>K0C0C@ 00S0c>K0C0C80 80\5,80\5#408 80\5#848#8 80\5#< 1RF8000,8000#408 8000#848#8 8000#<04 0#K80$0,80$0#408 80$0#848#8 80$0#<0 0"K@6@6@00, (04 4 ,0c 00  00(80\%0R"80004 0"K80$0 0!K@6@6@ 0 0$ $ 0c 00  000KTH-bMM0 06!P`0b>K0C0C0 0Y0S0b>K0C0C(0 (0\5,(0\5#408 (0\5#848#8 (0\5#<0"S !S !SF(000,(000#408 (000#848#8 (000#<04 0"K(0$0,(0$0#408 (0$0#848#8 (0$0#<0 0!K0606@ 0 0$ $ 0c 00  0 0.(0\5 S S SU6& "(0004 0"K(0$0 0!K0606@ 0 0$ $ 0c 00  000KV#P H- ,*@XH- PNX@K-M0 02 0R0K 0 0 00S0," 4R (24 0"K3K "K0202@(0$  0, , $0c 00  00,2,,2#408 ,2#848#8 ,2#< <3R(2,(2#408 (2#848#8 (2#<04 0"K2pK ̠  2K "D@#T 0 0HB PR )~K@ mK`F@Pt2pK "h`#x 0 0Ġx | =K @P(2`K "# 0  0ppr t '.KB1@K PlR `hb lr'4h ̠` `"0`2 l2S0~!K Ћ/H- M 0S 0嘾0!P0%0K0 0l_0S00@0 0 0 0   0<0 40R000K0.0[KDPWEVH-M 0!/ 0 0  4M00 0S!  0 0 0  0S 0,ブ 0@00  0W000E000V0000}0000    0 X Y Z [ 0!0(")"*", + 0P0 0,"-".", / 0L0 00"U831"2", 3 0H0 04"5"6", 7 0P0 L  08"9":", ; 0P0 L  H  0<"=">", ? 0  H  I 0  J K 0 L M 0 N O 0 P Q R S 0 T U V W  0W000E000V0000}0000 0 0 C0 0"$("( 00KXPH-M 000 00PB00 0S0 00 0 0,㬔0K萕H-M 00ᶕKH-HM8 80000 88004 K  0]0S00 40,40ᓕ00@0,0 0(0 (0 C,0   "000<0S (0C, 0 00S (0 C,0      "000<0 0!K(0 C,0      "000<0(0 C,0   Ġ Ƞ"0 00<000C 0!K!K !K 8 g0$0 $0S; $0@0 0 (0C, 0 0 0 $0( 0 $00 $08 $00+0 0 0S 8$ 0S000K 0[0#0S(00(0 (0S+00KH- M 00 K  U9& 0\0S# 00 0@0 0 00S 0   0<0 @0R000 0,h0|KWEVH- M 00 0S000#03夻 00S # 3囻 000 0@00 00S 00 ֓0 0 q  '00 0Se 0@00 0C0 00 0C0!0  !  !  ! "00   0C0"0  ! ! ! "00   00 00 0 0S08#808#(0"$("(  0 0"$("( 0'0 ,Y[0S 00ᠽ00K舯PVtWH-(M    t0 0 0S$ 0S "00 0 @ 0S 0 0  0  0  0 @ 0 c0KH-,M 0@ 04 08 0 0"  00 0S0 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0KH-M 0S@@n/<0S0S 0@0BK謯P\H-M  0@00 0 8 0S0 00%0S 0 0 0KH-M   0S 00@0S 000Sv/00@00 0S S S0  00S 0 0  0 0S 0  U:% 0  0K謯PDدH-M  0S 0Ĺ0@0Sxht h0廹0@00 0S S S00000 00K謯P,- M  0S 03b0S 00Ћ/- M 0Ћ/- M  0 0Ћ/H-0M( (0 0 0$K ( 0Z$0K_0KH-M  0000  N0S 0@ )0KH-M 000s 00 0 00 00 0S0 0 0 00 0 0S@ 0K H- M 00 0S 000S&.00000 0 0  0 0 0S   0S s00K舯P_H-M $Z0S000K@H-M0K@Z00 0S $$$ $0嬸!KK@LPvH-M0K@Z00 0S $$$ $0呸!KK@LPvܰH-萕H-D萕H-M 800  0 ሐ0S00K蘱-M 00S 00S 00 000 0 S  S S  S  S000S0000S 00Ћ/H-(M 0Sxx t2( 0!P00K0  0X0S000 0!1408#(1Rg00 0 0  1 00S000  1 00S  1 00SF 00 0 0SU;00S0q0S90 0  1 00S/ 00 0 0S00S 00S00S00S 00 0S 000 3/0S0f00V0KU H-M 0S 0zx0 0 0S ׿00 0S .00 0  0K6H-M 00L00 0S00 00 0K蠕H-M 0S00V/,0/000 K-M   000 0S0S  0 00Ћ/-M  000 0S000Ћ/- M  0S00Ћ/- M 00 00#3040Ћ/- M 00Ћ/- M 00?00CЋ/0H- (M( , 0 ,0SLLL!L1島00S<,8!,1嫶00 ?"K00 ?!K00 ?!K"KP@ 0'!KRP 0 ,00 ?$ $B 00K,00 ? B 0 0K 0 K0$8H-(M0 4 #K00S!1O0S!1G40S00H040 4004   ?Ki 0"K400 ?K` 0400 ?W"K400 ?KP!K"KP/ 0"K4000C ?"K4000C ?!K"KO_ "0#P 0 0 "0# R0 0 $ [0  [(0<,!d`(0Ct030000 U<* 0 Kx8H-M   0Sddd d0ǵ0STDs/D0念0 00  0KhDH-M   0Sddd d0垵0STDP D0喵0 00  0K\DH-M  !K0S||| |0t 0Sl\.\0l 0   0<0!K 0KLDH-M  !K0S 0E 0S|lx l0= !K 0 Ġ  Ƞ 0<00C 0 0K@DH- M $ 0SDD~/@1 00S, (!1 0@0S !0 0@0 0 0$0S0/ 000 0$0 0$  0!K 0$0 0$ 6 0!K!K 0$0!KQP 0 !K 0$0!KQP 00KX h|H-M  00 0Stt!.p0宴s0S 0S0 00 0S0KH-8M0 4 3,K00 40S"2~00S/2v000S"2m0000St"t2c0000!/ 0 0 P,L",2Q0000!0ᱼ00 0S0u0080Si 00 00  '0!K 0 00800Ꮜ0S00 000  '0!K 00S0SE 00 0  00S: 000 000400 000 00040 0 0S$0?S! 0S 0S40  40  00000 U=? ? 040 00 哌0Kط$'Xh)*+H-M  0S )9屳0@0S )8娳0S(8堳0@00 0$0S0&0$0!00 0 ?)K0 ?)K0 ?(K0$0 (KK(K P0'K0$0%00 0 ?'K0 ?&K0 ?&K0$0!%KK&K P0%K)KR&KR@ )KPP&KP`0)KKPp0K 0 0@,@ 00KRP0'KP`0'Kp0 0$KL0;H0 0L0 K 0 0$K'KKP%KKP@00l h 0l b0p0  0t t 0C 0 0 P0$K$KP0ix0l h |0|l b0P0  0T T 0C 0 0 P0$K 0#K80D @0< < D0c 00xlh||l@PP TTa TSR 0#KPp0 #K P0)KP@0< 80  <0c 00K P0)Kዻ 0#K#&KPpp0< 80t t <0C 00K P0&Kl 0#KD @# 32#KPP0#K?P`0000"#KK 0"KK#KE 0"K#K!K"KPp0"KP0!KP@0!K?PP0~K 0 0$ $b 00U><K 0B 00K%KQPK 0 0'K0$  0  $0c 00 K 0B 00K(KQP 0.p0$  0t t $0c 00K 0B 00K%KQP 0 , 0 $ 0  0 0KX|$>H-M  0S<<$00$0" K4 0$0S% 0$0 00 0$0$0!QP 0 0 ' 0$0$0"QP 0 0 0KDO(XH-M   0SG.1Q0Sx!t1I00ShTd!P1@0 0  0 0 c0" " ", 0!0 " "",  00  000! 0 0 0KDqr0H- HM@ $K@0Sddd"d2ڬ@0SL<H"<2Ь0S40"2Ȭ@0!"K@00, K $KM0S0o,00 0o?0@  0U0100U00100 0o?0$K0SH 0000@70(0 (0S1 @0(00!(B(@TP 00 0S' 80K(0s?08 KK  (00!(@w0S @0 0 $K᙮00 ,0 0 K0سH-"M K 2S 0-2 0KK M0S 2/K,Ƀ2݄?Ko?0@ ^L00K2K$ 0 K K0KUH-(M 0S 0 0 0 0K  00 0S UA 0! 0 0! 0KжH-M0Ku00 0s0 0KH-(M 0S"2孫 00S"2夫 00 K  0L0S00 0 00S  0,ك 0 K 5 0!  1<0S 0""", ! 0o?0@ 㫃 0U0100U00100 $ 00 0S 0o?0  B"0 0C0S* 040S 90S# 000 0S 0 0   0f00 00S0 00Э00σ0KĶH-(M    0 0 0S6 0S( (L00 0 @ 0S# 0 $ 0| 0  0  0 0 0  0  0  0   0 @ 0 {0KH-,M 0@ 04 08 0 0"  00 0S0X 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0$0S% 8Ȳ0 0$ 0$0S00$ 0$0@0$ 0$0 00$0$0##0KH-M 0S\\\ \0-0S 0@00 0$00@0KXeH-M  0@00 0 8 00S 0S 00 0S 00W0S 0  0400S 0 0 0  0 UB  0  00S 0 0 00 0S 00S 00'S 00S 0 000S 0q 00 0S 0 000S 0 000S 0A 00S0| 00P0S00S 00 000 00S 0000 0 q00ʁ0S00S 0 0 000 00S 0000 0 P00D婁0S 000塁0S0 00 00S 0000 0 -00冁0S 00~0S0P 00r0S0@ 000S 0} 0| 0K - M 0 0  0  0  0  0 Ћ/H- M  0S#3Ȩ0@0S"2忨00S"2嶨0@00 000 00C S񟗟XPP8tPؖPPP040S@X"{00  080X0~0  0S0v|0 0  0R <0S   e0 0 0S0U 0S k0  080 0F 0S \0  08007 0S M0  0800(0  0800 0S 40  0800 0S %0  08000KX|h H-M  0Sb. 10@0S 00@00 00C S+XUC4p|d040S000000 00 0 00 0000000KXt|!- M  0S 0#P00S 0S 040S0000Ћ/FH-M   0 0 d 0S0 00 x00 V0K0H- 0M0 4 8 <0 4004   ?"K80S<0j<0S80e80 "K| 00$0 <0 "Kr 00 0 $  0R%80400 ?c 0400 ?Z@P<0400 ?Q 0400 ?HT"00!80 00cS0c ?!K00!<0 00cS0c ?!KK!KP<808<0 K00H- M  00 0 00   ?!K4K!K  00S0vDK!K  00S0j0S- 0!KP0_0 0!K P0dK  !K0S0K0! BTK 0S*09 0"KP!K 0!K 0!K P0dK  !Kp0S0 0"K   0b0S0 0"4PKD@KdKK  00 K00H- M  0 00 0 00   ?!K0!S R+0!K00 ?!K4K 0 !KL0S0\DK!K  0@0S0P0S dK 0  !K0S0@0! BTK 0S0. 0!K P0dK  !K0S0 0"K   0UD 0S0 0"4PKD@KdKK  0 0 K00H- Mp t 'Kp0,0 p00(0 t00t   ?"K,0S!1娥<K"K 'K0S0XLK"K  00S0L0S ,0!,lK (}0S,0;,0 0 0"K! 0!K,0!KP 0 0!K,0"KP0lK!K (!KR0S0(0" $0"?KH00H!00 0SA 00q 08 $0 00 A0/K s0S ㋴000 0 H H0S000K {0[0#0S !$00$0 $0S 0S H0HY0K,̸ܼDA H-M  0@00 0400S HH.D1Z0"00"0#4080"0#848#80"0#<0 0 0!00!0#4080!0#848#80!0#<0 0 00,00#408 00#848#8 00#<0 0 K谹̸ȼH-M  0@00 0400S   ! 100,00#408 00#848#8 00#<0 0 UJ0!00!0#4080!0#848#80!0#<0 0 0 r 00 qK̸ܹH-M( (20 0 0S$$$%$5壙(b">K,q5 2 0408#80C8#848#( 0408#80C8#8#48#808#8 4 K 0008#80C8#848#( 0008#80C8#8#48#808#8 84 K 080S 080(00 0".K p 0K(20H08#848#((20H08#8#48#808#(t3 K (20L08#848#((20L08#8#48#808#( 3 K (20P08#848#((20P08#8#48#808#(2 K (20!8#848#(20!8#8#48#808#(x2 K 00 00(ጵ00 0S  0001 ">KN?0j000 0S(20"0(20"0#408(20"0#848#8(20"0#<0p0 0l0 4h0 00 00(L00 0S 0"">KH00000 0S0(0 ">K0L">K0#408@">K0#848#8@">K0#<0(0 ">K(,80S (20$0S 00K,̸ A H-(M    0 0 0S0 0S 0 @ 0(㚠 0@ 0@00 0S 0S00 00 T0 o 0"04 0 0  0K(H-,M 0@00 0@ 04 08 0 0"  ឰ00 0S- 00 00 孱0S0 @ 0UK !C 0@ 0@00 0S 0 0 0 00:o0 0 0幰0KH-M z0S 0@0S,,, ,0姗0@0hp困K̸NH-M  0@00 0 8 040S0 0040S00S 008o0S0 0 0K$H-M   0000 0S S S. D040S 0S @!30:0S 0000 40/040S 0S @ 0#0S 0000 00040S 0S @P 0 0S 0000 8000K(X-M  0000 0S S S 04 000R0000 000R0008 000R000Ћ/- M  00CS00Ћ/H-M  0@00 040S 00 n0 @ 0嗛K贺-M 0@00 00Ћ/H-0M( (0$K 0 0㌻0S0$0Kk0KH-0M( (0(00 0 0$K   0l0S0$0Kl0KH-M  0S 0[040S000000  J0S 0@ %0K̸| H-M 000s 0L0004000S 00 00徲0S0 0 02000 0Sڸ 00400S 0 0 00 0 S 00嗲0S0 0 0 000 0S@ ƚ0ULKT̸+dX- M 0Ћ/- M  0 0Ћ/H-0M 0S!1嵕 厱00 0S 0! 00 00 0 0  Ϯ00 0S 000 0  :0S000K m0[S 00Kt̸WPH-M $=70S000K輸H-M0K@s700 0S $$$ $0S!KK輸̸s0H-M0K@r700 0S $$$ $08!KK輸̸sH-Ĥ谕H-谕-M   00 @0 0   0000# 80!$4@" 00 0 0R:0K/H-MK!KK!K 0 0!K 0K- M 0!0Ћ/- M \0Ћ/H- M @00cKH-M a'00 0 0 0\"]"^", _ 0KH-M 00 0 l0\ ] ^ _0<0@0 l0K0H- M  00 0S 0i0 l0\ ] ^ _0<0Pv 0@z0 k0 K0N H-M 0S! 0\ ] ^ _0<0SXXW/T0)0\ ] ^ _0<0llK 0H- M  0S!10\ ] ^ _0<0S 000 0R00 0S00 kUM  0P0\ ] ^ _0<0@0 wk0 K08e fH-M 00 0Sc/0屓00,00#408 00#848#8 00#< 0 0048#(00#48#808#(0 0048#(00#48#808#(0 KDH-M    L00KH-M   0S 0\0Si/0T=00 0S00   0<0 0 k0KT8H-MK0K0 Rk0KH-M 0So/00!1408#(x0R 000  T0 00S0000 0S0K`UH-(M 00 00 0S"2ڒ 0"P0q 0300  0  0Ȕ0S 0 0 0 幔0S# 0 100 0  Ġ  Ƞ  ̠   Ġ  Ƞ 0<00 QP00 OkE0S0#0K0  0a30S00 0 0S0S  00T P00 0S0 0 0%k 0KEFI PARTTl0H- (M( (p0$0 $0SQ 4㭚0 0 $0  $00SB (0! i 0 0 0!K(0 0@P@P(0! S 0 T0!K K!KP 0 0 (!K 0 ,, ! " # 0$0 0$0<$0$j0 K0pH-$M( (000 0 0S0e(0UN 00 000 (0 0   @  0<0P0`d`h`l`d`h0<0  0ᛶ0 ! " #0<0 0 "!""", #  0$$ 0 )i 0KpH-M Q001j#KH-0M $ ( 000 $0T U V W0<00 0 ! " #0<0 (0 (00 00!< 000 00!c 00 0Pi0 0@ 00!0 ၙ0 0 0S01 0$0H I J K L M N O0<0 0 0S si000 imi0  0 0KH- M  0K j0 0 0S00 O00 0X Y Z [0<0 0R00  0 vi0KH-K0C0C 0g0S B>K0C0CC0S 0400`"j0S0(0 (0"B>K0C0C<0 0 o0S0  0!K0  0 K!K K 0 ~00 0Sz 0@00 0SY/1ke 00$ 00 0 00}0S0000 0S0KH-M 0S 0`00S,0v`000s 05z0St`p `0f`00 00 000S@4 =e00KH-(M 00 0S   ! 1;`00S 02`0000 00D0  @  ? KK 0 0  Iy00 0S  庀0Sy00Kd- M 0Ћ/- M  0 0Ћ/Ug?H-M $0S000KH-M0K@00 0S $$ - 0_!KKH-M0K@00 0S $$ - 0_!KKH-1oH-XoH-(M  0 0P+ 0{_00!0g00 0S0 7  00 0 00! 00c  70 0  0a00 80K<H- M !K0!0 g00 0S\\D X02_ !K2a0S70 0  0KH<H- M !K 0 00!K0K0H- 8M0 #K00! P@[ 1^00! %h 0"K"Kh 0"K 0!K (0 0, , 0C 00K 0K0a0S08K 0 0!KK"KPP(0 0, , 0C 00 P0!K!KP (0 0, , 0C 00K 0K0$`00 K0T<\-0 @ BRн d @ P @ < @ ( @0 0@0K/xH-P0S'S%0@-TT t00010` 0R 060S 0001 000x`H-(M  6000 0S0.0"0!QP 00!!@t b00!0 QP 00 !@ b00KtH-M  z60Uh?|00 0S00  0KH-M  `60b00 0S00! 0KH-M 800 E60 50S00KH-M   060 0 0R 0 0 00 0 00  000   0RK-M 00 0 000   00 0Ћ/- M 0 S S S S S x S s h S \0 X0 T0P0L0H0D0@0Ћ/GESLTOOBDHSFBDABKSDRTRAP $,4H-M  e00 0S00  0  0KH-M 0 0  000 50 0 0SK-M  00 0 0R0000 0S0Ћ/-M 00 00,00#408 00#848#8 00#<00 000,000#408 000#848#8 000#<00 0 S<0 0 0 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0R0Ћ/0H- M 00,00#408 00#848#8 00#<@z00cL00,00#408 00#848#8 00#<Pa00c#408@00,00#408 00#848#8 00#<PE00c#848#8@00,00#408 00#848#8 00#<P(00c#<0 0 K0H- M  !K 0  !K]0S0Z0S 00, 00#408 00Ui* #848#8 00#<00S0; 0S5 00, 00#408 00#848#8 00#<0O!K ap p0`0S @S0 , 0  !K]0S0 0 0K@$H-M  `00 0 0 ) 0 ?x0S 00,00#408 00#848#8 00#< H0RO 0 00 0 0SD0KKSDRH-M 0Sttt t0@[0!0c0 0 0S0  00 30s00KtOH- M 0SXXX&X6[ 0D0 @  ?!K 0m00 0S0}00!0ec 0 00S30l000 00!P%5Z00!0 (30p% 0! 0 00!000!0#40800!0#848#800!0#< 0 0  0  0  0 0 $ 0 ( 0<0, 0<0#408 0<0#848#8 0<0#< 0@ 0D0, 0D0#408 0D0#848#8 0D0#< 0D 0@0, 0@0#408 0@0#848#8 0@0#< 0H 0 L 0<0, 0<0#408 0<0#848#8 0<0#< 0P 0<0, 0<0#408 0<0#848#8 0<0#< 0` 0<0, 0<0#408 0<0#848#8 0<0#< 0d 0 h !KDc 000 0 0 0C0 0 0,0#408 0#848#8 0#< 0 0, 0#408 0#848#8 0#< 0 0<00CUj) , 0<00C#408 0<00C#848#8 0<00C#< 0 0,0#408 0#848#8 0#< 0 0 0 00 0 00 00 00t 00\ 00D 00Kta oRDSKH-M 0S 0nY00Sk/0eY00St t0\Y000 00dk00 0S000 0 ,00KH-M 0SPPo/L0.Y00S8,4 (0%Y001kK-M   00 0!00 0R0 000  0R:0!00  0Ћ/0H- %MH H2Sw/6XH20S&6XH20!/ 0 0 &6XH20Sd|&`6XH20@0 H20@.0s@@&@6]0H2 @0@0@0@0#408@0@0#848#8@0@0#<0<0H2 @0H0@0H0#408@0H0#848#8@0H0#<0@0H2 @0D0@0D0#408@0D0#848#8@0D0#<0D0@0H0,@0H0#408 @0H0#848#8 @0H0#<0@0D0,@0D0#408 @0D0#848#8 @0D0#<0 0 B 0 0#K#KHzH20!0`0<0 <0S00,0 , 3! PK 0 ,00,0 ,0S0,0 @00,@00#408 @00#848#8 @00#<080 ,0 -K8 0SH2<80 00S<00<00,<00#40Uk<8 <00#848#8 <00#<0 0404B 00"K"K<00,<00#408 <00#848#8 <00#<0 0 0404B 00 0!K"K !K H p0(0 (0S<O00V(0@0<,0/(0, 0 (0 4 (000_ (08 (00ቄ00 0S08H( x0S00 0KG 0[0#0S (p<00",00,0 <00,<00#408 <00#848#8 <00#<080 ,0S80s6</0 K0,H-(M   0 0S$$$#$3W00S #3 W0 0 K 0!000s K a"2[0@S000 0 K0S000,00#408 00#848#8 00#< 0R 00,00#408 00#848#8 00#<0Q00 K @!1[0Y 0!00 00,00#408 00#848#8 00#< (1R0H0,0H0#408 0H0#848#8 0H0#<0  P0S000,00#408 00#848#8 00#<0 0 KK 0QPK0K67`DHSFGESL-M   00 000 0!00 0R 0!000s0Ћ/H-M  r00 r00 0S o0S 0K0H- `M` `0S  -;U`00S +;U`00S| hx+d;U`00!0I^0X0 X0Ul& S0`00XH0$0 $0s0$0 <0 `0 0 000@-)0S0,! 200!)0S0! &00)0S0 00 )0S0 00(0S0 0 0Ko,<LNXEXTSWPFAT FATHFSJFSNTFS$RFS0SUFS8HUFS@XFSH-M   0Sxxx!x1cP0@0SdT`!T1ZP0@00 00CSELLL 0S 00$0 00$0 000S 00$0 00$0 0 0S 00#0 00#0 00S 00#0 00#0 00K<H-M  0S 0O0@0S 0O0@00 00CSDD$Uo% 4004 0040030030K<- M  0S 03r0S 00Ћ/H-M  0S\\>.X0O0@0SD8@ 40O0@00 0$0 K<H-M 0S\\\ \0}O0@0SH8/80tO0@00 0$00K<H-M 00D0  @  ? K K}0K0H- hM` `000 0D0 @  ?!K,K!K  0Z}0S0/<K!K  0N}0S0#0. B0 0\K . 0t0S00",PK<@K\K\K  0[x0 K0H-M  0S 0N00Stdp d0N000  g0S 0@( S0KDH-M 0S 0N00S 0N000s 00 0 00 Nk00 0S0 0 0 00 0 0S@( |S0K'(xH- M 00 0S 0}N00S 0tN00`{00 0 . 0  g0 0 0S   o0S g:y05y0KCpD- M 0Ћ/- M  0 0Ћ/H-M $0S000KlH-M0K@,00 0S $$$ $0 N!KKlhLH-M0K@+00 0S $$$ $0M!KKlh0H-}]H-Up]H-M 800 k&0 %0S00K8-M 0 0 00K 0 0[0"0K 00 0 0?0 S0 [ ! [ !Ћ/-M 0?0 0 00K 0 0[0"0K 00C 0 0 R*0[S00Ћ/H- M 0S 1xM0K0 0V0S0/0 0 00 0!1408#848#( 01408#8#48#808#(d0R 00 0S00 @, 'R0&0KHT8\0H- 0M( (0H00 00   ?!K!K 6M(_0$0 $0S {U $0 $00S $000 00@_(0"!K1V 0UT  5L(0"!Kz 0 00 0 ,2% 00%00100A001 0 ! !008#848#(008#8#48#808#( 0"$("( ! 0  !  ! 0 !  ! 0 ! !008#848#(008#8#48#808#( 0"$("( !008#848#(008#8#48#808#( 0"$("( !(0"!KU 08#848#H(0"!KU 08#8#48#808#( 0"$("( ! 0`000 0000!00000000 0  0  0 0 ! ! ! !0 00 0#4080 0#848#80 0#< 0""", ! ! 01408#848# 014Uq 08#8#48#808#8 01408#848# 01408#8#48#808#8 01408#848# 0A1408#8#48#808#8 0A1408#848#H 0Q1408#8#48#808#80 0# $0$9^0 K0T,H-M 000 00H]00 0S000 0 /#0KH-M 00$^K0H- (M  000 0!1408#848#(01408#8#48#808#8 0D0R!0!1408#848#(01408#8#48#808#8 0@0R0 H0< 0!1408#848#(01408#8#48#808#8S  01408#848#01408#8#48#808#8S0001408#848#01408#8#48#808#8S00S00!1408#848#(01408#8#48#808#8 0P0R0!1408#848#(01408#8#48#808#8 0L0R 0H0L0P0!1408#848#(01408#8#48#808#80!1408#848#(0A1408#8#48#808#8 0A1408#848#H0Q1408#8#48#808#8 0`! 0O0@S0h0!1408#848#(01408#8#48#808#8 0P 0!1408#848#(01408#8#48#808#8 0L 0!1408#84Ur 8#(01408#8#48#808#8 0H 0P0 L  H  ?P 00`( N0 S 00 K00H- XMP P0S )9IP00S )9IP00S )9IP00@0 PkkP00H K  0f0SF @000 H0,%!H09"P'0S7 P00P0P  L  ?"KP00H0 ?$ $B 00@ 0<0 < 07    !000<0< 07  A@ Ġ A@ Ƞ !0 00<0#408< 07  A@ Ġ A@ Ƞ !0 00<0#848#8< 07  A@ Ġ A@ Ƞ !0 00<0#<0S <0 "0 00S <0 "0 00Sw < 07 !000<0< 07  Ġ Ƞ!0 00<0#408< 07  Ġ Ƞ!0 00<0#848#8< 07  Ġ Ƞ!0 00<0#<0 0$ $B 00"K"K< 07    !000<0< 07   Ġ  Ƞ !0 00<0#408< 07   Us Ġ  Ƞ !0 00<0#848#8< 07   Ġ  Ƞ !0 00<0#<0"K 0 0#K"K #K P `080 80S^ 80@0D0 <0 "0 0 D0 D00S  D0 D00S  D0 D00S  D0 D00S  D0 <0 800 800O 808 800st00 0S# P8 h0S00 0K3r 0[0#0S<00<0 <0S0 0 K0T= >?H-M  0 0 00S" 0!1408#848#( 01408#8#48#808#(80R000 00,0K0H- 0M0 00S(8F000Sxht(h8F000( K  00S0(000S(000000 00$0 $0o?@ $00 00 G000Lc00 0Sf0Sc0$ "0 0  $07 !00 0 00 0#4080 0#848#80 0#<$07  !  !  ! !00   0S 0@0 0 0  $"00 @0000P00  L  ?PO 00\0000P00  L  ?@O 00#408P0000P00  L  ?-O 00#848#8P0000P00  L  ?O 00#<$07 Ut  ! ! ! !00   0"0!00c00"0!0 0c0#4080"0!0 0c0#848#80"0!0 0c0#<$07  !  !  ! !00   000 0S000H0S000H0 `" 0 0$0R 0$ 00R t  0$ 00R 0 0  00 0 0 p0R 00!t0000-S 00!t00000S 0 0$ 0 p0R0 00!t0000S$ 00 0 0 0$0R 0$ 00R t m 0 0$0R 0 0 0p $ 0p  0 p0R  0 0$0R 0 0 0 00!t0000-S  00!t00000S 00S0 00 t    0 0 00!t00 |0S 00t00000-S000 0 |0S 00!t00000-S 0S 00!t00000S  00!t00000x:0S0T0 0P0 0L0 0H0 0D0 00`0 `00`0 `00S `00=S`  000c\0 |0X0 0@0 IX0 00\ 0S8X000 \0RX0T0 @0D0 0L0 2T0SX0T0 @0D0 0ST0 X00R T0 X00RT0 X0 0R 0<0 <0X  <0P  <0P0 X00X0 @00@0 X00SP0S_ L0S\d0S> T0l0 P0h0 l0KP0 <;t0 00t000 ;*P000 P00P0 P0S:080 80H0S 80 800R*800  80  8Uz  8Q 0@ 00l0 0 00 0 0  ?0P0040 P40P0 P0ST0S D0@0 00 0 `00SB T00S `0 0 qd0S& 000C!t00000-S L9t0 T00$9t0 000Ct0000T 0@ 00 0 0 T0 0 ?0T00S3 0 p0R 00 t    0 !d0S 88t0 T00N 0@ 000 0 T0 0 x00:S:0?0V 0@ 000 0 0S 0@  T00S T00T  0;T0 080S 00!t00000-S 000x0S4d0S$ 00!t00000-S 6t0 006t0 00t0000 < 04& 00 0 0  ?0 00 - K 0 -0[xc0,0 000S 00 0 ,0S -0[:S -0[;Sd0S 5t0 -0[d- [ 0 ?0,00WS],000;SX0 0 00 00 00 000S 0 0 00 0 ) 0 p0Rd0S 4t0 -0[o- [ 0 x00:S:0-0K?0-0K-0[ 00 t    0 0 0(0 0(  (00(0 (00S (00=S|0$0 00 F$0 0 ( 000c G0S1(  000c@$000T$0 0 00 00 ( 0S$0 0 00 0S 0 $00R  0 $00R 0 $0 0R 00 $00$0 000 $00S0S 0Sd0S 2t0 0 0U{ \ 0@ 00n0 0 00 0 ?0 0S 00 (00S 00S (0 0 Nd0S 1t0 00 0@ 00?0 0 ?0 00S/ 0 p0R 00 t    0 d0S 1t0 00 0@ 000 0 x00:S:0?0 0 0@ 000 0 0S 0  00S 00  0r@p$Hx 0 0` 0  W0[,000:SU,000:S 000S 0 0 00 0  0 0  : 000S 0 0 00 0 ( 0 p0Rd0S 1t0 -0[ - [ 0 x00:S:0-0K?0-0K 00 t    0 0  -0[KH-(M   0 0 0 0 0 0000h00 0 0 000 <0 00 ,0 ,0 0 0 0K(d,$0H- M   000000  00KH- M   0 000000  00KH- M   0 0000000 0  00KH- M   0 000000  0w0KH- M   0 0000000 0  0V0KH-M y00 (0 $0R0  0K4H-M 00 (0 $0R0  0K4H-(0 0$0 T00K00KO0S `00P000[0#0S 0(0 , D0R*@ ,00(  ,00,0 (00(0 (00S00K0(0 ( 0$0 0000K0[0#0S , D0R*@ ,00' ,00,0 T=(0 0$0 00K, 000 <00K0[S $0S 0 $0 L0RH 000($ \ 0S0[Sk00KH 00000K0[~S񟗝mqqqqqqoooopooqqqqqqqqqqqqqqqqqqpppppupppppuuuuuuuuuuuuuuuupppp nquuuuuuuuuuuuuuuuuuuuuuuuuup pupupuuuuuuuuuuuuuuuuuuuuuuuuuuhpphpp0[S< 0[S, D0R*@ ,00\ ,00,0 00 L0R%*00 H000/S00 H0009S, D0R*@ ,000 ,00,0 , D0R*@ ,000 ,00,0 000K000S N0S S 0[S00S 00 L0R*00 H000?S00 H000!0CS #80S 0[Su00 H0000K00000 , D0R*@ ,00? ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00? ,00,0 a00K"b00Kf00Kn00Kr00Kt00K U~ v00K0[0K0[S 0[S $0S0S0[S0[Ss 0[0KL0sH000S000L0S000S`00S_0S^0[S] 0S[0[S, D0R*@ ,00' ,00,0 , D0R*@ ,00\ ,00,0 , D0R*@ ,00' ,00,0 40[S 00 6 0[000@0S000K80K 00 00KL0sH 0L0 0 0 H00 00L  c<K80K 00 0Sn 0s00Kk0s00K000 0 0 L0R[*0 0 H000SS0[S: 0S70 0 00 0 0 H000[0C!S!xxsxsxsssssssssssssssssssssssssssx 00 0 0R:<00S00K 000 80K 0S 0S0[S 0[0#0S 0 000 0[S9 0[0#0S4 0[S, D0R*@ ,00\ ,00,0 , D0R*@ ,00 ["# 0  ,00,0 , D0R *@ ,0 0[1000000,00,0 0[0000K0[S , D0R*@ ,00\ ,00,0 00K00 0R_*, D0R*@ ,00 [ ,00,0 00000 H 00000K 0[0#0S 0[0#0S 0S 0[20! 00 0[030S0[0#0S0[Sz, D0R*@ ,00\ ,00,0 , D0R*@ ,00 [ ,00,0 00000 L0s H 0000S000 ptxQ80 L0R000S,0S0S0[S9(0S 0[U0#0S , D0R*@ ,00(  ,00,0 (00(0 (00S, D0R*@ ,00 ,0# 00 0000 000@DH L00KH-8M  $0 0S 000 00 0 0000( 0,0 0 $000 0  0KH-M     00KH-@M $ ( ,0 ,0S ,0 10 000 0 (0S0000 000( 0,0 0 $0H00 0 00 000( 0,0 0  $0.0  (0S 0 C(0 0KH-M00 0 00 0! 000000 00 R: 0 l0R 00T0, H0@  80R 0 0 KD8<H-TM8 < @ D0 B0000 80,0 p20(0 80SX2 ,0R4,00$0 ( 82R000K$0s0[S 0(0$ !?0(0 1(  0[S (0!10!(0 10$0c1 |1$  80!(0000 80!(0000 D0000 D0D0D0( D0,0 0< @0t00  0R+80!(00      0R 80!(0@00 00D0D0D0( D0,0 0< @0B00  0KD8<H-M    0F0KH-M     060KH-M 0KH-M   0KUH-@M8 < @ 40K<40K8@ 0KH-@M8 < @ D0 40K<40K8@D 0KH-M   0KH-M    00KH-@M8 < 0=0KX04K4 K=0[ 40K8< 0KH-M 0 0K 0[ 0KH-M :0KH-M   : 0KH-M   0 00  00KH-@M8 < @ D0 T04K40K<@ 40K8D c0KH-M    00KH-M   0 00 00KH-Mx | x00 0S 0 Cx000/S t0Kx;0Sl0 0x| 0KH-M  0S00 00 0S00 00 0KH-M   90KH-M  0 0 0S00: S 200 0 C000/S0 0 0KpH-4M  $0 0S ,4$    0z 4 $0s#3n 00 S$(Dh4 <00 T0 000tK0 000D>0 000 -0 000 0 000  T0 000@ @ U i0 000P @P@ dH0 000` P@ `P@ #0 000` P@ `P@ DwKp| `p<lH- M   0 00 000 0!000S0000 0KH-HM8 < @ D0 00 000 0 S0 + K  + 1K000S00K0008<@ D0K0-H-$M   0 0 00 0KHЍ/H-00x,,, t(00$? m(LH-00 0M$H-M  .0 0R*0 a0KH-M   .0 0R* 0 [0KH-M   000 0S0S@.00 0S00 00 p.0 0R000 00 0  0 !0K說H-M 0KH-M 00 0S0S n0KH-M  0S0S  0  g00 0S 0S O0KH-M    0KH-M 0 i0KH-M  $00 0S!0KH-M  0 0KH-M 000K- M000S$0U 0 0  Ћ/(0- MK $ !40*"*0@P0>00K0/- MK  ,&  6000Ћ/H-(M( , 9 0 00 0 ,0 ,00S0e,0 00$0 ($)00 0S0S$ / 000 0 0 0 ,00 00 0S 000 ,00+0  03,0  0S,00,0 0#,0 00o0 0 0S 000 ,000  0 ,0  ,0 00 0KH-(M( , 0 0 00 s00 0S0] 0Kj0S0R 00  00 A00 0K0 0S   0S%00 # 0$0 $0S $00,E0S $0K 00  (0R 000 [ 000  g00 0S 0u0K- M 00C6S8강00Ћ/- M 0GS0OS0gS0oS00Ћ/- M 0OS0WS00Ћ/- M 0S0S00Ћ/H-M 0KH-M  0S 0(000S  0(00\0S00@00#00P8 0,0S 0K4H-M 0X00 |0KU0S0l0: S 0 0%K00 0  %K0 0 0  0S 0 S 0@S0GS0S 0S 00S0 0S 0?0S0 00S 00S0 0rS 00S0 0S 00S0 w0^S 00S0 l0pS 00S0 a0S 00S0 T0S 00S0 G0S 00S0 :0bS 00S0 /0S 00S0 $0S 00S0 0S 0 0S0 0 S0 0 0KH-M00s 00'c?K0S 0 00c?Kp.Ke?KfK0S H0 <00 1(14 1 0 00KĖH-MP00s @00 00  (0R  0 00KH-$M 0X00 ,0!,0!0(0S 0& 0R,0!$0 0K 0S 0@00!00,0 L 0R+0 ?!0!!K(h8H-MY00  D0R0  00R $0R00KH-4M0 00X00 0"K00(0Stt/p1)&00!/ 0 0 @4K[ 2 1[0S 1[0S 1[K 0S0|>K0K\tH-M  0X00 0 0 p0Kh c0p0 `0l0 0h0K05020g0K`0d0K0f0K0e0K0c0K0 p0K s0S0 Kp0K0 00K0K 0 Kp0K0 0U 0K0K 0 0KH-M   lk 0 Xe 0 00S 00S 0  0KxH-,M( (0X00 ($0Sm 0 0K 0S(0 %(0 %(0@0000`\!0j(0 SB(0S? ($0E08#((0%08#((0%+0 (0 (00S)  K 0K( 0S (0  00 0(0 x0 (~0S ($0 ($0KSK-xM 0K0Sp L$0Sm ,0!0$0 $0S $0 0 0S 0;;S 0 ?!0!!|0: S 0"K0!, 0"0"P 00@ 'A$*>$0"lp 0C@S 00H 0 L 0 P 0 <0H <0 0 00KdK-M  0Kt0Su #0Sr '0S 'ZM 06''\3''00`|!a'0 0 0 S @SL S;"'K ?Ϡ Ϡ 0;0 *K 0d`t 0"0"Ϡ Ϡ 塌 0C@S 00H 0 L 0 P ,0!,0!ddd d01"s0 0 #0#0KhlH-M   \ 0 H 0 00S 00S 00KH-M K0K 0S p 0Kp0U080 K (0b0K(0KH-M 0S```$`4!` *00 0S 0 0 00S * 0X 0X0S 0X0 0 0 0 ( 0 , 0 0 0 4 0 8 0S 0 0S񟗞ꄳԱ\̲x@h$Գj0S0S0S0S~0Sy0St0So0Sjl0SexT0S`q0S\k 0 0Sg " 0 0K 0s\ 0m0S000K00[0#0S= J\0S8CU0S3<0S/6\H0S*/DA0S%(@(!%# 00X0{00uq0K(@Xt0LH-M 0X0 0 0 00 M0X0I00E00A?KH-M 000S 000 0 0 0S0 00 0S 0000 0S0KH- M 0X00 0,0SK0 4 00,p0SA00 80 0 0S8 U0S&  t00 0S0S0S00000T 0$0S 000 0SKaxH-M 0X00 0U 01 0 00s4Y00X00 00 0 00s0@D00C00P 0$0S 000   H $0 , 0 , 0SL0K- M 0Ћ/H-M 0X00 040S 0000S00)0S0@00000 0B$0S 0KxH-M 040S 0K0H- (M "K 0!/ 0 0  01 0S 0) 000S  0  0X00 0!,(,B 00!K!K00 !K!KQP00 K0cdeH-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K F0sP00O0  pT #00 0@S00S 0K{|l0H- 0M( , #K(0X00 0 0 (0S#3(0!/ 0 0 #3 3R<(0 0S8 (0"000S1 K  0(0B 0 0QP  0 0 (,#K` 0S 0 00$,00(S0S 00(#K0S (0!0 0 (0!0 K 0S&'000(  p"#00 0S SS S @S 0d"0a!10Z0 0 00 0S 0,  0R 00?0S0 0c0 0, U 0,0 20S@@[00Z0(  p "00 0S SS  S @S 0|0 d" 0u0<D 0 K0l<H-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K 0s000  pT E"00 0@S00S 0Km\0H- 0M( , #K(0X0 0 (0!/ 0 0 #30(0,0S (00`# "0 S 00" p3R?(0 0S; (0"000S4 K  0(0B 0 0QP# 0 0 (,#K:0S 0 0(0!0,00(I0S 00(#K0S (0!0 0 (0 4 (0!0$ K |0S&'D00C0(  p!!00 0S SS S @S 0YQ!0V|`x!`10O$0, @$00 0 $0 00  0RF070S0 0c0 $ 00$0 *000(  p L!00 0S SS  S @S 0 !08< 0H K0!ttlO\{H-(M $ "K 0X00 0!K 0SXXX!X1% "K0S 0E04 K 0S 08 0!K)0!K P0 0!0  00 0S 0$ 0S0 0!% 0K 0!KK UP0!KKhH- M 0X00 0050 0 0S0%?00>0  pp 00 0S SS S @S 0L 0 0K\l\H-M 0S||| |0000S hXd X0w0,0S 0 0S00KPH-M 0Sttt t0R000S `P\ P0I0,0S 0r0S00K@- M0  0K@0 0[0000S   0R00Ћ/H-M /0S 00 0 0 ' ??  0cS000 00S0000S0000 000S 00 0 0S00S00KH-BMM00 !100 0S0[">K g0SO ">K _0S-G2>K0S 1@2>K@0 C1 K 000000S A>K 0C0C A2.KA>K 0C0CA>K 0C0C">K &0S "K` K0K K2K0S 00 0KtH-M d00 0 00 j0S0000 00S0K萖H-M000 0S40A 000S- 000S(0.K 00.K!>K0 00!S 00.S0/ 000 00S>Kv"0 0 0S0KH-t]p[lYhWdU`U S\QXOTMPKLIHGDE@C0 $0<HT`lxH-y0S-H-M0 0 0K V00 0S00KHЍ/H-M  00+00 0S0 00C00S 00C 00 00 0 *0 0S 0 0S 0 0S 0 0 S |0 000C000000S H0D00 008 00 0 0KdH-M 00 0000KH-Mx K 0x00 0S 0*K G>K0C O0SG.K Bt0K_0S K\0K QPK0 ?K 0S>0KtH-MKX K0S D K0S0 K0S 00KH-pMp l0Kp0S 0 \0: S 0$K0KH-M u20S000 0000 0 0S0 00 Y0S00KH-M 0SHHH H000040S00K H-M 0S 0a0S 0040S0<00 0S 0000 0S0K H-(M $ ( 0X00 (00 00 00 $0 0 0 0K  0S00Ki0H- M  0S"200!/ 0 0 TDP"D2o0S000b,0S 300 00 0 000E00 0U S0f0K #000! B 0 0*K0400S 0"SR,0+0*K 000! B 0 0*K0000 0 K @ 0S 0KT0@ Y0 0K O0S00 0K0 K  `< `0 S000 K03 4 PH-M  0S00K 00 0 0K 0KH-M @000 K 00 0S0S@0! K000 0S@0d 0K 0S00 0Kc 0[S 0S0@0K,t@H-\MX X0SLL.H6X00S4(0&$6D0KX+0S D0@X000T:X000D0D0 X000D0 D0S0_0@0 D00<0 <0S0RD01(080 80S? @540 000 000%40,0 0(0 B(0S 400K00 ,0!<000S"0!<0@00X(000!80@0000!<000S0!8000S00K000 D0 R0[0#0S(00(0 ( ,0R:0(0 X(300 0S{ (00C!<000S](00C!8000SU 0%KX00(00 0S 00 0s L0K  0ST0K 0S @"00s KX00!R 0%KH00!QP"0"%KQP(00C!<00 X0Sr00q00P!(0hU(00(0 D0( Rt0$0 0(0 1(00C!<000S#(00C!8000S $0S D 0100$0 $0S: $0 $F $0 1( (00(0 D0( R$0S0@0 $+0 C$00 X0000` $0j0 S0@0 $B8:<8@0KD '@BrXH-MP00s @00 [00  (0R  0 00K茖H-M 0S000 0S 0S888 80 0S00K -M  00,00#408 00#848#8 00#<0S 0a030C!000,030C000#408 030C000#848#8 030C000#<0S 050 0 00 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0# 0R0S 00Ћ/H-@MH L 0 0 00 00 H0S8 |4H00Sh\9 X4 040$0 $0S@,$,4XH$0S[ $00,$00#408 $00#848#8 $00#<00 $00,$00#408 $00#848#8 $00#<00 0S 000 $00,$00#408 $00#848#8 $00#< $00$00#408$00#848#8$00#<03 0 $ 04p0@0 @0S@h"`2H0H0  @0SH0 @"2t@00,@00#408U  @00#848#8 @00#< L0R\H0 0 ? 00 ? P0#KK 0 0OP 00b "KH0@0"K 0 ? b 0 0 0#K#K   0H0 0 ? @#K0S#K @x d0f @ \0S@ 04 ,0$,04S@%c04,044S@$Y0*, B> @$M040000 ,00$,004S@l$;0 ,004SS00 0408#8, $ ?, 00' ( ) *0<0 ,0@$,0 p$, E>ӀK, 3,044 ?  0 0K 0,x ,0t4",044 0 0,@ , 03, (3 0,F ,004Se00$ % & '0<0, $ 0, 00C D E F0<0 ,0@$,03, $ ?,X ,03, $ ?,4 00, - . /0<0 ,0p$, 0 , 0 , E>ӀK, 1,044 ?  0 0K 0,F , @1, F> P, B>  0,0($,0040(0 ,0(40, 0 tpd(0 ? 0R , 0 TPD(0 ? 00 C,0($,042 ,0,$0K $\8XxHhH-M 0SXXX X0(,q0< 0Z0( 0K6 H-M  0 00 0S\\\'\700L 048#848#(0 "$("(  B>04 ?U& 0 0  E>04 ? 08#(0"$("(  044 0 004S0t48#80 #48#800 604 ? 0@P004S"0    504 ? 00 "!""", #  $504 ? 08#(0"$("(  0 ! " # 0  048#(0"$("(  048#(0"$("(  00 0""",  004S0    304 ?; 00$"%"&", ' 0 ( ) 0 * + 0p$0,"-".", /  204 ? 08#(00"$("( 1  d204 ? 08#(02"$("( 3  0<<@00A0040 0) B 0@$0C"D"E", F 0G0p +0R0\ %= 8104 ? 08#(0"$("(  0 $ 0) & 0@$0'"(")", * 0+0t 060d  0U0100U0010KCl L8HhXdpH-M  0 00 0S 00 0  0-0S0004S0 `0  -0S000l-0KT U<hH-M  0 0 0 0Si/00 0  ,0S0%0!  1<0 |0R 0!  1<0`@ 00 0@S00K|< HrrAaH-M  0 00 0Sppp p0~0 `0  '-0S000,0K|$ H-M 00 00K000 00/S 0 0  00/S00K0[S 00 00K 00 0 00S0Ћ/H-M 00 0 0  00C 0 0S 0 C000/S 0KH-M  0S 0S00 00 0 0 0 0R 0 00 0 0KH-M s0S000K0S000K!0S000K0[S 0[S 0[SO00 S 0[0#0S E0 00KH- M 00 00 ;0 0 0S0)0S +0  00 0QP ?0S 000 00 0S 0  00 0KH-M `,A00 0S@0 0"SJ(( 0  0K H-M   0 0 0R* 00 00 00C 0 C00 "00 0KH-M   0S0S 0 "020 000  0 0 0S00 0 00S O0 0S 00S00 0}r0  0K H-M  U) \0#90 00 0S (0#9 0cf0KC@B0H- M  0@0 ? 0T 1 0$0 ? 00 P@ 1 000 ? B 0 0 0 K0H-M   00 0 00 0S000  B S0KH-8M0 4 8 <0 00 80S80$SS 440S$0K40 0 0 0 8  0"K 0 00R0S 000S 0000S  0"K000S 00"S 000 0S"K< 0 000S ;0 0 0 0000S"K< 0000S 0000DS iS BS  0000BS  00 0 ?0 00 0 000B0C5S񟗍<-..d-.-...-.-..-........@.`........ -X-...-...-.-.........$.,0K00 V,0K00 O00 L,0K 00 D,0K 00 <,0K 00 4,0K 00 ,,0K 00 $,0K 00 ,0K00 ,0K 00 ,0K 00 "K< 00 000 0 0 0 000S 000 "K< 0K0 X d H-M h0 0   00c0 00 0S  00 0R:0KH-M10sZ0K7 1 10s t1 l1U* 0S\1000 0S41 00 zh08@0 $0 "00".[08#(08#80"8#88#(0 08#(08#80"8#88#(0  00"C88#(d0 0K 00"00 00C0 0S 00Kp  0H- (M0 4 400 {00 00 000 0S$ 0 0 0 0S 0S000   S   00c0 0 00 00 0S000 0 0 @0P030 0"000000 00 0 40R(0K 00@08#8 0"8#88#(0 000 0 0 @0P(0K030 0"000000 00 0 40R(0K K0H-MMH  00 0S0hC>K0C 0C+*;@0 C>K0C 0C<0 @0Kl J0S0O@00 0 0 C<0 000 08 K 80K .0S*80K00 00S000S000S000S 000S000S H4S H :F0 0 0 0 0R80K'H-PMP T X \0 (60sw00 B. 5 l50 5 50S50 5 03K03K080 040 000 p50S'l5000 S 00S 050}505 4 <0K 0S40S4@ KD0KHKLK0S@08#89#9|$0D0 p4 H0 `4 L X4 L40S<40S(g409#9 $0U?%30 C3 ,0K, 30R , 30R( 30R3008#89#9t#0t3 d3, K, L30R( 830R ,30 S30 3 3 2, K( 0100 200 ?"K,0 ?` 00K 0"KK? 0"K\0S= \00S9\00 C020 $2 2 20qA?0c 1 11C!? c0100 c1 1 10aA?0c 1 1 1sC?0cx0cX!0810S8410$1@ 10 10 !00 00000S 00 000003K`0 <0K 0@P P0 $ T0 40 X0 0K@    gfffC@B  H- M  0 0 00  9 00 0SB00 S =00S 0S 0S000   S 0S 000S00 0 0c 0 0 00 00 0 0S 0KH-M00 0 0 5 0S( 00 0 0RK H-NM( , 0! 0\0 0 0  600 0S00C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$//SRQPM`-QЍ /SRQPM`-2Ѝ /@-mp@- 0P@Pp@ p0p@- D0`p/@G (0 0&  Ѐ=C-@P`pNT$ 0`Vp 0`C-@P`pT$ 0`Vp 0` *& *Z>>*SJ51:3////QO-`MSS@P3R??oS c0"C$S *x'x % SI* SI c   XXWPJ*WJ p\BpV 0 r0ЍR@oZ d($x   Z % SIU& * SI c  G8#XXXPJ*XJ poW g201;(   ' "Ƞ'8P0Kt:@` 0 @ ("Ƞ 8Z0@D[:j *Ƞ" H"(Q:Ppp Wt Jpq r0`0p`* pj57J;$x _(" ,8R0K(:b K Ƞ ,8R0I*RI0 Z bM\R!0-Z0@DPK0RK0SO-@ M`pP3R?oS c0"S%h H$H ( SI* SI c p m("TpG*TpG SooV~ f20v4'    K0 H #6 RI: b  0 P 6 8#(0(T PE:@d )#X  " (,T:RQ? I<RPoY6@e!%x` (( SI* SI c r@ Ƞ,Z@D*Z@D SR! Ѝ pi8Y4g%xL* ,hHS@K :@c9`H$8HR@`F*R`F@@b hT PEo RIWSK@0 0 R =) -L nonecylinderminimaloptimal@gHgTg\ghelplistmachinescriptversionalign-pretend-input-ttyghglgmgU3sgvgagdisplays this help messagelists partition layout on all block devicesdisplays machine parseable outputnever prompts for user interventiondisplays the versionalign=[none|cyl|min|opt]alignment for new partitionsgLhghhghghghhiNUMBER is the partition number used by Linux. On MS-DOS disk labels, the primary partitions number from 1 to 4, logical partitions from 5 onwards. LABEL-TYPE is one of: FLAG is one of: UNIT is one of: desired alignment: minimum or optimalPART-TYPE is one of: primary, logical, extended FS-TYPE is one of: START and END are disk locations, such as 4GB or 10%. Negative values count from the end of the disk. For example, -1s specifies exactly the last sector. STATE is one of: on, off DEVICE is usually /dev/hda or /dev/sda NAME is any word you want Copyright (C) 1998 - 2006 Free Software Foundation, Inc. This program is free software, covered by the GNU General Public License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %s... %0.f%% (time left %.2d:%.2d)Partition %s is being used. You must unmount it before you modify it with Parted.Partition(s) on %s are being used.The existing disk label on %s will be destroyed and all data on this disk will be lost. Do you want to continue?ped_geometry_test_sector_inside (range, *sector)parted.cwhat == SECT_START || what == SECT_END0start_dist >= 0 && end_dist >= 0start_dist >= 0end_dist >= 0ped_geometry_test_sector_inside(start_range,start)ped_geometry_test_sector_inside (end_range, end)start <= end -%c, --%-25.25s %s New disk label type?ext2Partition type?dvhPartition name?File system type?Start?End?user_constraint != NULLdev_consU0traint != NULL Is this still acceptable to you?You requested a partition from %s to %s. The closest location we can manage is %s to %s.%sThe resulting partition is not properly aligned for best performance.ped_partition_set_name (part, part_name)Partition number?, dev != NULL%d:%d:%d:%s; BIOS cylinder,head,sector geometry: %d,%d,%d. Each cylinder is %s. unknownCHS;CYL;BYT;%s:%s:%s:%lld:%lld:%s:%s; Model: %s (%s) Disk %s: %s Sector size (logical/physical): %lldB/%lldB Partition Table: %s devicesfreeall%s (%s) NumberStartEndSizeTypeFile systemNameFlags%2d %2s Free Space%d:1:%s:%s; free;A %s %s partition was found at %s -> %s. Do you want to add it to the partition table?searching for file systemsNew device?part->disk == diskpa->grain_size != 0alignment type(min/opt)%d aligned %d not aligned Flag to Invert?New state?Unit? %s %s align-checkalign-check TYPE N check partition N for TYPE(min|opt) alignmenthelp [COMMAND] print general help, or help on COMMANDmklabelmktablemklabel,mktable LABEL-TYPE create a new disklabel (partition table)mkpartmkpart PART-TYPE [FS-TYPE] START END make a partition'mkpart' makes a partition without creating a new file system on the partition. FS-TYPE may be specified to set an appropriate partition ID. namename NUMBER NAME name partition NUMBER as NAMEprintprint [devices|free|list,all|NUMBER] display the partition table, available devices, free space, all found partitions, or a particular partitionWithout arguments, 'print' displays the entire partition table. However with the following arguments it performs various other actions. devices : display all active block devices free : display information about free unpartitioned space on the current block device list, all : display the partition tables of all active block dU% evices NUMBER : display more detailed information about this particular partition quitquit exit programrescuerescue START END rescue a lost partition near START and ENDrmrm NUMBER delete partition NUMBERselectselect DEVICE choose the device to editsetset NUMBER FLAG STATE change the FLAG on partition NUMBERtoggletoggle [NUMBER [FLAG]] toggle the state of FLAG on partition NUMBERunitunit UNIT set the default unit to UNITversion display the version number and copyright information of GNU Parted'version' displays copyright and version information corresponding to this copy of GNU Parted partedGNU partedhlmsva:--alignUsage: %s [-hlmsv] [-a] [DEVICE [COMMAND [PARAMETERS]]...] No device foundWARNING: You are not superuser. Watch out for permissions.You should reinstall your boot loader before rebooting. Read section 4 of the Parted User documentation for more information.You may need to update /etc/fstab. partition_align_checkscsiidedac960cpqarrayfileataraidi2oubddasdviodasdsx8dmxvdsd/mmcvirtblkaoemdq}}}$}0}8}@}D}H}P}X}\}`}d}l}t}x}_print_disk_geometrydo_mkpartsnap_to_boundariesprefer_snapsnap%sline_length - indent > 10strlist.c %*sstr_list_print_wrapGNU Parted 3.0 Welcome to GNU Parted! Type 'help' to view a list of commands. Usage: parted [OPTION]... [DEVICE [COMMAND [PARAMETERS]...]...] Apply COMMANDs with PARAMETERS to DEVICE. If no COMMAND(s) are given, run in interactive mode. You found a bug in GNU Parted! Here's what you have to do: Don't panic! The bug has most likely not affected any of your data. Help us to fix this bug by doing the followingU& : Check whether the bug has already been fixed by checking the last version of GNU Parted that you can find at: http://ftp.gnu.org/gnu/parted/ Please check this version prior to bug reporting. If this has not been fixed yet or if you don't know how to check, please visit the GNU Parted website: http://www.gnu.org/software/parted for further information. Your report should contain the version of this release (%s) along with the error message below, the output of parted DEVICE unit co print unit s print and the following history of commands you entered. Also include any additional information about your setup you consider important. 3.0 Error: SEGV_MAPERR (Address not mapped to object) 0ui.c Error: SEGV_ACCERR (Invalid permissions for mapped object) Error: A general SIGSEGV signal was encountered. Error: FPE_INTDIV (Integer: divide by zero) Error: FPE_INTOVF (Integer: overflow) Error: FPE_FLTDIV (Float: divide by zero) Error: FPE_FLTOVF (Float: overflow) Error: FPE_FLTUND (Float: underflow) Error: FPE_FLTRES (Float: inexact result) Error: FPE_FLTINV (Float: invalid operation) Error: FPE_FLTSUB (Float: subscript out of range) Error: A general SIGFPE signal was encountered. Error: ILL_ILLOPC (Illegal Opcode) Error: ILL_ILLOPN (Illegal Operand) Error: ILL_ILLADR (Illegal addressing mode) Error: ILL_ILLTRP (Illegal Trap) Error: ILL_PRVOPC (Privileged Opcode) Error: ILL_PRVREG (Privileged Register) Error: ILL_COPROC (Coprocessor Error) Error: ILL_BADSTK (Internal Stack Error) Error: A general SIGILL signal was encountered. : command_line != NULL'"str_list_match_any (possibilities, def) /[]? ]? invalid token: %s%d*valueExpecting a partition number.Partition doesn't exist.Expecting a file system type.Unknown file system type "%s".Expecting a disk label type.*value != NULLprimaryextendedlogicalU3Can't create any more partitions.Expecting a partition type.onoffoptimalminimalOPTIONs:COMMANDs: Report bugs to %s bug-parted@gnu.orgUsing %s (parted)This command does not make sense in non-interactive mode. command_line_get_disk_typecommand_line_get_disk_construct_promptcommand_line_pop_wordsa_sigsegv_handler ncols >= 0table.ctt->ncols > 0s != ((void *)0)**s == '\0'table_render_rowstable_render_rowtable_add_rowtable_calc_column_widthstable_destroytable_new3.0[%d] %s:%d (%s): %s Assertion (%s) at %s:%d in function %s() failed.path != NULLdevice.c/dev/mapper/dev != NULL!dev->external_modedev->open_count > 0dev->external_modebuffer != NULLped_device_sync_fastped_device_syncped_device_checkped_device_writeped_device_readped_device_end_external_accessped_device_begin_external_accessped_device_closeped_device_openped_device_get_ped_device_probeInformationWarningErrorFatalBugNo Implementation FixYesNoOKRetryIgnoreCancel8<@DHPXn > 0exception.cA bug has been detected in GNU Parted. Refer to the web site of parted http://www.gnu.org/software/parted/parted.html for more information of what could be useful for bug submitting! Please email a bug report to %s containing at least the version (%s) and the following message: bug-parted@gnu.org3.0%s: %s Out of memory in exception handler! ex_fetch_count > 0ped_exception_leave_allped_log2fs_type != NULLfilesys.cfs_type->ops != NULLfs_type->name != NULLfs_types != NULLwalk != NULLalias != NULLfs_aliases != NULLname != NULLFile system alias %s is deprecatedfs_type->ops->probe != NULLgeom != NULLped_file_system_probeped_file_system_probe_specificped_file_system_type_getped_file_system_alias_unregisterped_file_system_alias_registerped_file_system_type_unregisterped_file_system_type_register3.0U0Out of memory.handler != NULLtimer.cnest_frac >= 0.0nest_frac <= 1.0ped_timer_new_nestedped_timer_newsBkBMBGBTBcompactcylchs%kiBMiBGiBTiBCannot get unit size for special unit 'COMPACT'.0unit.cdev != NULL%lld,%lld,%lld%lld%s%1$.*2$f%3$s,.-%d %d %d"%s" has invalid syntax for locations.The maximum head value is %d.The maximum sector value is %d.The location %s is outside of the device %s.%lfInvalid number.ped_unit_formatped_unit_format_customped_unit_format_byteped_unit_format_custom_byteped_unit_get_sizedisk_type != NULLdisk.cdisk_type->ops != NULLdisk_type->name != NULLdisk_types != NULLwalk != NULLname != NULLdev != NULLPARTED_DEBUGprobe label: %s %s: unrecognised disk labelold_disk != NULL!old_disk->update_modeold_disk->type->ops->duplicate != NULLold_disk->type->ops->partition_duplicate != NULLgptgpt != NULLtype != NULLtype->ops->alloc != NULLbios_geom->sectors != 0bios_geom->heads != 0disk->update_mode == 0disk != NULL!disk->update_modeThis libparted doesn't have write support for %s. Perhaps it was compiled read-only.part != NULLPartition %d is %s, but the file system is %s.disk->type->ops->get_max_supported_partition_count != NULLdisk->type != NULLdisk->type->ops->get_max_primary_partition_count != NULLThe flag '%s' is not available for %s disk labels.cylinder_alignmentUnknown disk flag, %d.part->num != -1part->disk != NULLdisk_type->ops->partition_align != NULLpart->disk->update_modedisk_type->ops->partition_enumerate != NULLdisk->update_modedisk->type->ops->partition_new != NULL%s disk labels do not support extended partitions.part->disk->type->ops->partition_new != NULLped_partition_is_active (part)ops->partition_set_flag != NULLops->partition_is_flag_available != NULLpart->disk->type->ops->partition_get_flag != NULLpart->disk->type->ops->partition_is_flag_available != NULLdisk_type->ops->partition_set_syU% stem != NULL%s disk labels do not support partition names.part->disk->type->ops->partition_set_name != NULLpart->disk->type->ops->partition_get_name != NULL!(walk->type & PED_PARTITION_LOGICAL)!walk->prev || walk->prev->next == walkwalk->type & PED_PARTITION_LOGICALwalk->prev->next == walkloc != NULLpart->geom.dev == geom->devext_part != NULLpart->disk == diskpart->geom.start >= 0part->geom.end < disk->dev->lengthpart->geom.start <= part->geom.end%s disk labels don't support logical or extended partitions.Too many primary partitions.Can't add a logical partition to %s, because there is no extended partition.Can't have more than one extended partition on %s.Can't have logical partitions outside of the extended partition.Can't have a logical partition outside of the extended partition on %s.Can't have overlapping partitions.Can't have a primary partition inside an extended partition.part->part_list == NULLped_geometry_test_equal (&part->geom, &old_geom)metadatafreeextendedlogicalprimarybootbios_grubrootswaphiddenraidlvmlbahp-servicepaloprepmsftresatvrecvdiaglegacy_bootUnknown partition flag, %d. %-10s %02d (%d->%d) ped_disk_printped_partition_printped_disk_minimize_extended_partitionped_disk_get_max_partition_geometryped_disk_maximize_partitionped_disk_set_partition_geomped_disk_delete_allped_disk_delete_all_logicalped_disk_delete_partitionped_disk_remove_partitionped_disk_add_partition_check_partition_check_extended_partition_partition_check_basic_sanity_disk_check_part_overlaps_partition_get_overlap_constraint_disk_raw_add_disk_raw_remove_disk_raw_insert_after_disk_raw_insert_beforeped_disk_get_partition_by_sectorped_disk_get_partition_disk_check_sanityped_disk_next_partitionped_disk_extended_partitionped_partition_get_nameped_partition_set_nameped_partition_set_systemped_partition_is_flag_availableped_partition_get_flagped_U?partition_set_flagped_partition_is_activeped_partition_destroyped_partition_new_ped_partition_alloc_disk_pop_update_mode_disk_alloc_metadata_disk_remove_metadataped_disk_enumerate_partitions_partition_enumerate_partition_alignped_disk_is_flag_availableped_disk_get_flagped_disk_set_flagped_disk_get_max_primary_partition_countped_disk_get_max_supported_partition_countped_disk_get_last_partition_numped_disk_get_primary_partition_countped_disk_checkped_partition_get_pathped_partition_is_busyped_disk_commit_to_devped_disk_commit_to_osped_disk_destroyped_disk_new_freshped_disk_clobberped_disk_duplicateped_disk_newped_disk_probeped_disk_type_getped_disk_type_unregisterped_disk_type_registergeom != NULLcs/geom.cdev != NULLgeom->dev != NULLCan't have the end before the start! (start sector=%jd length=%jd)Can't have a partition outside the disk!a != NULLb != NULLbuffer != NULLoffset >= 0count >= 0Attempt to write sectors %ld-%ld outside of partition on %s.checking for bad blocksdst != NULLsrc != NULLped_geometry_mapped_geometry_checkped_geometry_writeped_geometry_sync_fastped_geometry_syncped_geometry_readped_geometry_test_sector_insideped_geometry_test_equalped_geometry_test_insideped_geometry_test_overlapped_geometry_setped_geometry_destroyped_geometry_duplicateped_geometry_newped_geometry_initconstraint != NULLcs/constraint.cstart_range != NULLend_range != NULLmin_size > 0max_size > 0min != NULLmax != NULLped_geometry_test_inside (max, min)geom != NULLconstraint->start_range->dev == geom->devped_constraint_is_solution (constraint, result)okped_constraint_exactped_constraint_is_solutionped_constraint_solve_nearestped_constraint_doneped_constraint_duplicateped_constraint_new_from_maxped_constraint_new_from_minped_constraint_new_from_min_maxped_constraint_inita >= 0cs/natmath.cb >= 0U* align != NULLped_alignment_align_nearestped_alignment_align_downped_alignment_align_up_closest_inside_geometryped_alignment_initped_greatest_common_divisorfs_info->cluster_sectors % frag_sectors == 0 && frag_sectors <= fs_info->cluster_sectorsfat.c0fat16fat32fat_set_frag_sectors"X#hfshfs+hfsxJFS1jfslinux-swap(v0)linux-swap(v1)swsuspSWAP-SPACEUnrecognised old style linux swap signature '%10s'.SWAPSPACE2Unrecognised new style linux swap signature '%10s'.S1SUSPENDUnrecognised swsusp linux swap signature '%9s'.< h  linux-swap(old)linux-swap(new)linux-swapext2ext3<hext4nilfs2NTFSntfsgeom != NULLprobe.cdev != NULLParted can't use HFS file systems on disks with a sector size not equal to %d bytes.hfsc_can_use_geom (geom)hfsx_probehfs_probehfsplus_probehfs_and_wrapper_probehfsc_can_use_geomgeom != NULLreiserfs.cReIsErFsReIsEr2FsReIsEr3Fs(reiserfsreiserfs_probe +-sun-ufshp-ufsped_file_system_ufs_init0xfsaixdev != NULLaix.cSupport for reading AIX disk labels is is not implemented yet.Support for writing AIX disk labels is is not implemented yet.Support for adding partitions to AIX disk labels is not implemented yet.Support for duplicating partitions in AIX disk labels is not implemented yet.part != NULLSupport for setting system type of partitions in AIX disk labels is not implemented yet.Support for setting flags in AIX disk labels is not implemented yet.err == 0566 7@7|777 8l888999 :909T9:`:aix_partition_max_lengthaix_partition_max_start_sectoraix_partition_alignaix_partition_destroyaix_probelinux-swapbsddev != NULLbsd.cdev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0disk != NULLdisk->dev != NULLpart != NULLpart->disk_specific != NULLpart->disk != NULLUnable to satisfy alU) l constraints on the partition.Unable to allocate a bsd disklabel slot.err == 0<=CCCH(LMNpNO8PQRRHT0SXQ|QTTped_disk_bsd_initbsd_partition_max_lengthbsd_partition_max_start_sectorbsd_alloc_metadatabsd_partition_get_flagbsd_partition_set_flagbsd_partition_destroybsd_writebsd_allocbsd_probelinux-swapм؎|!8u u|tL|msdosdev != NULLdos.cpc98disk != NULLbios_geom != NULLchs != NULLraw_part != NULLpart != NULLpart->disk != NULLpart->disk_specific != NULLpart->disk->dev != NULLpart->disk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 00ext_part != NULLdisk->dev != NULLInvalid partition table on %s -- wrong signature %x.Invalid partition table - recursive partition on %s.geom != NULLgeom->dev != NULLped_disk_extended_partition (disk) != NULLlogical != NULLfatntfsfat16fat32hpfshfshfs+sun-ufsExtended partitions cannot be hidden on msdos disk labels.Parted can't resize partitions managed by Windows Dynamic Disk.Unable to satisfy all constraints on the partition.metadata_length > 0err == 0VdYZZ(~ZT[[($ИxԻ||ped_disk_msdos_initmsdos_partition_max_lengthmsdos_partition_max_start_sectormsdos_partition_enumeratemsdos_alloc_metadataadd_logical_part_metadataadd_metadata_partmsdos_partition_align_align_logical_log_meta_overlap_constraint_logical_constraintmsdos_partition_get_flagmsdos_partition_set_flagmsdos_partition_destroymsdos_writewrite_extended_partitionswrite_empty_tablewrite_ext_tablefill_ext_raw_part_geomfill_raw_partmsdos_readread_tableraw_part_parseraw_part_is_lbaraw_part_is_hiddenraw_part_is_extendedpartition_probe_bios_geometryprobe_partition_for_geomprobe_filesystem_for_geoU<mdisk_check_bios_geometrypartition_check_bios_geometrylinear_endlinear_startlegacy_endlegacy_startsector_to_chschs_to_sectormsdos_freemsdos_allocmsdos_probedvhb != NULLdvh.cold_dvh_disk_data != NULL%s has no extended partition (volume header partition).dvh_disk_data != NULLChecksum is wrong, indicating the partition table is corrupt.PED_BE32_TO_CPU (vh.vh_magic) == VHMAGIC(part->type & PED_PARTITION_LOGICAL) == 0(part->type & PED_PARTITION_LOGICAL) != 0part->disk_specific != NULLxfsOnly primary partitions can be root partitions.Only primary partitions can be swap partitions.Only logical partitions can be a boot file.failed to set dvh partition name to %s: Only logical partitions (boot files) have a name.part != NULLUnable to satisfy all constraints on the partition.0Too many primary partitionsdisk != NULLerr == 0Ľ\4\T Lx DXped_disk_dvh_initdvh_partition_max_lengthdvh_partition_max_start_sectordvh_alloc_metadatadvh_partition_enumeratedvh_partition_aligndvh_partition_destroydvh_write_generate_boot_file_generate_partitiondvh_readdvh_duplicateread_sector0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,U<[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-gptpth_raw != NULLgpt.cpth->Reserved2 != NULLpth != NULLuuid != NULLdev != NULLmbr != NULL%s contains GPT signatures, indicating that it has a GPT table. However, it does not have a valid fake msdos partition table, as it should. Perhaps it was corrupted -- possibly by a program that doesn't understand GPT partition tables. Or perhaps you deleted the GPT table, and are now using an msdos partition table. Is this a GPT partition table?The format of the GPT partition table is version %x, which is newer than what Parted can recognise. Please report this!last_usable > first_usablelast_usable <= disk->dev->lengthlast_usable_if_grown > first_usablelast_usable_if_grown <= disk->dev->lengthNot all of the space available to %s appears to be used, you can fix the GPT to use all of the space (an extra %llu blocks) or continue with the current setting? gpt_disk_data->entry_count > 0gpt_disk_data->entry_count <= 8192The backup GPT table is not at the end of the disk, as it should be. This might mean that another operating system believes the disk is smaller. Fix, by moving the backup to the end (and removing the old backup)?Both the primary and backup GPT tables are corrupt. Try making a fresh table, and using Parted's rescue feature to recover partitions.The backup GPT table is corrupt, but the primary appears OK, so that will be used.The primary GPT table is corrupt, but the backup appears OK, so that will be used.primary partition table array CRC mismatchgpt_part_data != NULLdisk != NULLdisk->dev != NULLdisk->disk_specific != NULLpart->disk_specific != NULLfatntfshfsswap0part != NULLUnable to satisfy all constraints on the partition.err == 0,|U) x 0""l(t.//H03'44%|004t4gpt_partition_max_lengthgpt_partition_max_start_sectorgpt_partition_aligngpt_partition_get_flaggpt_partition_set_flaggpt_partition_enumerategpt_alloc_metadatagpt_partition_set_systemyD<#*=(;Mt?(s*K>;Hah!IdontNeedEFI(2{\ M}-@Mjy֬oceRev0eC쬢3Dh&SFH0eCmWC 3KOO3Dh&gpt_partition_destroy3Dh&add_metadata_partgpt_write_partition_generate_part_entry(s*K>;Hah!IdontNeedEFI;Mt?yD<#*=((2{\ M}-@Mjy֬oceRev0eC_parse_headergpt_probe_pmbr_is_validpth_crc32swap_uuid_and_efi_guidpth_get_rawpth_freepth_new_from_rawloopGNU Parted Loopback 0dev != NULLloop.cdisk != NULLUnable to satisfy all constraints on the partition.err == 05647l779$;; <@<t<<\=<=0>===>p>loop_partition_max_lengthloop_partition_max_start_sectorloop_readloop_freeloop_alloclinux-swapmacInvalid signature %x for Mac disk labels.dev != NULLmac.cPartition map has no partition map entry!AppleApple_partition_map%s is too small for a Mac disk label!partition_map != NULLpartition_map->type == PED_PARTITION_NORMALApple_BootstrapApple_BootApple_driverApple_UNIX_SVR2rootswapLinux_LVMLinux_RAIDApple_VoidApple_FreeExtraApple_ScratchApple_ExtraPartition %d has an invalid signature %x.Partition %d has an invalid length of 0 bytes!The data region doesn't start at the start of the partition.The partition's boot region doesn't occupy the entire partition.The partition's data region doesn't occupy the entire partition.Weird block size on device descriptor: %d bytes is not divisible by 512.The driver descriptor says the physical block size is %d bytes, but Linux says it is %d bytes.U* i <= disk->dev->sector_size / 512No valid partition map found.disk != NULLConflicting partition map entry sizes! Entry 1 says it is %d, but entry %d says it is %d!Weird! There are 2 partitions map entries!part->num > 0num > 0disk->disk_specific != NULLdisk->dev != NULL!disk->update_modeuntitledpart != NULLhfshfs+Apple_HFShfsxApple_HFSXpart->disk_specific != NULLChanging the name of a root or swap partition will prevent Linux from recognising it as such.Unable to satisfy all constraints on the partition.part->disk != NULLCan't add another partition -- the partition map is too small!disk->update_modeerr == 0ADEF`~,ЃD Tȓ`0@Ԕped_disk_mac_initmac_partition_max_lengthmac_partition_max_start_sectormac_alloc_metadataadd_metadata_part_disk_count_partitionsmac_partition_enumeratemac_partition_alignmac_partition_get_namemac_partition_set_namemac_partition_get_flagmac_partition_set_flagmac_partition_destroymac_write_generate_empty_part_generate_raw_freespace_part_generate_raw_partmac_read_disk_analyse_ghost_sizemac_duplicatemac_allocmac_probeIPL1pc98IPL1dev != NULLpc98.cdisk != NULLc != NULLh != NULLs != NULLraw_part != NULLdisk->dev != NULLInvalid partition table on %s.pc98_data != NULLPartition %d isn't aligned to cylinder boundaries. This is still unsupported.part != NULLpart->disk_specific != NULLname != NULLstrlen (name) <= 16fat16fat32ntfsufsUnable to satisfy all constraints on the partition.part->disk != NULLped_partition_is_active (part)Can't add another partition.err == 0dxܣ 0<dD84DLPX̷̲@ped_disk_pc98_initpc98_partition_max_lengthpc98_partition_max_start_sectorpc98_alloc_metadatapc98_partition_enumeratepc98_partition_aU?lignpc98_partition_get_namepc98_partition_set_namepc98_partition_get_flagpc98_partition_set_flagpc98_partition_destroypc98_writefill_raw_partpc98_readread_tablelegacy_endlegacy_startsector_to_chschs_to_sectorpc98_freepc98_allocpc98_probebuflen <= disk->dev->sector_sizept-tools.cb != NULLdev->sector_size <= sizeof zeropartition length of %jd sectors exceeds the %s-partition-table-imposed maximum of %jdstarting sector number, %jd exceeds the %s-partition-table-imposed maximum of %jdsunloopgptmsdosdasdamigadvhmacbsdpc98 $$$$($$$$0$$$$4$$$$<$$$$D$$$$L$$$$P$$$$T$$$$X........................................................ ....................................... .. .... .........................................................................................................................................ptt_clear_sectorsptt_read_sectorsptt_write_sectorlinux-swapRDSKU% BADBPARTFSHDLSEGBOOT%s : Bad checksum on block %llu of type %s.amigadev != NULLrdb.csizeof(*rdb) <= disk->dev->sector_sizedisk != NULLdisk->dev != NULLdisk->disk_specific != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0%s : Didn't find rdb block, should never happen.%s : Loop detected at block %d.%s : The %s list seems bad at block %s.%s : Failed to list bad blocks.%s : Failed to list partition blocks.%s : Failed to list file system blocks.%s : Failed to list boot blocks.part->disk_specific != NULLpart->geom.start % cylblocks == 0(part->geom.end + 1) % cylblocks == 0Failed to write partition block at %d.dhxpart != NULLpart->disk != NULLext2ext3fat16fat32hfsjfsntfsreiserfssun-ufshp-ufsxfsUnable to satisfy all constraints on the partition.Unable to allocate a partition number.err == 0LddtlX|HPptped_disk_amiga_initamiga_partition_max_lengthamiga_partition_max_start_sectoramiga_alloc_metadataamiga_partition_enumerateamiga_partition_alignamiga_partition_get_nameamiga_partition_set_nameamiga_partition_get_flagamiga_partition_set_flagamiga_partition_set_systemamiga_partition_destroyamiga_partition_duplicateamiga_partition_newamiga_writeamiga_write_amiga_find_free_blocks_amiga_find_free_blocksamiga_readamiga_readamiga_freeamiga_duplicateamiga_allocamiga_probe_amiga_read_blocklinux-swapsundev != NULLsun.cCorrupted Sun disk label detected.cyl_size != 0bios_geom->cylinders == (PedSector) (dev->length / cyl_size)GNU Parted Custom cyl %d alt %d hd %d sec %dThe disk CHS geometry (%d,%d,%d) reported by the operating system does not match the geometry stored on the disk label (%d,%d,%d).The disk label describes a disk bigger than %s.disk != NULLdisk->dev != NULLdisk->disk_specific != NULLThe disk hasU0 %d cylinders, which is greater than the maximum of 65536.part != NULLufspart->disk_specific != NULLped_partition_is_flag_available (part, flag)Unable to satisfy all constraints on the partition.The Whole Disk partition is the only available one left. Generally, it is not a good idea to overwrite this partition with a real one. Solaris may not be able to boot without it, and SILO (the sparc boot loader) appreciates it as well.Sun disk label is full.err == 0l ( $%|&&0(|*d+.p/H20++,22ped_disk_sun_initsun_partition_max_lengthsun_partition_max_start_sectorsun_alloc_metadatasun_partition_alignsun_partition_get_flagsun_partition_set_flagsun_partition_destroysun_writesun_readsun_allocsun_probeinvalid argument %s for %sambiguous argument %s for %sValid arguments are: - `%s', `%s'write error%s: %s%sPOSIXLY_CORRECT--%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument A NULL argv[0] was passed through an exec system call. /.libs/lt-literalshellshell-alwayscc-maybeescapelocaleclocale $"`'%s (%s) %s %s %s (C) License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Written by %s. Written by %s and %s. Written by %s, %s, and %s. Written by %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, %U3s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. Report bugs to: %s bug-parted@gnu.org%s home page: <%s> GNU partedhttp://www.gnu.org/software/parted/General help using GNU software: %smemory exhausted/proc/devicesBlock devices:virtblkdev != NULLarch/linux.c!dev->external_modeCould not stat device %s - %s.%u.%u.%udev->open_countCould not determine sector size for %s: %s. Using the default sector size (%lld).dev->open_count > 0dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0PARTED_TEST_DEVICE_LENGTHUnable to determine the size of %s (%s).S_ISBLK (dev_stat.st_mode)Could not get identity of device %s - %sGeneric IDE0Device %s has multiple (%d) logical sectors per physical sector. GNU Parted supports this EXPERIMENTALLY for some special disk label/file system combinations, e.g. GPT and ext2/3. Please consult the web site for up-to-date information./sys/block/%s/device/%srvendormodelError initialising SCSI device %s - %s%.8s %.16sGeneric SCSIPARTED_SECTOR_SIZEThe device %s is so small that it cannot possibly store a file system or partition table. Perhaps you selected the wrong device?Unable to determine geometry of file/device %s. You should not use Parted unless you REALLY know what you're doing!typename%s %s%sGeneric SD/MMC Storage Cardpath != NULLDAC960 RAID controllerPromise SX8 SATA DeviceATA over Ethernet DeviceIBM iSeries Virtual DASDCompaq Smart ArrayATARAID ControllerI2O ControllerUser-Mode Linux UBDLinux device-mapper (%s)Xen Virtual Block DeviceUnknownVirtio Block DeviceLinux Software RAID Arrayped_device_new() Unsupported device typeError fsyncing/closing %s: %sError opening %s: %sUnable to open %s read-write (%s). %s has been opened read-only.buffer != NUU& LL%s during read on %s%s during seek for read on %send of file while reading %s%s during write on %sCan't write to %s, because it is opened read-only.%s during seek for write on %s/proc/partitions/dev/%d %d %d %255s/sys/block/dev/hda/dev/hdb/dev/hdc/dev/hdd/dev/hde/dev/hdf/dev/hdg/dev/hdh/dev/sda/dev/sdb/dev/sdc/dev/sdd/dev/sde/dev/sdf/disc%.*s/part%dp%s%s%d/proc/mounts/proc/swaps/etc/mtabdisk != NULLlooppart != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0Error informing the kernel about modifications to partition %s -- %s. This means Linux won't know about any changes you made to %s until you reboot -- so you shouldn't mount it or use it in any way before rebooting./sys/block/%s/range%ddisk->dev != NULLUnable to determine the size and length of %s.Failed to add partition %d (%s)%d, Partition(s) %s on %s have been written, but we have been unable to inform the kernel of the change, probably because it/they are in use. As a result, the old partition(s) will remain in use. You should reboot now before making further changes._have_blkpg ()x`linux_disk_commit_disk_sync_part_table_blkpg_add_partitionlinux_partition_is_busy_has_partitions...dm-ramlinux_sync_fastlinux_sync_do_fsynclinux_checklinux_write_write_lastoddsectorlinux_read_read_lastoddsector_device_seeklinux_newinit_genericinit_ide_device_probe_geometry_device_get_length_device_set_sector_size_device_statgeom != NULLaffs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu Pralloc = %d, Reserved = %d, blocksize = %d, root block at %llu %s : Couldn't read root block %llu $TDt4daffs0affs1affs2affs3affs4affs5affs6affs7amufsamufs0amufs1amufs2amufs3amufs4amufs5_genUeric_affs_probe_generic_affs_probeRDSKBADBPARTFSHDLSEGBOOT%s : Failed to allocate id list element %s : Couldn't read block %llu %s : Bad checksum on block %llu of type %s %s : Couldn't write block %d geom!= NULLamiga.cgeom->dev!= NULL%s : Failed to allocate disk_specific rdb block %s : Didn't find rdb block, should never happen %s : Failed to read partition block %llu amiga_find_partamiga_find_part_amiga_read_block_amiga_add_idgeom != NULLapfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu %s : Couldn't read root block %llu apfs1apfs2_generic_apfs_probe_generic_apfs_probegeom != NULLasfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read root block %llu asfs_asfs_probe_asfs_probebs != NULLbootsector.cgeom != NULLFile system has an invalid signature for a FAT file system.File system has an invalid sector size for a FAT file system.File system has an invalid cluster size for a FAT file system.File system has an invalid number of reserved sectors for a FAT file system.File system has an invalid number of FATs.This file system has a logical sector size of %d. GNU Parted is known not to work properly with sector sizes other than 512 bytes.The file system's CHS geometry is (%d, %d, %d), which is invalid. The partition table's CHS geometry is (%d, %d, %d). If you select Ignore, the file system's CHS geometry will be left unchanged. If you select Fix, the file system's CHS geometry will be set to match the partition table's CHS geometry.FAT boot sector says logical sector size is 0. This is weird. FAT boot sector says there are no FAT tables. This is weird. FAT boot sector says clusters are 0 sectors. This is weird. File system is FAT12, which is unsupported.Xt~"tThis partition does not haU ve an operating system loader installed on it. Press a key to reboot...MSWIN4.1NO NAME FAT32 FAT16 is != NULLThe information sector has the wrong signature (%x). Select cancel for now, and send in a bug report. If you're desperate, it's probably safe to ignore.fat_info_sector_writefat_info_sector_readfat_boot_sector_writefat_boot_sector_generatefat_boot_sector_set_boot_codefat_boot_sector_analysefat_boot_sector_readUnknown error (%d)Unknown error %dCopyright %s %d Free Software Foundation, Inc.0 <= strtol_base && strtol_base <= 36xstrtol.cxstrtoll/dev/urandom/dev/random/var/lib/libuuid/clock.txtr+clock: %04x tv: %lu %lu adj: %d clock: %04x tv: %016lu %08lu adj: %08d /dev/null/var/lib/libuuid/request/var/lib/libuuiduuidd-qT300/usr/sbin/uuiddRU \X@XQ $ (g(L  |T(444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444̒hijj,j@jhjjjPklkkk\~l~~Pdh$X6Hx|Чl$PDTH\̓Lplt,X4\<`d|    ̪Ȫ (8 0P$XhT\P@X4lD3?<`,ط<`,ܼXLH048<ȖHLP4TXX|\`ėdhUlp0tHx`|x\ A/aeabi%ARM926EJ-S ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.U 4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v1U00(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.U 9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.comment (($ LL@! ) TT(2 ||;$$644AȚ`G(g(M8g84Upl l `lx}ȒȒ DPp0U ԳU%SlsZjSjSjSbusyboxV3SiplinkYjSjSjSbusyboxW&SscriptreplayZjSjSjSbusyboxX&Sbusybox[jS[jS[jSY3ELF(4H4 (pLLL88aQtd -L @ -p x p1- RCA 0\R! B 0R BR  BR  BR BR B  b  0RR! B  0c 0S,0S(   - @ $4s$p pP$4 p1%0p p p1,qp p1, ( <p p p1,@-'pp '@ p1, pp p1z, ( <p p p1n,@-'pp c'@ p1`, op p1V, ( <p p p1J,@-h'pp ?'@ p1<, lop p12, ( <p p p1&,@-D'pp '@ p1, Q:@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1Y<P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R G-@M ~D`q%Vp`444   @' VPf 0Nb@ 3`T0P:  B 01b 3tpX.EpX7@3p<#P 0b.20P PX p WX ` VX V@9V l2x0S 40FSpP`  9V 1\bV0 0 B"0FS!p!` A@{h!k'[:E{7K[{'{:0㙙 0/ 0FS- Vp pP !   0}a0.0 !Rp 0 S V0 0 ` Vca.H0@DQލ .A          , 2 8 B T K @B?X  { @-@0 -Gk [0EkE{EkE{NST1MK 0+D;˓0G۟@,[K< [  ۸ [K4[Ek[Ek6 E{[{7 QK KE% +"E;30S@Ak0K{3@k k[kI:N{ Nk0{[0S E[7kY?{ & { G  iUMu>p? 0k{@-@k- S C0@R {H{7{{@{H{7{{{{{{{0QR {H{7 { {h{H7 k@-f{:G 0{{ k*"̠Ȟ,$Č$ #,,<,$40AkM:s0:{G 0 {{ k*R$#4r s0Ѝ/@p0 {$M#4s0:4@ p Fk{ 0Ѝ/@M 0,0 { $*#,@ ,<!$4:Fk{ 0Ѝ/A3 O--8 Mp80DP UP20 M, @M `%&0+ {k Kk6A{;[GkGkN{ G D{2KIk:k{6;kk{ RSP@  2@0  jX0# k-*Z 0\:k0EE(  \# 1 {-*Z0C HS|{Rk0A@C AJ@0@Sd[[ J[ K@[[5[ 0RTL  d1vT20S {{ZG{  [RkFk5{S {G0SJf{ M @ J@D †0L PLY:T0S  Q S  R:T8K {Gz?iUMu>@DhGk50{P∁k0{PP[[50{[ @- ᩛj{j[k (0{0 7 Ѝ ư>OuA 0@--dMT@@j{j[3k{8{kjkF{7-k{'{zpT0`@0 PY* 0 R+Spl0@,PH PU{H{7{{H{7{{H7dЍ0ư>.AH1U1m120@-- PM@{Ǜȫ{ǫk!H0S S0H0 Fk9{kZH d200+L00I0 0H A0<彑 I1I0SD0S0L00I0{uk '{G{8{{F{@kkF{k EH P 1@@ H IŒRH I0A 0R A0lH { {0@0[ k0k5D[<0k KkDK7{{ 7={ǫG 6{ 7{104k000{&{z@0@  0 00I00C 0ИP  <R0 40B(SP  %\Ѝ0 `@p?iUMu>{Gz?.AH1011@--tM@,D @0 p 300p CeSRdS oS cS SPXDP0P H1D RL1H R, 0S -0S S㽐P   00H4 E80 0L0RT0@N2P0{S { 0010CB>A>A0BGk0 H[9C"I0 0[5k{H{7k%I{7kk {{ kM"R bG{k{G{|k C"{7{ R C { { R   4Q C#{0{0 {0{0{0{0I pP P1``;{Gk{{P2 k[k%{ ZL00$SL0&I0L` S0I0ŕ L I0#"$rL  S0L0I0S0CI0,0 QIk {G{6{0SP00tЍp??111H)2 O--M@p `<3Y0^H@@ H0 ` @0{s ; Qd $ R ⒗T ፗ00 0e .A/<LDz}T < eX 0@--PMU@T' @ P"  ( A{ P= @ {{(k  0I0 0(P Ѝ0 .ApO--@M!P !!3Ђ `0 TY 0x&Z{ A{Pu A{ Q 0=Y+S$Ѝp.A @-@00S 0" {0{  0A--MS TP@.P" H`@!0`0 p0 A0S 00S 10`Fp0\{ f{p T{ f{80PS! 0 {NjZ{z{G8{{({zP0P@@s0S Ѝ AeA 7@-1 @0S0{S{ 00S P 0    00S 0<00<0 Ѝ0O-@P-PDMiP T9`0pF 0@90$00P0 < 08 0 ( 00 (( 0 *40C'Sep`ܰܰxx@,$x8xT,TlP̳8 d4P4<0< SPI 060<0 P060<0H P8 50(1 Y& 0  p 0;0  0000 0   0  0Z Y:/00 0R @" @ 6080 0S (D 2 0S|X  \PLR00<6wX, e 080 Z3<0S80%8 8$< 0 h0 0  0 0 h  <0S  <0S0$ 8<y80 8<0 ,' R8    R "( 0S n0 <0 0(v  (q  0L00F0x00t0  {k 000T S0 ##00 0S0Ps 0K ( -(F 0r {P G c8<@_ 0 0<0 < 00  0Yʤ!X8[(( B0(P> 00< S  0  0P Q 0 R  (< ?0 0 0* "01 00R*<0S8᐀(吐L0 0LP됀<0S 0D  80S Z a00 80S8808080S $0H0: 0   0S80(0( P<0SL P 됊0  X񟗛ȶԶ D̷0| {{R  k"{{ۄ|~}ᇅ k{G{r  Q An<%P {k  A|d^Wd˘H QĘ K<0S8] 00 f{A 0Y3P 0S (@ {5{3<0S3 0Q 0S DZ 8#!0D < P 0S b(F D  (Y $0H0: 0 8吚{ { <<j( PX -X MX !X !mX pX { 0{ 0{G 0 {G 0 {PkF{ {@  8 ({ZU z8P ET0U \0PE 5%0(00 = 8 Z 4 0  " 88* 0 P;   0| P    (%H@ X.л {{7 {@{7 {{'@  {{+S ~@ %  {kkk@{ { Z 8P 8  0 , P ( ' P : @7@8  6 (3 l0S  Z {( {0S S S {{00 {{00 {@{00(0(0 {S G {S G   Z@ Z*t0ST-DЍG-08M`%@,0(0@4$0<4 044pPp9l0c Yh<@DH<$x  00S mL  $0p *R 0$0+ $0XP3P ( << 83800< (3(00< 3003ZP=P 0020\W  =00PpW"2 (000004 ,0yQ2P <240 ,] P+ Y3,0S(0q`eS! (@]1P04u@/0NPP00Q(0S` V\1p!04  p0,1j P@@ DD! PD !Rx*l0S`P* H0S H0P@E0Lx0  0Pt0 L  x0S 88 P x00  88P 6? DT$.[ k A k'kf[ k{{ / =  --- 0T Ԁ2 0@ R  / @@-0S00@S3/0q 0Cs0SSQ 000 c! @-@}$0 0@P @耚@-E! @ 000 Pd xO-_MuPP3 HCP A: S(1S@8PP 3 p p` P 7P22@ PP2 `#0`S [S]nPt 0Sqs0Sl $Pp W`=ZPb  a0S\ Pj0 0`@ 0: 0ᤑ@ x0S@1F x1 cl1d@T00 0  P@1 .#P-  E10S  P@0 00 20S P@0 00@aW^0000@008 0OP@T_ߍȘ6\̘8[ !_z0<@-6 P@Y & @P  L帹0P0S@PTP0SD @(00$;H\)*, \qbMH-`pPP1S2 BU "2峠 :#:@1@ <P7P 10Sb Վ10S1@@0S @TCt1 0 S* P  P 0  0 P0  R  Pꪡ) 40$S P 0 0  P 0 R 0x*ZzP pZ040&P013/? 뤕 |Ș̘ E-P@$PWT P`PV1P00! P' 0A0C00`0fUUPP`F@0SXoP=| PpP `cPT00P0S818!pP,A@W1!00#2!00:#:` 4/P 0S LP"E1U,P@0S 0|Pgo`m , \ 0 RM   L 8@-PjgPX0H D@0-Q00 k19 7@-/@P@0" 0 /R00S/0 Cr R 0a0Cs0S00 R  /@-@0-S00Cq Q 0a0Cs0S $00i  07@-P00Cq Q 0a0Cs0S $0@0@Q Y %  0>@-@0-S00Cq Q 0a0Cs0S 00  0@-@00Cq Q 0a0Cs0S 00  0p@-PLPP@/;@0/S 0\  0p@5k-@- p@-/@P P0S @@-/@P 000P0 P/R00S@8@-@PP 0S @0S @8-@-00,00P  0@Ѝ/mC-@-00$00P  @-mC0 Cr SR/0 SS/ 0Cs0S/O-P!M`0 R` !P ` 0PWh1Upp <1 @ P 0 @ $ \0 5 0: U 0p 00G Q  @ 0@ @ t0 @T00   000 0$  AЍ謕mC@-0P |d l|di|d 8@-@ PP;8@-80P (0($0QҌ0 RE-RP@ h`pṃ000V0S Z Pe0 p⨃ W`ʚ;?R00S-0`0 B@- @00И@- @00И@-0@ `@D0P&r`P p PpCPCT0 @-@&PP ^ `Pp'PUV `00@000?0<<03 _s@-0P@Y 0 00ˋU` 0SrP ; -5 Br R00́00T 0S@^P ' -5 Br RP00́00|@F8@-P@ P @68  '@-@#+@@-@+@@-@tPQ8@-@mPP680-@-d@P 00(00 R@Ѝ/0-@-PP 00(00 > @Ѝ/@-@Pj@-0000Pz@-P@-ZP$@-P3@-@P8@-P@P 8@-@P@-@؈P@-ΎP@-.P@- DP\ -@-  PP@Ѝ/ 40H0S 0 S*p0/U@-@p 0QP=@@-@<P!0P @-`@p@D 0SRT 0VT܀@-wPI@-@RPp@-@P( p@@-@᥈P.P@-@@O@-nP!p@-`Pߋ@P  p38@-P@ҋP8 3@-@bPK8@-@SPP 8!@-@FP!@-@ᦿP@-0P sP @-@&0p03T0S@t @-@0p03T0Sh p@-0P  P 0CS@c   p@WY * @-=@P@.d@)@e8@-P@ G88@-Pa0p03U0@SP 8 p@-P`@PP@  p@:P00p8@-P@P ,00P   8bp@-`k@#PP000SS `V @0/S pZ@@ pO-PMM@P+0`JPp P0  aP |Y  A PXX ?`px@TP0 `pЍڍ 00@-@P00@8@-@PQP8 0QP r-@- @Ѝ/@-p`P@  XPT@@`P`U@-p00`P@ +P0S @-p`P@  PT@ `@P`UE-lMpQ 0 ``@#Ph0(V1P p,P@ :V``(X#u0W0@lЍ8@-P㓎@P8P\8@-@P(8@-@PK8p@-@PsPp p@@-@RP7@-P`@P*.PP% P P tP 0S0SBS0ZS, ($H>tDȺhp@-`@PPpP@Pp@- X0@-@p`P P0 S 0  @05Y ?G-PQ`p pV㜠pW@Pp`  P T S0 S X@:0V00e0eGT0A-p`@P وP0T@DS S @@-p00`P@ P0S S@- W ?# ? Ѝ@- ?  Ѝ@B@-@ṭpx O-0$M@:P0P4 ` 0P# h 0@PpH 0@P( 0@P{0v>C 0C000C00:S0e k.0eP 0PP00 0P P 0000 `0P9HP 000000 $ 0P P 0000000 0 0P( P% 0000000 0 0P0v>C 0C000C0.Q 0X zP000S 8$ЍMx @-@Pٷ00ܘSE- P`@p0"0 P P" 0@ R   Pp WpG0#SS 0Cs0SS$0U005/PtO-pGM FpP`P@@1SP jm1P1@ P4B <`P g@GߍEt@-P@ pP`UP!}G-(0p@h`0oPPX00 L 0P_P0S@Y* Y<EtG-(0p@h`0JPPX00 L 0P:P0S@Y \dG-(0p@p`0%PP`00 T 0PPEP@Y޶ PG-(0p@p`0PP`00 T 0PPP@Y᷶ EtG-(0p@p`0PP`00 T 0PPP@Yᐶ \dA-P`@41X0p @:@PA 00 0S5 :R2 R  ,  ,Q Q# ,Q! AqQQ Q00QR 0 P B1 @T@@-`@P0Up@:0P  K0SUP :P@00Po@-`@P0p0S U@ :0P  !0S :R@00Ph0@- J@݇) 0P/-ܘ 0P/'@- @0SX0@-@ 0 0H/< Ѝ@-@ 0 0,/< Ѝ@-@ 0 0V/T`\00>\0j0 d0T`0T0j00X  k \01\00 @7 0' TP@Tk`k@ 0T0|*0Ph @ 000Cs0 SP\0:00\0P:TTPk`p~0  00 S S0  jP `k PpU  +3 g$lL\L P\3000CSFHPU(QS  0 0Q 00c`v`P U U& U %U U U 2P6%0U0 $t2Tt @D!p@D 42TY U20c S:G PA0S T@/x0 xA P`ps}T Ugp;,T0`0T > 0`0X00XefX0Vip0h0l V V \0<\0\0<\0T000T0\000 0\00T \01\0000 000  e[DTx3j "- 6ZHOS@-<"z}vG-0nM@1n<|GKp3 ~b.m?>P Xa N[t60Q a F[P P P [`P`F `P00pD0S0S (0S 00Cs0S -]X! P,_@P-Wd5pn/Lu   ,, 0ᘃXE P,Z!4p   ~1S7 @J40H R  R4 5:ᬾp P@Tp 0@s0SS,4nO4d@ P  XP@0 S00a @P '00!S*S& 50SNL3P 01 kP#P3%NP N1S 00S 6PpX4倰Wa/ 0ᆣ0P1z{0S' pPP! T >P;H0S 0 S@405: p@U DMF3m1n/0a łX9ⲫ{pm埃Y A v|c|X% sP 01xh XPia0, ( $  54`V 0S`%Q 0Y㸃PP|0S  0YYnߍT TLb `" Kakv @-@P @4 O-WMV_@0%3  3尢 <3`TPkP`|p P1SK3QUP3W@ 0Sh  \#0P1C 0>0 <`P PZ P00 200S "2X0!0Cs0gpWpS00S]ϰW 00S  3P  ~UP d 72T&p2 82P)  0LP W2pP fP @QO S  SQ @U@p@ <:8Th 1  S3 D S,n@0@@!0 AV"a܂[?Xt0 =^0P 6^t0S ?T 0| x WߍTY ,  '6Pcr`jG-PM0PP@0%L0{ L0p;1`0Q1S -R0S`P@@X、PP P`YL1P @cq20@S 0S10W 4P 0+ BL0S - 0Y7M vLL0WS WP |0L0L0pS0L0J2L  0WLH 0WTZ# (4G 2 @-OM@NoP  1@&1!  ;1`1S {ydysy0P ,P (PD1 T LG"@PF 0C01>0 <P;01S8 004 1PP 0S>Oߍ S`pW h1D t>pPdPT0 R 0V8묕DMUT^h1 {0 R  zH0@-M@z_1|!Px1t@ :hmZ \ZX Z }Z {Z<t 1\x0 00 08 08z   <<000<0H0<?0H00 0Q 哮C3P0Tx z -8D^r0 (HnC3T@-@Pp``PPPG- M`P`\1@T1 P0L10H100000 00$```91pa 1 1PS00&埬PUSp0 Yp  0lh0P` XH ЍgpD{T|d  F@-M, @$V 3(00P>@PU 0@ TPPA`@P A48#0@Y F( RP0 P  6P 6"'$"" PD 0(4 0$ @k`P0H@$80  uwt@  0 P@ P1g)xP Pl1tB7PP T1\<7pP 0-S0-S, P ሺPpሪ0  p\P R 0 -R0-S x07PPЍP\jpq|gav  )0 p@- M P`0%&|0@t0t t0p00l0  0  00 000i8<0 Ѝpg.<pDTp@-P`x0?8@P 0+S\000S zvU f @.@pp@D  Q O-M`p P `'t3@l3l#l0h30`3 0 0 00`8<3@paLv0S f 0@P9 <R/ - >@KPPzFP FG|2P`  `XP0 R,QSQ !1@-M 0000 040P0 Y0900 X0 00 X00 00 X0D90r@P[EP7$0p0(0 `0,00 07,  W 0哵0p厵P`|00STlh*D000<0L4 0@0 @080 ЍD sP 1l wO-Pp`*3nT*1Pp`!PlP@ dP fP p nP rP   &0XQk0X`|0Xph0XP/ Y P0 U Z / sPU RUtL4"0 /Xs@-`P@%\P  P cP00 NP sP  -P0S E00C0^P  @@p0000Pe|5 O- ,M@`ȿ p`$`RT 3P5 `0AA@P>*PP@,PXZ@XV`1$\?6X$`   P$ ? V `1XX? X  X W Zp ApX)@@X 0 -S000TP ^ P!1 Y VP0P1Aꈣ  &PW   0S   P0U$i P g$ 30U JHP# 2  Z 2 0UJ6P 20S  0sP0ں! D2 0S 020S @0Ss 0St 0-S p@S 1 1XaPU[ 0@SPSP Cp0001 U\R dRpR KR پ PJZP0E Y  0sP0ں!pZ0  X 0Sl \00S@Q<0,Ѝ 0R ꤕ\8\T,?mCX`p@-Pxt@tPT 0R$0p@p@ bE-!P1 1ppp {/D1@ 1!P0 S! aV@Y S` NtPg(0 20⫥tP  0垥P`c0 W sV "tP8s kP tDT A-`P#9P00 0S0000pW0S00  P@T-7@-0@P00P U" @ P A!PU 6 00  p<0< 40SX>@Ѝ/HO-MmPXPP10@ D R0Smr00 0 0  0S  0Lm   000S Nt R 0 @` 0<0'p RЍIH%G^kO-0VkM&00 %0 0P.@AR@ 0S5H L5 <ps@p? @`s7gas`dP<7pP s ၷ   P40@ :. <R<f0V<faOSJi⼔ pCL40@ H0S`5 640@  00c0S' 00+0S" 00C0S000S 000S 30@  0Sڈ 000 0`VpW1<011 S `L 0S0@ 0CD0S>0000S ~"2*-:tP p 0p' 0ps  x2 000>02m0L 0S0 000@T`V p_0S0@0TUPOY fsP0PC0S009 `0x1l!ѡ0S, sr[$ zsP81S4\  0> SR 0!* R  R 0 0S P00@T0pWX< ïyD H 5?IVk|@-,@PP" PP ts #- rkЍe@-P P0L0HE#0kP0h \ X@PLPD@@ 0,eI 27>E]2A-Mt"p|0l2l x |0,\2`9P  @h xe#lH#`@0FVQ0-S0S rPP!HP|V V VB(0pp00t0NQ|Po lB-`P QkrpP 00 0UA-prPz@ |V q  哠@rP 0Se`A-rPPЍ<|0 myHDNT Wnt{ma@-(0 RB! 8@-(0 R KU @8@--@ȋ :* "*@ @@- :0:@ @@--@ȋ :* *@ @@--@ȋ :* *@ @@--@{ {cg @@--@ @@--@ (@@--@H 0@Y @--}@{ 8@s@-P A0S 0S zmP6/@@`V +| 0 p@- 0S @0`S 0@0480+PP@0@Sp 8@-,{44@Z0S08 0080p@-0 S+Sp@L{SZ S` Xp@@0A0@S10}@ p@x8@-$P@Q @DTPE80 ! @--@+S QdV A@O-P$MjpP) 1 `_PPE @ 00As0 S0S O@A &1d@ P  @Z  0H`GQ0 00R   php0`0ST T ' T @T " 0  0 D堞T T  T @T xx涀$$Ѝ +!p!l10@-@tM` !*X1P0AL1T@j 3 h wjPh /5R@ S0000000 0l00H0 0}>$0}>C @## 00h00h0h0S_Hj &@jP  ,0@tЍ05DBTFQ mCp@-0a@P$ABAń@@|@$P@!`P`@PU@Z0SZp1O-M0 `pG@PH XJ JR"%Q"$ r `,j P Z$ ,Iጠ L\ ZpGPE +J `@Y    000[ dH/aUd0ppadp0PE@dH UЍO-B4MP3@3 ,00(0$0(00$00,0))(P |9P BN``W PX^P`<#<3d9P93@ 0S,RFP$ 22 <0S $0 (P0  0fp A$0S Z p X 0-S0SP2@ P @,b,fQ ᜩP10 #GP0P`0 0P0S  \1`$0Y!(0[! 0ᐪP0 5!0 SS >~ S R0:P U:2$P% L0P0P $n yP ?000Cs0dP SaA(@PZ \ 4Ѝh r ,:p@-0 Pd@ 0%Uc0 xp@8#2G-@M (2P0a`Dn0: S 2N/D1@|181S @pP: 6!9,p606 0h1P D2@ 0SPpUPU@ L1SPp @SPp SPPpp0h10 Y0S""$!l!圡 F0x11E p10h.t1hP4Lx+0 0_S@ $ N^^^/1| 0Yx!  X!V/0`\Qm0H eZxśx!D10x1x1@!S:Y N^0 ݍ'}DbTe{M  MȀ M@M@M &20@-`,MS 100lS@P P 0SbLP 3L@{0 `0 00$00lS p gU t^@^T T P@ <0$@400 ,Ѝ{M NmM@M@C-@0`P؂0S d!4#   0Vb 0V@ <V8 0 ("ЍpCxЍpH00S/ [HO- M@- *"2 &2`Q lh pgPT%P4 x@` 0a1@`@00` `fP 000F0@  ? SR`@ 0@&@J 0%  R 0!08 /0QP(%@ ,5 +; 0)5G  WV0  0P 0 0 0Z  A  P \ 0`JVЍDTM  M@9h$0@-@PJL  !PA-@000PU|p` PPT0ӗ `p V -,000SLt~@-@&0   <SA-P`@0Sh@`p@pg`FV 0 S@pg`F.V P A&E-pP@` T ϙ0S00 ( ÙpWP@Y P/嶙0P P@-@ 姙@0@-@ ᜙T@P PP務H-@4MP /P밐 |PP4YsPP  YY (Pcl0dd`>W0'SS s,S 7( S $帗0'sSS0 字P-06 0-1-0,-0'- 0" !Y 0As0!S` =UP`V l d *? Br R"D Uzpwp    U*ZJ P{ P X !pJzwpZ ZUPUP1VuP UV :) R9#9SOʸ:) R/IV UV1SC ;9 S? :) R9#9S7V UV:) R9#9S,*70S'ʴ69 S# 6 ;S?0S V UV:9 SP V UV 6  6PPPPV  U u% "9 S0 k0/AqQ Pai` ZPU `S  @ P?XUEx` 崖YU    p`p   0`Vp0S0`0 S h)@S   @9P)7wx9W`V v4f`0 &VVH XQ0S $ V 7Uh 8&b bQaR bQ`З͗:1; S 㼼8  Y "t 0 ᵗ 0V`1%5<*᪗0(0^`p 0ភWV /0^ 0咗 南P Q 6  傗6  }6  xU &6x t l' l`ٕQ QL'QD'D78'p68[X2/CqQ :Fzz'zgj+SKXQ CU`` 8QR R 5p&Q6|| x6#V 6) RTT6T ]@U^0S({C^  qnV5 : < Sq U#+R "r 0S 6  J8S9S hҖQ X͖Q HȖ <Ė6 /QQ 7S7S!ᲖP s /0`P m /0`v`6 P u /0`v`V/0Sl厖  6SD6 8S8S xQ sQ n j6 pW q`p \` V pYX6fp ` `v`pI0#V 屔6 8S8S 6Q 1Q , s:9 S)`㓔봊z   0S X1 0S&2p xwp0zVji V`/``v`/V?0S00Z 0S;S;S T? Ar RܕpW `1P`  ̕Vx p )01AUZmY )=PHTPFbu@3 5>Ge%N@B~8Pk #Aaiu,RYbf 6#-WR_sa5Ng0 \\0\Hp`  W W` :V V 2 y;) R #40S0 S0 0  "0U00S ]0  ,! 00 8!01 !Q X1Shh8-MM ,0 @0ApP U aApPWAg0S$96 1c0 '70 *0'e10'`1c06 6 r1;  l1:801: :` < S L@ :  :(( $10As0S:S Qړ*? Br R P:S5 ̓PU$ЍO5LG'1=BY! xB  Ls <  %7JaYs0@- 00@-^a D0. _P000S @JO-@MP*`P Q9dT U|bTpq`` k_P 0"*&#: 001` 0 @50ؠ 0q[Z`T `&iX V1:Tp@ @`Vd`@V|pWV `0X7Z 0@ _Ѝ0r-@B =p@-@P _PpP 0p@@-0M@20222L ڒ PD bD ;q0S  ɒ* ;f0S 归0/20202;T02020S 0S d 妒@QT cQH Q@ dA< A—'@ (;4<P` ` ;),PP !P :$PH ]*:(PL "L :hPd &d x:0PhT .T T:4PDX %X 0:8P \ #\ :P R002029/02tP  s0/Sf0029P  xR002R/L9P  T0<2"D 9/02l0S, 02"3PU U EQ EQ EQ@EQԑё?`8/l02|P  lR0U02Y" /8[0S 44R"002 80᪑7/G02P  R002/|76020S "0 0`0S "0 0`0S 0"^ 0eX 6x0S702 $"PdU  UUU `<T<pNU UE5 0 FU U?T孏6/02,0S0S ".00"=]P ,0S (  ,0S L"P]<0S  /5P2S S S S Se(0S /|5PDh0S  /L5P t"ڐP$EP00S /4kP 80S /4^P40S  /4QP$0S ^/p4DPl 0S c/@47P40S `/4*P/3#P < " 2u0S "0 0`qP 300S2S 2S 2p#Q0X22Q0S  430S 020/230S   I\P "0r00~ 0b 200*s哎0S P/Ẻ000 0P 0S @ Kl- 20S /2Pp"W0S _ 1 0S h0S c0S Dߍ"(5>bw'>MW|@js}Y# $6EpN_){a#<S|x-CH\i}+j0ATvE-p`C0IU000iU000gU000fU0uU0L( dUd hnUX4DpU8#$0rU($mU,cU<kU8 aU BU 0 tU0 0 0TU0SU 000|x DUdPUPHXU<"40KU tAU| LUWU0CU000yU000YU000zU000ZU0UU0QUx0rU00xU0XvbUDrRU,pG(m0QPv?00`Pn? PP'X d0  $ 8 ( < , h 00APSPP@HXT<hdLT 0G-8M`S  R000UZP,0:MpPP_P 聟 ὟPh0XQ, `ZP@TJ90310ST, y[P\100S HG D1,4 40P(Q*P,4 @X4+0S"   P R000000! 0 S00==0  JZ,Y 04 0@ c4 40S@0U 08ЍE&N< X<p@-0Y$ M8!@00 0$1$ 00 0Z 1P Q:aP k> ; pg 0@Q@I ᄍ0: 6 0p@sZP |cЍpVD_Tgtma\ A-`M @PT1`PE0  @5! 0TwT1<cJQZ`?QpZP<P<`3Q  0vULdXp|  T l d` ``0L0@ .00 , 00 `ЍHP3O-M/@`0"p^1~1]0 0 0b_0-S=CQ%20 0"0@PT 0 0 0I -d1~Z10Q00P`0U3O-0p3wp00H0 T3W`@000 4 ӝ( P40@ P0 0"00 0P2@( ,0R }$0(0$0S,03(20S  Q U E \ A0( 0E  S   R S(  ( 000 0 S 0000W0S0p00 0 40R>P4põF 401  0 S000T1R0$0I810@00R  R 3:4 1 0 0S  r R 0R  0R$0sp$0S 000 S0$0 0R[0PP [ YP10 00`B 00H~1O- MP0`@0P 4t1  p0M( (0J, R * @ R@p T0 ( a 4 }0,4 (40  =40 TP100 V, (0@40 @t 040  Q`V0 q, Q 40 400 4P  @ KHx0p@-PP@0p\0080Q  㭴Pp 40 R,$M p@?H1O- $M@000M P Lh`P p 0pS P  ru`P. p0S P؀A00bU000Y& 0`p(0P@00 ,0Ky, (0RP 8`KU 8圉0 0ᖉM K@#0pH-M` PK0000Mb @z$PP 0PS  lx  0Q? Q\{0P 0`0q0SῇKp.@ga0@-@0St00 @]=0S   bS@:@xD<0S @ @'@AH4:p@-@P1D0` 0S00 P@0Up@0@- @@0CP$0CS 4P@AP U 40`p0 ST 4```W Q1 S08@@0Q@H0p@-@40SP 40P@p0U4k040DP0P0PP Z,D0(0,0 000#p@` l0 P@-@@0<S RD00@0?@ H0 BD@0R@Uf0p@-P@0000 S0000 R e P00 0 a cR00p@K(0@-0  `R @>80p@-OP@0 Q@@cOā@p@-l0p@-P0Sp0OT$0S@0S T@C0Oġ@p@p@ s@-k0 ,@詠@-@Td3BE-0M000T1@0O^00081` ㊠$1 0@00R00 R03:4 1 00 R00s0SP $PUPPQx1S  ᅡ eY' U 0S\PP -pP0 S5ЍH8@-P80@P00P00 P0S8P8A-P@p000 P`0000P`V00T0S L@DmV00C0eT*`@rp`Mp@-t_ 0@Sp@ QP 8O00PDH0D@@0@0<0p@s1p@-P@0PPSP =cP`&0 ?/h0PSp@   :`V p@0`0a P000S  0C0p@HO-pMbP84;@,+`0<`08 0@`$``;0pcQPV ?P GPQ NP {mPR dP? [P RP o]P bP0 jgP9 eP" fP$ bjP kPuP) qPT nP pPrP sPc OzP wP yP G{P }P Ba:660O~& 0Y( a0Cs0S-L0SL`L0 !0TL0 ` 0a0Cs0SL 0 P V1TR0SL0Sg0Vb_ 0S P` 40 !`Ⓟ0V قv#X5 ) @+,5 ) #YNP" EP MP "mP ~P SP 4  " 4  "4  "4  " 4 @ " l4  " !4u` $Pl ` P`0V:0u` `40P c  P /`FVJd@PKT\dlt<0S3@P 4<0 H R0A<$<0 H 0R@0A<0C@0 N u00 Cr R<0HᏄ`PP  00 Br RV  `0` F 1 @`RMGU5 %U8 u, u% U$ U!<U& /U8 >U ?U7 nU, eUdUbUgU wU pU uU yU zU000FdG00040 )$0 ) THNmaN4hk~3O-MM.@0"33PT(0-S0S dރ\K(Pd 1@$10 1 1111I? p000> 0G?0>0E?0F?0Y)K?(0@妎P ! 10!0!0!0S(!]0S |O0S \XON/!L0t/S@dR$   Mp$MP cfR  VP00: S  8!  zMPpR$1: cR$1: bR $1:$1%r1`S0C1-0kP/ !S0 ၃1!  b2!4 0$OP   ?MP$)MPP 1! X Jd d0P7Mߍ '}DTo@ t mC?D SG-`hM@PZLPU\1pp SLU<  #KP3pP  㓕P & /.P / ᾔP /#P 00 |@c 0P 㯭w@0U<@NhЍHjomCzA-p@`PP%. 0P.\ 0tP .ԕ 0iPE#3O-`4M 2$TDP"0P@@00P2PpP<p7,X4 `(P" $:"P Z 0   ڬP P c5P @Z 0S(ìP,(!1P aa@/PPp7  0MP5@:`d0!@0 ! 0 0 @ 02Y*`P` qVU  $0 @ @0:S S0S 0`Ut00`0S4ЍDT`bp@-P@֙p@8@-0@ PP 18-E-=M"@00002 0 00 2 2|i/pSPP`200Sp L@ d> (,$2  PPq ` SH -὘ !@P^P  !PQ 0,@,p!P001T<S  6PQy Q&  8 RT@<S   Pڼ0 0`V NPH Y㈘P  QW Q,0ЍDDPTXjz< XP/ 6:0/1!O-@lM 7 1p` 0A S RPPTW 0: S b@ @@<104>(1 0 0: S5 ЀЦ PRP@* YXP&[ZPP  p : ( Px p0  d0U`\  'PPlЍD'}T6xmCp@-@MP ѪPP0U R@3PP刾0``P00 00Fs0S Fl0r VT P0PD< ,0PЍp| mmCm@@-,Y+  0S0@-@S`PP0 000p0 0 0pMpᤪW`P@-P xy0S0X XS QQNR B,", tyP})/@-GI ۪@@ITO-M MM+@BM㩗Pˍ ϖ  ؗ+P㋗C00a YT3 p ` @00PZT- 0}$SR~$SR4SS   S B @R0DQ T 0 0 )P Ž@Z04fZ Zb00a {pPVwPR`W LZ@KhPC 0 Z:U ]P8X 3JS P.0H0W/ 0W #U0 0 ! ! !P0S! 0SR 0Up4 00a p`V0` V CS`P 4 0j彖  :[+   T1]0p@-@PS|I`V-P }NB)1O-M @0" 1!P.u1qHSXXX10'!.PPF  ?`rH0S 0 S@405:6<@ 0D T^S00V>@00 }00 }0 F`V 0"0` 0te0S s5Tl` H0"Y, ,2M-PM  b 2@P 1!P0 Spp!ae.@Spa8չ KPg[0ꮢሀ †:,\RSA\D0q    n}PЍ`00 0 0 .0 0S A 0 2 1 " @X KP 8s P >%DT 8@-P@@T$E%8E- LP000 0R ~   喻XPT@t0p`p0S \廻  IN P L00cL085v}%5O-@TM x5 p5qE@5@j>H0P RXQSQ @|0@0  ?(@d0P``P    @|%Y0C0C5S (4P4@LXdM|0S 8L ?P :? .@<?< '@f<?< @  ?d@0  |(0  ~|4LQ y?y{wl$s?  XQ Z <?< j@%? =Z ? V@<H?< O@0  <Y- ?< C@? 0d`,0"\*<H'L ?  ?d? {@ <8 \?D{{@Y 㾼0 R  RPS TЍDT  tEgGGV chlHB@-0 M 0 008140"01000(P ʹ0S0 01Sb@P F*X00CS0aGP [GL0S4S H0@0  4 Ѝ3jMDTes@-@ F0PPP``PST  Hz 0wS hSz 0S |524p@-(MP 0S H@㹼`0P( @1 ゾz(ЍpF8@-P 㡼@u 0S$P*NtP8N@-`:M `@ 00  0.p) /+ PP '+P`F&d@ =`$X X0T0P ?@ 㧥'}D NW W@-  㓥}A-`@PpP pW0   00@ 00ppPU@- @{P|d1E-CM@`1&P[ AP M0p 0@(@p: 㦌P` -S200@0S  @$ 㑌Pһ ㆌP @Y.  P t値P ỻ@@1 0C0T:]Cߍކx@-PM/02"l9h2`壺AP /H0 oP@ PJ0PS ~`>0/[0S/ !0r10 19BKy lCy0   P0PPU 〺@T10 1B`.Pcpe& 0y0S@T00 0B`.PDpe 0\x0S@Tߍ5 T H;G*8GW8@-PU@P o 8m0@-$MX@&x0H0S 0 S 3 405: f ʅPᄣPP@&0P ` P0000080x, ,0P$Ѝ00S0/@- 0 ! 0xp@-PQ@ Pp@耺H`E⃺@ xpGp@-M` Yd0P@ %P PUV@ 㤺@ W v܍p7@-P':P" P 0  00 0S 00C 0@*JP D ,@@ 0S  , ,0P>HH8@-@P`00080@<@080  0 $0 0嫊P008HA-M@ĵ0.Sa X@P\ QQpᗢP) 1SH TQ`p cKY/P 000 00C 0000 00 0`V!hP  1S  P  |XP `PP~000A8 80{Pލ`20G-`10t傺@W0E@@TpF RF1P@0@ 0p@8 @P W1 P T*0p00"0 V 00 P@@йT P0 4/0000SH! "2A-PM 01h@` 倵Pi "Pe õpHXp000cl!l1P? 0S(1 Q0S7 &$0S b 0S \P0S  0+Pp0  P>0S``PUލCDKTZ``sG*PD/p8/P0/P$/&P/P`0@-@00@`0Qs@-X``0!L0@ 00KPP@@d 0 0A@|@-`Pv@0p@ ,0P( TvPPP#8@-PP@@ T @ᙴ0-R_  0S  R .R  8@-@pP 0S  ᮠPX`P@-AM`z0@"MLP0 sP 000Y0* S 坴q1S뜳  ` ^PP 800>  (7PAߍ)TZ.O-@PM b)^003/Ph003/ዷ@DP `n0- 10*>0>0>00! !. 0?SP`q 0S 0"0ROT !PH0S P@p0h0!) 03/P003/ !1Prc+P+ !."uu u  u P0L u`p ፁPU 40 RT00S PtߍmCHir8 bV5E-ME p050ɵㇶ^+P 0 00000l|5P H+PJXT%GH0 00 R ,;0S+P$0 R a! 1S? xP D 'q 003/Pp`Vx( t40  PXUP' @4`$U 0&0R h0p$P@003/Pp1`P񟗛 (8LP PPPUp0S 0X} PP 0xp03/P P8p`V4PP 4U 2墴D ᤞ 003/PCP 0S002040BX`P;P P 40040040#0S 0pW 办Pp Y1?0x03/P840 040߯QU`P4 㩆 S ?P 100SPPPU 40S 040?P 000SusUЍ)P  & T7  T F t   H   D & I Y mCw b  @-00 tttDSTPP6s800 ,0LP0Lp3hH\ E-CMhAѷ@0S40@SN < R @aQGS0C4080S !cP> qP<a0000 << 0᭄ ᪄0    㡄00Pa   0僯P D080D0H00@H00H040S$00 }<Cߍ H6G-pFxM `t00pp40妳t0&P6 t00p004 l0K l1$Y#t6z:><0dv 0?00L60 `@6't(63 000:00 05  厵0l  $0p0P |ȩPpx50 R R   0S9  @<pt`_% 040S  D0#A?40 hpD0004p@p $h ⬭4S 媰D00000 6p00x 0"X0啭0dS< 0 ğ00' 叜0 姩q墩t q P00h0,00h00*0ŭ`P|唰XpY2<߯P A60S0 S  S3 #qR S R0SpW0Q0V` d, `& d0R42p  `0Rw \ P @ Pj 0S ` SdpG6 2 "嶠Y2! Zdg0  Tq`0P p Kq ԛP W@q0c Hh8q80S 8ppg4&50 'q o|L0p0L060SP00P00 ST00T00  奛0@00P A-xЍ   D @BHT( E* 9  S l     p     #5   #O   00 0/00Q P.\ @  @Q/5O-M/L25H2?0 =0?_@xP D k!P5 @/c!p   4 b4 4%NH   00$ `10PD 姳(040S (,0"垳,Jɲ.00@,p8" "<<,!44S( #, s S4p#3U pP <2L$0"`@ ; 0 000卲p劲!` p0(p00%<<\"4T P 帚0 ("000000 0@P}S0T20S d%>(`P0(2E0SD P 44Ś 0ಀp X  XN0 SKx$P" G X0 S0*S 4#PQS0*S  រ4 ጂP X ?PU$ Y3) pP74 pN 0% 0(G4%4 ps042>  p9<00=? (0 a0R000<0i0 000000_P(0 0c00 S[ r c H}       O-M2M- 0"2G>0@+ C^x P000 0p ` 0p`5zP@ l 0p`+zP@0D@XC. G.0S 2P0aPF>0  㴙CP J`  p⮙[ F>0F`⚙np0 0:0 !0噙`F ㋙VAn| `n|4' 01墯 yT G s[t@ !P 垭o|pO En0`3_ b; %+ 4X40_40` 0p劯Ѝۍ '}D.4 LTh0\ 0\`/0P/@-@ @話g@- (@00S@4@- (@00S@PO-pP".@+`v@̀ ᎀpe 0`S B0P`@-0# /  @ 0 0 ů00S۰00@-4P 8P @ @550 250 @-@㮯00S@t@-jP 0,@T@-(@,姰0,0P007@-PKPl0  @PPb 00 80嗪,p @T>425 150p@-PY43 M@P\ t!p10l!0h1 0`1400P 0-S0lS PXK@Py 堘Eᛘ7}ɷ哘U@ nPP ;.PP `P  T l8j Ѝpuv213 226 8@-x@W(0 ;P ((0 )( Ũ(P4p8t0s@-p@P`DZ00cSP 0 00㓮!QP  6`|NC- PQ0tM@`Ђ"PI V $`⁴ 4P@ TA4A"@@ 0A B$?P@>P0: S fT # 0@   0IVxၯXʯ`p͗V04F,3×00tЍ553 451 226 G->MIP0>C0x0 0)9 0000 0A0` R 050 S10*0 R 0PP ~LL ~+P( ,9  9 ]9  80S x1 ᖭ80P px6 㫪P 8P 8P  t8Ph`哪 60 : 0"@8@.PP0k0S  R R 0CS0  R R0C00  R~0eP*0 R R R  0 P:  0Sh }P 04004p4p W'S]Ѝ'S &S&S7 &S4 &S1 &S. &S} &S &SY5& PP­P""Ppjr|x&S p&Sh640i\&\S  SP <6R8V8PV,$QR&S9 &S6 &SPPSS&4P- >P) 0: S%UxP $k`]0 00v. 0000 00kx#\%S40SL <%Sp(0SGP., '$w0np  $S`Pܭ$S@ 0Ђ"P 4P P=PP<pP 0: S HP卫 0  0pw4$2p᭭WX0r_00#SA4PU,@~P  l3pPX,.~P  PPUPP  P"1P 0P 0%t,PWqP"S4P _+W t"SP d"S4P3 7P/@1<"S4P' +8 "S4P ;P"S84k8!S8P 4Q!7P8 0U80 T !S 0"h!S 0"*D!D (8?TGT 220 H" TIUQ221 RESUSSAP230 POONEPYTURTSEDOMOLLA202 TSYSNDWPt257DWCPUDCPLEHTAEF211214bmTSILTSLNEZISMTDMTATSVSAP[ VSPE RTER550 "451 226 TROP500 200 TSERROTSDKM257 DMRELEDRFNR350 OTNRQ250 EPPAUOTSf@- <00 Aq^QR 0a|p@-`@P0S  Y6% V 0U  0i udd)|\ 4vP000Cs0 SP U00YPp|!E-M0pAP #d!d `\!gV`T!`P L! H!DD! 000000$ 1 p 0S Q [igP hP P K1PyP p^d`pQ6/Ѝ43DLDTT.Ip@-SP 8)x|P@0,0\|| @,P<t| @$@Pq`p@8@-P@ 0QP8P 8A-phM` P1  0-S0S P0 P@0S 0  R;P嚧#P0 00Q h^1P00hPTuA2$QPhЍgA-p`^0P-S@T q@,}P P Aq Q@- \@< <0WP@#7P .H[1!s@-@  0P`t000dSP! `@.jz0"0 0S  ؟dh 0S Y 1S tf|LCgTP0E-/PPp@/`Dv`T V`` @㔆&V@0Dx Z.TPt@T/TUT T R`p00@ S 0a0CS0 0/E-Y70@p`P#+S  W PR 0 %SPW@ %00F  PW/PP@ PF`0 FS0P0 00 P AP/0Sp3/8@-@P)P85O- M@P0T00 tpxP5P`VT "0 M$5`g T?Te@P 0@ӦP 4T$P0S #S S S S  S S00 SS #S0̀K0 R  :yP PP ̐[p IW 4p 4$P  $t3HWT30 DW  AW00SD *PR3 0 4$KP / 0P( R ,K,0 .R(K P  R0 S 02300Dp00DW p200  0 00S0  0SEW  R 0 ,cP0pl"00S"p⛨82 p W|PWppW+ : xpP l   =yPp0Sb /uxP] 00徨qn/00 ip1 0 尀K.Y *Y0[.S@ PhP ⠨KpPx0.Y0E1P0t x   tpxp-/Y'  00 K0p mf <ixx00ppPYP%*PUpTK 1PK rPoc KsqfP[8@-@</0P0Sx ,P`000|  R0<00A R|0   ?T@8O-X1@`pPLVp Y80PCነP  uxP8 0S/S4: wP 0`$S01S0$S0S k  WxP I T` @V LP:wd᧧8`PUv3@-C 000S刨 0/@- @ᱣ2Pppg@  X00 0S0ô1W0ô0J  㰩Pd1S  P0pӄp00ń0`0S D cP41pp`ŀ00S T|`2 /SP T9  5 10@T ㉏P  # P!`DTp wP X P * P@  P~ `o 0Q @@-`p6PPV es 2.@2(0xP$ ~pz VxP  p0S.S(p(0StpZP0(0 pWV 0% 1&%* &% 0&%P26%QP 0 00(6 0% &`p `0 R0&J F% &`P` 06P%QP $&RƟP` pf! &R`| SV & R?& |*]`PV0Sޢ\1G-`hM40d R"僁!"0" q0 ShpVT2X0(D2@0S <PdVP0 "rVP0 |d1PV|4 d .1V |, Q11Y9% cPW x-P |u| ٦ 0QP$ UP0(!4VV&|$ % %c&P 0 R0%%|  0cP|0 Z  P|00| P | 0`cP@0 @|否P 0SL)hЍP[D H:i_s1@-;@-(M` P0pF@  0DP/00 /00//u@P0Y(V 300S  SةHT002@ 0/S兡:74復弩庩@:2T@bv`P ]tP`pV :00T 2L@@HQ 4 LQ $0S 댩U W 8Q {<Q D pn뙍@P /S? =S #P" 0" P0S0 3 `|PtP+K P s0P" K !0 姞 0-\P R  㗞<300S%P20@ @ @ Pp)PY RV 0SA \1 X20, 0 R.*X8 `P Pa0P}  YP}廊P p00PS("("0 0 00` 0 0 00 a#儢/* f rP0Y;3S0/S $*r|KD2P.spP0x`  iP`V$K%0, 0 0/SL)P T0 0P00  0580Z 00Z ~MbCo\XiiA-xM`pl`圡`3@X3 T40P30L3$00%4l0#03 ( 00p00400h0 0l0000 t0@` t\! # ppP02`@00Bs0 S 0a0Cs0S dD_@P R D2\l  @@1$0A@0B0 hU]q@ `l |)2 1 P 00S R P1:P P᩟X d0s d#.pD噝dݟ`ԟ0BW1W @@ A0 @0  x@0X0$ `P00 0M6pP ٜዉ0%8၉xЍ"6?Xf<DBV\? 0O-PtMS -R aR0S4P  P 0S 6 0P-S@`*@ P0@  FQ@d$C0 @ $C 0p0SkPE@@c3`f`` > S p/pP   000D6ḈPd4 0+S 0S   >S0 00# 墈P ; \ 8@  㾞 32p^(0 HL0Y<) 00x2x0d0 `d d>Lz pWݙP0 %:P0 0A| \ aL~^WL|P :QQ "P0  p Z APPP dP0   p p 1 W  㼰 0p 00 0 :Rp0s0 RS 0W-S @ @ x0ϝ2  002 L0ĝ`VtЍ   \ p q 0 #)p@-P@᎝p@0  -$M   $Ѝ8@-P@P ớ88@-P@P ᯛ8-$M "  $Ѝp@-@P !   ` @` ' p@- M@ W  $  Ѝp@-MP `@P00`D`"o㌜oF  hPP00_S Lx ὚40000S Ѝpd2E-`dMP@9  D噟szP0Sp2  TP0 31  0FPpW0 1 p   3Px0Q \P \L0S0 S(XhP $78P/S$P*RP 5!0SP00@p↜  P P X000*x  dЍ *BT"2O-LM@ )2p|2 @ 0 QU`ᴜY=<r@T` `yvP3  3` P y9  (`  wPM (mPH \ ah00( pP4)9 ᒞ8   TP  JP)0SauX wP P p `@T`LЍ:LmT r#p 0 0 /\1@-M  @ٞPڀ0 @ 8Ѝ@- P`  @ៅ000 0Ȭ Ѝp@- @ፅ00@i8@-0@ &0T0P? ᣙ8@- M @  8 P1 pS Ѝd0@-$M @  @ P P0  $ 0PաP$Ѝ0x0@-$M @G  @ P P0H  $ 0PաP$Ѝ0@-(M @(0  #F  $ 0P$P(Ѝ@-(M  @ 0 0  l yP  RDR R 0 Q0S(Ѝ@-0P(0S 3/p@,`0p0p@ 0(00pMp@|0|(0ep@h0h(0p@T0T(0>p@p<0<(0lxl l ?0S000000cpXڰ RR000`cPVʮЍۍAO00@-$MP0S @  T P00 1 001᨜   P#$Ѝ0u@- 000 0( H8@-0P0S00@@'0$03/p@00@0@t@$ X0RPiT  4嶟  尟@8Hm|00@-PMp@0 H000 P0 0000@(8 00Ѝ0 HO-,LMPW4@0$0000004040404 00 00000 0 00 00/`t0h4d P%LЍP%P  0iS aS eS pS wS mS 333333$07 ᒙP K D3 J\3  LHH姛X P3  p30S pp JXP 2"Q0S ၛ:&S6W00S  #P0 @0|2$00 p pP\2 R R R<2  hQ d @X  %P 0S TX 4 P0IY !S40S pX7  W D !UY P YPPPUPU eP PW PUPWPU  O I00S )[7 @^D[Y?* gmlxl lm!M@-T@-S_0a Cr R 0Cs00 Cr R a Br R_S00=S SHG-@Tq`VP꫗PP套`:P0冡熑 P P P P  `0V `0 t0Ph@ T P@ R(4~!!!!!!>iLx@-0 0 S00sp P \0X0T 0 0 "Pp3ЍH A-`P@ 0q)PP@0T劕A!0@-@l03/PTELP 0803/P $Pxx ~!0@-@l03/PT LP 0803/P $Pxxn!O-0LMX H@D0P90$弗D9D)@9049uQ0    9001S 9 0 0@ P ` (@f0 $0 Hp(EP 0#S ~P YA `   ẕ 4)P0$  0S g~P` P 4僒4[ PዕY   C~P `7 XX ` <  -~P  ` V ` `[ 00 ~P00S  Y [ |~P  )P X 3F4PnY Y? f400Sb }P }P }P }P 0 }PE 0X 0S   04刁000* ,}P0S4P۔ }P0SՔ49Ĕ0 00 j JpP V^P l; P40 0D0p D0坔D0=P0D0dP0030L`h3QPPᗕ$3 RU 30`N O 0  &PA20 < UR[, 0000 !dR0Z0O ( (0S4S,P }@00 P:0P 0Cs0SSڔ,O0X`V`  |PP03/p0 p #PpXP10 :[010  p6 102<m0 8RD 80PS< 僔80P<8{Q$0s@-P`]Pڄ0@0SD@ Q4SX LQ8L嗓00UT`|Q$d$pH-M`H00  M.P@0@00OPH!0K#~B< 0P({@ 000Kp@w$@-@.!0#dB  `Pw$@-  00#,,<!$~pH-M`H0`0  M.P@0@00P K !@000㧌Kp@@-@ !#M-XMH0hK0  MJ P@0@00ދP(`@0ShH0D0DhK@ppaGWH  mz`H gizD0 @ hK@0SD000J D0 0 0K 0YC0K000_K@A-`PM@0S8x@ 0L0 0M0@PpPdGUH  9z4H e5z@ @0TJ @)@@-@.ɒP@@-@.忒 P@H-M@p ㎑H0P0  M*`@0@0PY P@000 K0@-0,M@$ $0ڊPPr1$#4$ s0sP $0D01P$#4 s000P0U,Ѝ0$$A-@ PP,A0S% Hr100S2S 8廖P 0SHiH0 AP0H `p~p2SH' H0 +P H姍yA2S0P3$89G-M0Y0<pw Ő<8P 14AP804 ( D0S@8(8PY8P`:bP 00`⚐0SX<C0<0<厐ዐX80, 埑0 [800 0 v` 3yP0!0J 06!0P00 0!0 aP(/V`P| 䀀( tP`g|0-S  |dP0P|0`0SxP0$0xP0$0Z600$0S (0.`,0`P|  |9P6,00S0nS00o0S0S0`HxPw.8`_P:_P 00<Lx`PxP`T 00Cs0S  `P `V|B2 @S0YD 0R:LP ` V2S$0SS($0S% $` 8x㤏 塏 8垏8<囏<L嘏LP┏YP00䌏D0D0D`,`P4`=xP 8xP 3xP DX lw0 00^0 D0j/tV0S 00000S)08 0,0,0808 < 80<0< L <0L0L  L00PPQP P0t;0(0P@l iU @0S 0S oP)_000s0sU R0P0S0yP1#P l  8 xP 8긐0*S0S 5 4")r y9P 0HQ 0REwP 0NHh0H0 b0sDZ@X %8tP(0SDPD00 +0S 2S"9@Tt 00pЍ$#&/$$$T.q.}% %+%C%Z%p@-@T@ 0M 00<840,(P0(400(8 8(8P01Sǟ4040Sϊ7 =7 '00S!7(Pǟ SR @ 0 @ Pv-*' 7W07070PPP Py60$0` 0S0$ 0   P(Ɵ 00S@ ƟP 0$0  0QPw%,@YE  Sv5  0 PX$0S tݝ r H "0! 0 R3?  AQ52S  ḆP $0S' G"00 QP TP @0.3 ; H0 娆Pfv  X @0S "R@0S= , R$ 000S00 4S:ۏ 400c<S T  8v 00000> 000 @0S ͛vPL'@ @ 0@`V $ ~q 尌T 0v2  2S  @0@00 03/T  r 0@P B0@ˆPm 4၍ 8|@P H8D" 0<P cP  "<֍P00S  S ̍F0S <0S 0 0F <0S @律 ! QP 4 PdR7, 0P&@P D@T E~ PLo 0L. 2S .@0& D  0RSj 0SBEs%%%D T%>$PܛW%@%v%%"$]d0 p@-PX0`@, 0s 0s 0S D@T`p  Q 00S/ 00@s R/A0@S7@/@-`0@P0rW :PPP'r  pWL0 0 @pP0:S@0P0U0S  Q 00SYF/0 00@-0 )0C|@ T a0Ls0SWL0  0@CtP U @aPDuPUW@D :SS,  T0 0 0S  0:S0SR\ 0p@-`PDtPP 0@Tp0 p@-`P3tPP 0@Tp 0p@-`@!tP @TF㢋Pω4 T @@0S00PPPps@-  PP@ M@`= `0ʼnP@ 0MS `@ @0T@tNj|1&Q&p2G-pM R@PP L PP@8@ |U xU\P`e\`P`_ه0:SS 0Cs0SS :S @aTʎ as80828^렠@p Zs0000000 0000000000 00$0<(00,0000040 0 0SV V 0++0000W00 NsP 8@ UP$T@P ,@B0 EߍN]&8$ G-`@ M  pSP ݈ hP_s20P|" 1 |1Ȉ r' OP r1 (p 1᳈0 0<P0 00! 0 0P 0 0r ᗈ p"P0 8p⋈0 $0BP0 $00 1r P50x0 Hp i  r PXp h@Y sr P0 pI cr YG P0rB\ Ԋ Ѝh&y&A-xM0@PcpQP [ `0%[{5V1f@T P GЍ"&&@-p\@0S1㟉@0@`P ,@GTP0`00F0& ? Br R/&<p@-P8@` ? Br Rpp& p@-P<@` ? Br Rp 8p&O-@M PPPa^pPZp D  G0S|   \ R|3/|G1  l44 hG1  TF Bx0S# p083/ F1 0H3/F1 0X3/F0h3/FjP@Z 6DqP180pp< 0  40P F  k| 09R 4F0F00 S  S S  @S S EHPp0 80 0000004 # 00<  $0@ 40 (pnQp@ChpF1SXkFPRpL2 1 <`Fp/q0S R SF 㚇0S9 1!VV``FF0000000 0*;FV 6Fx4F0000100 0*)Fh&FV X!F$q DF@F 8!l 0!i20S(0S00( F2Q FQE(Q , E3Q E ; 9Ѝ R &&L &'''('3'='P'h''''''''''f*d[P' (H(e((((((O(()")8@-@P!00SYH P|PP#0@IPP1l00S rU@TP P@8@.PP^8 0@-P@@M@ 0嵆Ѝ0/)@-@(4/`Tyx@-(@Q\0 X@%PL0 PD0 0 P800 @R,0( P03/*xTy`@-q2"O-pMP 2@`pf 0GSW Z d2   0/R0S  10@P(<(<"40 R a|P 0W0X  Q|P|v0X#,,<!$4!R4 S/000 |D 0 0}|D 0 s|D 0(#  <"!00 S xD  ~@PTDDЍL*3+T:+M+m+}++++++/A-P@ ` ``   8 b⮇pP000 S 0  YP0p03W0Sp 08S UPP D0xD``   ++0@-M0 P0"@V00Q  *W0 50 P @c P  ^@@ Pq hhnPބL0HH 0000@&Ѝ0++TT.+| @-`@P,p%@P  %P{ u%@E-P`YInP$8p @ἅ3ᨂ0PS0 0` S00eVP⦅ [VP✅㰅 NVP ;P Lp0SW0 0S0@@ ,&,+,3,8,G,2A-M,`@P0"lP  \2 4L2  @20`c VA Q @P@ t!13P  P`Q 0SN@ m p圃 m0 F 0p  '@P pmPP mP P  mP @TpmP ^Up0# 0|0嚃 0R000S  0S , <0P܍a,m,THNq,,E-@IMP` >lP   9 pP3 `0wP3Y)iP3R"fP3刄eP7xs0S30cӄP3 0000S #0#АP20pSp0Z0SPh W U0u03UPPU ~Q 壀) Z$W1 Z$ i}P4[ R;m AP  0S  Q  R lP 9gm㽃㲃㯃 0  0 0S"!0c " 000 P {l @0@ P幀P">!0!R3   `TPPYJ P~ LP R 0T@PLT.T,p,eW@-3@-@4001 0SP SA-@M. 0p00Cs0 S%P`!9+X?`bHSTP0!@ @``V ߍq,s@-P᷃@P<  @ T PQ0`0]S  SP C0`00S `Vl0 0 1@0 R @0Se` ]|,,A-`p PP@ T 7/P 4 @⫃PAU>,Os@-P702@0$0 20P0000000000  %Q` k 1aa0  0 0!1  P0SуP00PP0p \@0 RL DD@<Q|,,*-,K- y----- ..%.H5.J.X.g. u.......@@-@  K00 /A-@0XMS 0<0L00D00@00H0 0<00T P0KPt100 R @ RL  c P1!XD00CS!qq@0S@H8`hXa Ta L0LaH1`@aH00  PM0> /ᝁЍE虁ЍH/0@-\MPg@P3 S 80<  @0 D00@@S0@@T@ ~ 0\Ѝ0.-\MBP 00CSh h3 S 80<  @0 D0000S0400S0 v\Ѝ q.0@-\MP@P 0 0`\Ѝ0| T.A-(M@`P p$@ i0 0$0}o`P $@P\>PPp 0 0H M>W <@TfV(Ѝh0r000p@-PS 0P-SP dzxP 50@S?y0P000 S5y@01A0y1S0 Sp@00k,0{{ *0C:j['{F{{& /Z7_0f{0k{6{/k{kC/A/k{kC/A/40@-0I@0@ODᜂ0D0P#0@-QpMP$@ P 0YL @0az   0@0P {|Ѝ001 A--@M@(Q6 0 040S 幀A ~pNP ~`HI0 #~P@+S~:MTTTP(&$"{{Ѝ00000000A-P(뀂 `P d{`1@0A0SmP L1  40 `"00(0P,pqy >Z{`0 $0 1{ {ykN80080 0S`0`000 {(000 0L0y   ,"  1D 1 < 1O-lM$@0p`90 PpD 0@00DP0P P\100 SL L{d@ 8}@L0D $P0^gA0 8 S@ ԕ Q%0  $ I0&00'0 /kD0l )kL0  #k40 @0<05k P0k<0P 00$00097lЍJ10 0H  /@-P@p`0s000 hh00L8}P z0S 8 R R*z80S @  R@ :Hz 03  Lo3W3~33333333O- A$Mpp0`00M๿LP 0S 0 LwP y 0 j{Q D $0K,  #  1w(xT1p0,0 <0K0,0K0 0RvP0S y00P#:  1\Qc Z8q 4 )4 s0YQ Q@@0@ !K}0S  R: K4 3 3HA@-lxD4:, :$ : Q :Q 0d0c|9(Pu$ 0  0p,`jbPZ\ 0 90S 8 R  S*94V4p444YN 4@-8 hA0M`P 0< (0@!@1@ 800<0000 0N` f@ fPpp ^0   0 D 0PS 0R0 0D Hhs9 P Lk9Hh90 SF4D4T515 2O-0/00=0N? 0O?0Q?0>0t M?CC P@` PCPJ@v@0TS(V0pR `0BQR?`p:00GJVD1 `@  m V@$ 41| (`0018z@1 T0<10810> 0>7zSߍe666z666~'6A-M@`bPPt b/IPP  PtP0 @H gb|0UT00@YOL00D07t-0! @RPX1L 10PeD#PL0t|P-v|0,L00L0T P P 0 S0@s0pW  oxTPPp T bwL03 xd0P0V  $0  0wЍp 78L &707A-pMp0Pl#t0p0S T a0/0BI@P0c  `030#,,<!$4400`3 ~P+T/00WPo0 @ 2!404aPZP4 RT``RP u0`GP4A  ?4P049 P4@)@04T+P4!04X P 4<4p@EsdP R P P 0 S00P0r00S4  P0S0P040S #(",       puU4040 owU 80 40 wpЍ9p 78L :7R7w77&707A-PMu1X@W6LAP0000000 0000000000 0( ,03A P PAP:t x>0h`  !0x0`060 l00p l0`mx 0 l 6xxX(00H 0< 05Ѝ777788@86]8y880@-MP `P `P#00@T @ P`P `P@0 01S YP% ? NO]X&P 0Sq MЍ0888J'TP6@- $01NP \tN9P@-DMt0` #"v< P@`~McMP@PX92O-dM` p0"T00P0pl2@ 1SqXP8`PXD V` PPP/R sP sp)wwMPt$!1 pu< _   _@>K> !#0D0 LM LLY pLL L`U`P` 00"#0uP&L 0uP[ dЍ \ P\0@  T24a9g9T,9s9|98N99X99Q@-!0 R/ w9@-0 u 00@T{90 @-u 00@F{!E-0M@P000 007'0 'p7 000000 00000P7\ 0 ( rǟ0 R :R p0L0_TL&(0 RƟ0` 6P1!H R 0R0S61tWppW$pX6pdzr\\ tr Ɵ0S $ 06HR  }pp$0 0St,0,@ @ Dt$ R ,t,tt,rV uuLş0S DzV@ \ 0vHvv850P000p 0R*,P@`$@LPp^YQ0iT\`|` \ n0|`0000 0`dZ0S d4T`drT Fu#0S `#3 4kß0P 47vX T @0oT,P@`$@LPp0 `t,A$`@ ,D@ Ot,G^p@h&rP # 00 00S 0ŸS@2@uu00P@Uk@T( @1Ÿ0S`4(Lp `P8p4Av4 8 $0S | n`TP \< P<@qpP@0S DŽ!`0S 4 v(0 8 1<40v( @3$0Sa |0`0P 0tnPj`P7u@a@14 (4 (  < 8 P rH `_u]u[uYuKt pEH0}Htq9D9T[ l N8 q.T.9:J,e):G:k:\::::::::::$0@-@0S u:7@-0S % 0S0C 00S 0S4T  0L 0SD0 008iu,@PP0S >:]::d0p@-@X00 P`Vt,0 000p0@ S:p E-@P`p `00P \P`p800W:x` V00A!  @-@Dt 00@ 0  /@-@ 2]0040p@-@P0}Sp@ 0S/V/^J 0YR3S/G/UJX0@-   R 8 41@R  1@;:";@@-{H1@-0S 4r \ ]P40eS0 cS .lS zS" )0 R%0    00S 0     t4 \00S 0 X@;;@- M|0SQLQ L Q̍ A@0PR  q\܍G-UM` NqGt @dIP 00VυVH00%堼 $t5 1aV P PPSPU mr00 4m(o0P0010 Px40S &0S H sPo1S  spP# [ăP`0SQ0P0 CR$Q00PQ0  P Q :Qĕ0Q5 Q Q! QQ4 'Q- L0SO S   SS 0S " 0x [0  RR 0#0( 00S" Z0wSJ@>PPhP  rP`pe P PV` ` PV100 S g(00f(0$0`7V$`0$0Rύ0"S0!0(0 S 0$00R3# 0~.a,~>c 0R {pP> <100 S 80 0+0S0@0007P00R0"! R3! (0~.a~>c 0R MpP 000 S (00(0 07P 0 0 PU PSߍ"<<D2<p#<@-P$0 R   0S8@- P@j80000S0P0SP8o8<E-pP@`0S `VZ@PpW`*@fX@0p0@-@M0P0/ 80T^|0H0S 0 S 3 405 : = 9t,QE 00PЍ08$O-M@pP$0 `mn jn :mQ 0 )m 6 R R$P Ԯ60 "PA  (  R !TP 4040qV T00= &LPP``Pc -R0 00S m 5$0V P:P oF$(_>(0 Y> TVPPP`PLS 0I00j,S , (00 T <> $0YU) +V4 0> 08 & &+&# $Q  D4 &4`v`0(0040  nPPP`P 42+4 b4P00 ,00 004 ,0Hl$0S#?F[00 S * oP P P000S008 Pmn?0}S}>0 R,0 02g@P,  nn@PTڰ0#0{$[#4s0T P 0 S 00HZL"H ̭ < +ne R5 [-00C 0@?P P "@P 9$ R #  *P @i 0 ~H10`5d偟 0\m 0! [Q S0@ PC  m P 2= 0 PP [  R L  Fr SEZ@ P P%=P0S m4@00aU0 00dkЍH<<<<=}A< =#= mCO-MP@Pfl0!0 1ူ10P qk0000,000H1 @R0U*a ' RPt#twp0GSJ*0.SJ *P=PE*(U+Z:* TP5jX  eP IPP00Ƶ,\W  UP W\x0  \`0  U h 0PЍ\LH\Dd<I=HT _=<<= "N=b=A-0M8!@00(1( 0$1 00 0q 1P `pP@YV* 40X0 S/ =P0S !1ReE 0| 82  p>@T 0-S0S  Ѝs=E==DTq.T0000 S P0 S?$0/P/0/ =` O-PGM@"pAk>>.100> A?0<000> 0000000B/C?=P,    0   0  D=0 0D0 !D P   -<09@0 ,@( 0 (<(  `]@ T&P  )  T: `ij)1 0<`e) <`e i|j 00 ;e T` ;`|eP  i i[jD;` ` 0dePH |g, R  E?`WeP [  :Ke j:`MzT000l  Z  T` 0 00+eP l f+ T- LiV@ n9A`0 1#q`P  @GS !i ijTiKiP9a@ p (Z d (0p P (`cj  R0Zj0LVj@? 4P dP\00T0( @'0H<8@0#Q00S \x=il<8p( `0  R 0#< '<<!440 p 0 7P00 S0YW? ) dP ` tdPf `Q4`Fq0  0  qhP } PyAlX0S^ 00Q R 70@l <_  y'e peP 1R!qR S SS QQ $QqP SNHH& @8 $0_`_$0@$0 00P005'@ @P-'T p RW W%00,Q080Q0#  <,0P0#<  Q W,@ pP?$PU 850@ P @0 ]Tl @0` ]Pnp  0I00&P& hx&0S0 S hP@ U h,@ pH0S L  IQP9 P3`0 &0S[ EP & UiSit30@ 4-4` p0 S2(I0 I&>i LQ H X0``ap q&t2`0 Sd  e&un E Q> Q6 Q. Q) =Q* Q 8Qx3Qp0&Q*  Q# Q@Ll  Q Q ! Q  Q? 0S; 0&0808'&/ H&&@,@0PP +/`0~jP,40 @,0000Ph8< 0 < <D Q8 2g[ T D0AT(  ( (00SGߍ,@ p%==DT Q6 \ ===4=>1>;>?>YX?Z>l>H>>>>p^G>> ?@?<1@-DM@ P<0|10"x140<0\06 @'P0<2f8yg  0p7f` 00f 0 0P0 ` fP` 4` 0f| 0 f  # d PE%\B%u L=% fDЍ?@R@E@D_@T@T@k@@T@T@@@8@-@P00SXai9PD8P@-pDM` P@ g8 O00 PW 9aS0$0{ePU $ U/$U $   e0 00eDЍ@A@@00 R /@-c"PcA8@-@POv!P 1 08Hp@-@f PPe7`PDP @P P `$ V7P  P0 P0c`/6?P}6U PUP#t6U PUP00 P0/S00 F fN00C000EPP@7P0P0pBT.B BO-p0P0`\@0 PСЀUU 0H0S 0 S 3 405: 4 ,1 0!u(00`E@-P P@ \0 0$/ |0P\bT7P00000Cs0 Sp` W00pl(Bp@-@ PY0PI 0 0 R R @ACqQ 0s000YY* 0Cq Q aAqQ-S .S :S >bP00b`P0 SS SS 00H0S 0 S405:3/ Pp`p?B@-`P0@P.00 /pP/P 0S 1E-PM0xA00SAO40S ` VV1l pq.00 00`Vp .P 0S paW.P a  d! 0!40S R0 00S    `Yk 0  040,00ߍH x*0O-FM M@T$\*\d4P$T*\4LL*E.0 0E> 0 0E.F> 0E.F> 0\T`U P pMPpUdpPE ƺ #P\4S p9PB,T0TpvMP 8`9`)Pef0P 0S C@T p44p0H4dD0D0[S%4PP ]4P 0S:S(aX0d/SS8X4P X`XX4 -R0S` TXX` XP0 00c$DH 7@D$0a"dW84SvW@ (48ĝ'07\ 04K" ($E"|0$P4@",Q cX 7"W @Q X0 ,"  &" 0S f/ D ` L0d 0s3S!S &S'S (S)S *S-S .S=S _S~S 0C| \ aL|\Q0 84/L, 0!~d %Ɵ#00YZ)  0/늏 ;.Pe ``8iPy dP Pt P P K?@S jP a<+3@00P:0P S S cpW _ 0R 400S 4p5WCP t04000KZW!$0 p0S$0D_040000/SFc(BY04D444H4cSP,4S*c,(p[@ 0P Hp,:3pP(0T0 ,0P K1P, 0P (*(p 0 (0P C_ 0R 200S 040(p 0P (d `D)/4P(p0,0(4P  s,4P hPq   0  ^1P R0 (P|( 0P\ H_[2AXob  bX  ?_P ^lЍۍ2SBiALXBD_B+TxoBzBB2BBBBBBBC%CWC pCCqDCCCCmCDDD*D0DFD]DcD@-dp P*00,< !$O-DM̠P*`@ J6  2pJ J <"  22&@'pJ  4 0J  : J00 0`DЍRp@-@ W`talP 0UPP8 ^400PPe Y[<0bpA+>DG-M@PH MJ%5 D0 O &`Rap4 4   VP 0#,,<!$4$#88S |^x4x``FA00`T P 8 (Q` _4' _" I Iyd0S$W̮pp0x0070740Sd04c4x cP PA W񟗷tZZZ@]D[<0S 0 <04c 40p@0 }>40@0S0@0 }>40 0D00840 04008040S ڗc㑨(X0C40EJ\47  aD0Sh  cL* bP]%6R| Z  ZwL BIP` ;IP Z L& 2IP $ ,IPW)\@]\\]N 800 S80`:p40`040<0@0@X> 7p40 `6X4  pDpGpC4p00FP0S [H!00R00S 0S+V a0P J 0 0 c0R@13/P  JIZ[  :U  4GߍW@-@% -R%0-S0S@ 兟P0   P QXd呟PT@L0 H0 @0S 0 (0R\   FE$5E%E (O-eMF/@P$G00.5 Pp`440$0TP񟗉teteeepffg,gdg @Q{ Z$ Y$0 eFSd1$0Z?,6%0| @Qb X 0+S0Sm -S0Sf $ S$0F SP1$0Q10U?hQV @Q< 0S$ ;$0F SP1$0Q10U?PQ =01 @Q! cP B1P'0,` @V(p @W FF 0*0 @S-Y ^$ $0F Sx1$0y10_?y@QVV<<^W Y]3F {.P  FZ Y Z R 0S ^Yύ0F 0y10_?%0 S7%0@R@?2 $0S l ZY΍0P 0T1 x ̠!̌0,44!̠̌.Č0 bQT1Q1F 0U?U T x1Sy1S |1S0 0'0KO( Peߍ\EEEE|8 EEE@-0@ PYE0A-`M0Cs0S XJS@$0S  R40S 0 pT E 0 Q^P 2SS P0Sl d  `V `VD `_0%``p<\@ 2P V 0S $Q 40S `0,0S  W`P`p 5E[B D1-[PEEpQ 2SS+1`P`c qP @0 00A~0'0S 0[@0 0`0Ajh0' [ЍF&F/F6F>FG x$XDFQLFTF^FiFwF(FFF@-`0yM Cr R)QZJ]aD R S} D0 P0C%1S111S11$0S  S 0  "00  "00S Qz P<0S 1S | D01  BqDd#P0S%  0   0RP P0 Y^0PPPRD0000    80P PbP0S00S @: Qt Qh`Q  <<2&qW p DPu <~ kQ   `Q" 09 0vP  dCP 0D>D> 00400 `S 0 0 `SW p`pQl6L3 9-T W $X 0Ѕ0< 000\  8 g80S PQ l 9- Sز[[9 0^bHnVP0 RP(0S s0SI 0  "0C0  "0=<0S0S; ⮍ B0  0C ,>S(>,><0S ,>S  B0,0  BB P#P0S 0Q j P `V2pW[Ln$[P2SpH^0S0Y_% S0 R ( R 0r R xPU`Vߍۍ00$8 GGH4EN(y(n@-@Q XYPLVP@ P@P @GG@-pP@Y` B0@T` @-U>H@- 9TP 3TP  @;X 0  [O-MQ @`P848   Pp@QPP@ PP@ P`V9 P1P Q2 0s LR/P Q# xPp JJZ!P Q @ڙP8@@PPY  P0S+W pXWcUYH h W  dA CW 3x2UW0 0UA 0* x  ** W0 " ሠ3R A0 㰻 0:A W[ ḹm P0`P   UV HAP HVV#p T1 W{A`0s (p AV "18  VcAY $p 0VYAU pV 0`V1s  $ uP0PP h0QV;A ЍH H6HGN8 EeHHHH @-@ @08;@-0@ PT E0E-P oMCqQ ~FQ SxRZsT0` S S ppR R  a  ^R RY RV RS Y`& ROpx R SH QDʌ R S?(RR9 R S4 Q0ʴ R S+;S S%R@ -@0  x0S gt'P0S 8SgH P0S b(*P0S ;Sb uP0S1 1 S0S`1S 0s 0   0R9P S `0 ```?0000    0` `b `0S"P (0SBL1S Q  <  <Q P1S Q  < L<8Q ,\Q 6S  <X1S D r i dQ 5S  <`1S 0 S:xQ0UP U2 0S)H1H`V" 4qQ(3TP m/>P1!R10p0S9c0| Q wT1S < r  l UoߍIFpG&FPIKIIIIIMII(IJJ@B$JQ3JE-JMM$@ P>)0 0J.l3p`X3T300KHP0pԆh=Q#   0S404S 0  I>R +P80$`VpW$0<$00SG   0S404S 0  I>, @80Q0SV FN@ @W@3 0V0  S 7 0 % T . 0  0Ya3 @F S00+ POXG UE (1J0S(XZ3RB@ :>0  D4S  0N2C1004SRW84Sp<4SV44S`X0J F  @0  P  jЍۍrpJ;J]JjJwJ4G-9MT@`8Z00 0SQP<Q 00 P t Pd-<<>0x0ISXYpWmaYQ\ *YQU ݕP P0 PW  P F <>Y00GYQ7 l忕 PQ0 ` 7 PQ' @ P0S $  ß YQ 坕 YQ  YQ  Y0S  e Ÿ00@pQdV`V``L @c @X@ 0W0 S  08<0T  0@D0Z1 0s V pT@P  =PʨDQ=VS 000 0<0< 00L @   Ht0S< NP 80s   ) ^@  p<  < <#09-  @!09 (> `0(>,>0<$00SPdQ P 49ݍ8 JHIs9\np)IJJE-VMMP@$P<0V.0Z4Bn`P0CⳠ4000000 000000P0 0 p婔PQ~    0 SH50I50PQk   P 0Yb0 SH50I50yPQW 啔P0SP  0 fP QA U P\5P0VP Q1 U 8 P X \50F0@SpW@ P P  0 2P0S 000Cs0 S U P0S \5P0     0,PSH5040I5S  0= 0|@QURN@W 0 0SX  0F0 0C00W0S S0 SS S SZ0 000R S00mPYߍۍHs9n~@-@Q 寓 P',ȓԓ@{@j  GO@JGX0p@-(M@`V`T Pc" > (ЍpA-@`M VXCJ}@ P$;0 0S S``X1S (q nlH1S Q  

00Yc% 00$兒03 ENSQ } pU 4 0I40SQ| } pB +4 0I400{ @R Pf T 0 S QZ E 1P_\40_S PK  0 RSQ> E PC \4 @R Q, E Ph1\4`00 @P pW : 0 CR P 0  0S0Sh SNKE P U \40@QN0S00V U00BN@ nPdЍۍK KKKQK3@-@Q L嬑P꼛!@$cM @CKG0@-0$M@ FO @O@ 0ZOP9$Ѝ0LLE-@lMP4 J9@0 0p 0@0Tp2兑P&Q ~0@S)0SS00@S)0/SS /0)0@P)0)SS HH)048 MP`V 1. 011 01j P  <(< "4P`V 1. 01N P <(< "4 P`V 1. 017 P  t <(< "4 P101 P10 P10 P101101P101|P P0 P@02rP QJ 0ݐPi 0eP Q= АP\ ,XPQ0 T_NPPQ( 廐PG  P(>0@SQ \娐P dYd?yP Xd00!0'P0SZ &N9WX 4 `;8 P W00pPQ)0S 8P/0 h 8P0 P 7P)0)0)0S)S1 1  2T0S 4`TM JN0P3 M[8D000S00,"R01 010S00,"R01 0100<2S,0SHKlЍ(OZLiLLQeLLLLKuLLLLL90@-P$MP@0S  M @M9 U@ 0 0M8$Ѝ0M#M@-@8M ;,0S 2ST -0)S /S S4 ($ 8ЍfK1MZM`MeMjM@-0 M@ R FM @M@ 0SM7 ЍM@-@M0B/<, </@0PC/@0KC)0S0" /S(" $)S " 00,S2B?Q 0S  _2qM` 1Mp7W NPP i  O(Q |b t_ !0S dZ !0 TU !0 /P PI (I 2@D 1    P 0  R / 1  ) 1 0" 1 0 1 p0x 1 T0` ߍ+LM)MMMMMMMN NNN$N.N(8N[NNNA-@-MppKPP 4` r n:P 0o0 P N{?0 =0?0? 0?0?0+>0?0? 0?$0Ye* *>(0?,0/?PU0S w6PMo*L L p'81?L6X,7 #S SN/S-o4 (6P#0S D"R0S ?6P00S d"R,0S `"R 0S L"R L4p Pr-ލNmCNNDO0@-PA-pM.@PP'  PcPX 3:`P`00 P0S8LV0 P@UЍ$XPQG- @p RR 3R 0G?VH 0@DPP@D( 0`P` Vp^o^80 0S/0S/P/P@- P@-@ >  xp@-@ M tEPP I03 0`3VP  G ЍpP8@-PP@,@ P@ 08 Q0p@-PXMSC0S@`@T 20 0C[0S0 P0S@J 0 `a R `PU,QJ0P000000Q 0  B R 2XЍp@-PL`@pD00S p2&W`` @ Q@-`pPu@ F PpD K I  0ݣPR`QP0@-0SJ80,00(04$04 03@Yg<8,*|:QBQ@-,@0SJ00@8uZQ@-,@0SI00@0)sQ@-P@0SI<00,04(04$03 0(3@(QQ QQG-@P`P 62P00pX *2Pppp W EPp@-P@u0 0p@,p@-P@0 0p@8p@-P@0 0p@0p@-P@0 0p@(P8@-P@ <X8=,0 0P8  K8,P8@-P@ <>8@,0 0P8 188P8@-P@ <#86,0 0P8  80P8@-P@ < 8-,0 0P8  8(p@-P@0SpIP4@00p@4 Qp@-P@0 0p@4@-Pp@/p`Pp pIP/00 0@80/000S 9P  0007@-P@.0S) S & @P"S S S S S S  S S   M0S 0PS>%R@- @ P#ꔾľ̾Ծܾl@h@d@`@\@X@T@ P@ L@H@D@@@8CQ#|EGQQ RRRRP P /<R@-rP`@ !l0P `@@q$<(`<pL"4 D00"@-0 UDR@-0Yh< NDR@-0 GD @-CDRp@-`P @H0m0P h0P c0P UP0PP0PP$:P UUPP 5;P0 UUPP  ';P0000Ppp M@-@M P 0 CЍSX MRG-@MP!C / 0P p0P `0PJ/3pP00 z`P30 S0 0W07   `FC000S0P  ^P%0S㲐 "<<,!44 c 0 S0R đ W V/00 804 |CЍ`6SqSp MSR@-@$$ hC$P0 `C6S MS7@-@0PS  QL00S>7@-@0PS  @L00S>E-Ppp/P`` F@P +/@-0  08@蛡ꬕ8@-@00S P| x0PtplPl0@Pz/00TH04T8,0 080#.Q}T@@-@x0P00CS `< < <Ǔ( $忓0 <TETO-0MC @X30T3P3D0 09)489\CHC<89 )9 ?0/0?09 090?090?05> 0?$0?(06>,0h9007>⡏P =t H@ <p AD l :H  Qh 30L0 d; `喴@08ʛ@ᨆPYi) PB|8 1 0" \#R4HH8yP@  08 & 8  D88孠7@0S   =0@0 @.D(R<D7@`@p9 t70@0 ,H3#,,<!$42 SH3 0H3 40\ 01@P(厑<L\ M10S  @u1XcWaS_@PL8 00S  Yj* @8`SPpP 30S A8+[5P C0X  pP t1  -+ s }8' 7p 00AS񟗨,\20S G Pm20S 26Z   *X  *W$ X 0Z8#RZF  044 8 <Q :Z 043 0Q +X)Z' 4pP P  *43#,,<!$4 S: Ss 10S P咏W  *400S$0 S(#< 000S zW P40P8 0\00S h% c00S HߍUzWD0TWDU/ W,WWWYk?.VWVX'X9XKX\XmX~XXT@-00Cs0S5PO-M <PP"C," 7PHw>P0$3 ;pA0@,R p 0 R`A@@H*V@`pA@C C pXW/0% PPL30 0 ߍ 1P U0  0S"!0 033>0 )04#lP ="!0 R3) pP% R 0 R YbPP P0 S0000    ;P =pP p 0S00A0PP ="!0 R3@ 0831>0?0/0:P3 4 0 P<340PP PP P!  @1>@ p  SC0   2.@00    H; P xj=pW@TpP5C 0 0cxS00BA0pPP2Xz\2G-@M@@P"`0$H2 V@2<"<  p<d@ 2p`a0 APs4 00"#̠,̌ $!Č<@ 0#?#@_TCͱQ; Xx5 \!0` T  + 0(#<"#T  *W"d Y  <~< 0 @ #p0T  $ >A$P @ЍXXLDYYhYp^o^VYbYQjYsYP/00S:/!,80@-,@#$ <<$Yl% !4T0C-@nT?,LaA-P@`0@3/Tv@pnG.P 7/P   ? 7/V` h h0̘PAT0 ", $ ", $ Y@- @:00p38@-@PV?>8@- @0P00F?@-@P$ `Dp 8: 0j  ЍpG- pXP PPS@PLP 0#0`0C S0l   <@ -P T @= '`PV`@8 yP@@.  rP@@&  C  C  CP440  C  C <(< "4 0@@t@3Tw `!`P1+0Ss00S 0 >`= 00  m&  0S P:0`70S @G0 Ym0= 0S0 0 0Q=00S 0  R! 000   0  ,&0   0 Z 0S R <>@Ѝ0 et , Y Y  0YYX0 0@-,L0 0$P@DPHPLT  R:00,@-@p` @0 PP$@%P `0,0V:P,@-0@D0H0L*T#3O-P@ppW 0S ` W 1 %P T d100 $0(<S41$ %$`,0X:0 ,`0 p ppQ`11$0 R:V( pZp (  R #( 0Cs0^S^00p0S c%T4@0T8$L0@ Y40Y8)0,s@-`P@0 00,PP g28 $, 8 0Po|Z A-8q@P-0* S( %l8Xl#d<dPPP T 0 $0(0,048<R*@P 0UT !P  04 8 P 0`` 0R  R/P0p@-`M@0S P ':000 孉ߍp0%[p@-@`0P0SL9=p8 P $0P00p3[][0@-PMl0T@0P  00 0$0@T=Ѝ0, k[p@-0@l`a/,R<+\ B@ \! R<@0  " R<@Yn30> PP RJ\Lwp4\@ 0(00Sp*p[[0[M0 PA0Q   0s0C(0sЍ/00@-@nP P!000R00S k 0P @ PGߍ* bO-@DMP -R -RQ 4R6R0S `P0S00S`twp2PQ@,4pT< 0P < `ݵP .pP  <@.( P*" "@PX-pP12Z *0PS( ۵P$0 L0 <0 ,0 !0 0  0,Yu3PX  =@PP P @t*X dX ,@$DЍcT cb  cZ,ccPFO-@`PPEMUPpZ0-SW0lS'`V$U3@P'000Cs0 S  )0S%.P4-,M@`Va[qS 0S PUpt'0-S l[p0oS U 0sS0SpPEPD.`pPE<l[D`Y$200140 S. (0 S+ Sp#'0-S0oS  0RpZ ( 0S  .` (0S pW(#  `PIU8-a[1`P=` 2u0PSpZ`- P P Z`x)pP]-pW0 Sp(0S P-ٶP @ X)`pW7c1cAcNcoccc0 0S4 05/@-@@D?T/0 0 /`@- ,   2c@-@,D0 00 00CS0? 0 0 S9@-@,0nS 0 000(54@-,00l5@- x,00\6@- q,006@-@i,  D7D0@- @1(Q卮Q@B8@-PPJ,D0@ 01 PP PU_;,HPL8T:E-P@pP `- 0Pp`P Z Z ZZVT /PYv    20pP R`0G-@0 Q,  $0 0cC1` U l+P+pF00  Y Ypp VpW `+P p` -@-0 000ЍЍ/-@-0 000xЍ Ѝ/8@-P +00@00S00 858@-P8+U@ 0Sp%00P0l*488;p@-`404P@ 0PcPPP  0P Pp@- 0 @v0 0c1O-@M0S7 T`UPP0 S S S7 SP` `V 51 V Ё 0  (1P0S SP0 S$ 0 00 T  0 ! 0P!% !aQP R0 !SR! R0 !0 "0} #Ѝh0@-@$T 0P  aSR!R\܀80@-0  P Jh0@-@$T 0P  aSR!R-܀ch0@-@$T 0P  aSR!R܀c@-P0`u0@0 0P !PЍ@-l0@H\` 0PH D0P  R0"cc 00@-,M"P!! (1@H2 0hP$ 0tS$ 0#5H 0XPH 0QP H 0Yw JPH 0CP @! 0 0 0! fQ" B@TP$~,Ѝ0cccdd0C-@0M<0400000 0 P Ё SR`p` p! R0@  P!* H"* A0ЍЃ0@-$M@P `0O 0@| 0T0=ID0 MD“ 0X  0 pW `8(0 t $Ѝ?BddO-M(@8  d2HPL$j0t000000 00000 0P   `pa(0С ( S R@P @ P! R0` p8P Pa? a p@` (P01. "0$0!!`@8Td0 p d0 dP 0Sp1@P`%A 0%A V . P> S8 :80U(  4(0N0  .00DH  (H0IP  "PiX LJЍ#d<0@-@0  " <03/@TE-l$MP(2@2 020200l'0SD   *P0 0p3pG(@@pP`%90P>  `%Rw 0[S %S 0]S` 00As0 SQ P00@"1c113/P U@ @pp0S B(UD1P@0q1@1 00S 㑱`V aav6`ᄱpW  gR_' p0SqYx 0p S  0H ?֬b8a0S  PG6O@B $(dc X-D0gQ 0  $ бH2~7O-DMP( 200kS @P 0-SGp@0@ 800",,280$ q 2`P200kS v7<0S<18 q0 0<0Z1S 0S p!Q  㺘@H(0 SE PU hP0SQ C0C R*80S, S1<0S4 S+0S 00 0mP 0 00S40S000 S ( '&  M -@PX  @z3DЍWdD]dTG-0 @0"0rpp|pP O$00A%o oP`i0P Yh P0SpP'PZ % hdDldpdTFI- KM00"1 (p@$P P   K $ 00C S 0 ; 0 01@`,PK8w p0qd0'`K 0t0( `O ( `00Mh0P5Рቂ@PKvdD{d1@~dddO-pP 0-S 0nS0SPZ !Ĕ 1`P90-S Q P 0`S+ V+P  )"0S 'Z  0 0ၯ0SPg  ጳP ,s"P@TddddE-PpE`.00@.Z 冭PTp/0Yy 0@DT00A-hM @G0: S 2` `öPP` fP 0p.S0/S`J&PR%P%0@/W.  0pW1` ` =yP U 0`S&`apepA!㝵ᙵPpp100ST10 P0 DD @1"  $K0 7`-&=Xp!!`!00  0H0S 0 S`405:$ Vp `V`V%%%hЍHde7eUeZe1oeues@-@n0P 0Pa  P0PPk@#$P% t t0~PT# P@ P@P@P|eTHee!e 0 `/ 0S3/1/0`/ 0S3/1/@-p,@` PP03/P@T00  !P 0S`/" Qp@-@:$dPd`]V 00``v`P0` ץ.00 0K%000 0000peO-SMQPONo4! 0@.P! P M?0> 0 =`@1#5@1<1#5<181#58141#54101#501D1#5D10( 0 PP081M/0.0<1D!0c@1P@^<14K$P0p81PYP 041001 0@1 x4ttD0l40@@ S10R 8 X a`@@0Z c0S !Yz0 pPPc@ 0F,0b 8 0b 0 <Ba ) D a "( (Ha 0 0P`La ,0 D 00<0 L 0H0 0 0"80WRoPPfO .% iPPP "0h2DQ04x"t2R}Ϥ*H Z*`Ĥ1P<Pc1S<Q5uPPQ`u?c1q ᫤P%Q`F U*ᡤ@04 8C0 g@p[APF< *! 1'80 7!1'@1JU%% 00C0 P,0,0  !000J? 0101000,00 10$100 00 0 S0 a~00@9[Z<00  "#"Sߍ6deeeef f0fHmamfwf.dfgf fffp@-P@o`P p@`p@"@-@ 0n 00dO-Ms, `/  PL PE P> P7t P0\ P)D P", P P P @ P P@ PR 0PQR S0 T"IP2L H0\ 0PQR S0 !*  0R S 0! 0 ",ZK_0 ts#$ !D1X!0T10[-@$!- !)!%!!  Y{ $ ( , 0VHA0F 0}0 [ZX00   Ѝ6dcccdccD g$g/gd7gHAWgcgggg "(.4:@g@-@},"000O- M@P3 1cS/0F000 00(0 0000800 0?P` ؁آ 0a 0b 0 0 0У 0أ 0$ R 0 R0$ЍЏ0 A-AhPP hP0S- 1S! m!0P 2!P1011PS01Q!P /1` !p 1! pP`~1WARggO-P@pQ %`0`   00`[ \0! P00c0!01 0CQ00Pp0X\e!0\00`0O-0dM@E!PD004h(%帰$5$ L0P >j 5TPp P0 -R0P0PMpT`` L0 -R0L0L7`<  0K00p4P0l4T0h4X0?00`X070 0!X X0ST R>RT0S!0U# 0 0圑00( 0 ,      d 8  h0 x0,0,H L00( 0 0t00 h 0( L H   H  TP  \X    T\  $ T ( ` , =|PQ!!0U `0Sx.h0 \20 P2%L2X0!0U TT1OV`Vl  /_Y|D 1"PY _ P000P_0% RR 0qS_0N nS!P  mS\!P P!T P!X ,Q!  U hS RU%pS1P01T0 1tS0P00T00X0P sS \!P3 0\0`0_0rS  " cS1S 0S1 1     0100s030, dЍ Dg36  NalLLL|LgLLHi@-0  Uip@-`@xMT:hP p`嚭P'0@- p@ T0 R Fph L%tt ㌊pX up3 @000S 0xЍpiliiiii@-@t0/00    0 8@-P9@P0 p8i@-@RDM0S `P R pl H2<Q CP$pP0S S S 90 40 /0S 0S S " 0 0 aTl1HQ  , 1`<', $&, 4000#,,<!$4400800 <  Ru d = 0>00?0`PP, ^`V l`BX0LQ DЍiijjj$j-j8jDjPjijcj~j0@-@S tP"0004 0SdSx@00@-,MY~ S1(01P 0@P jP @0(00@1u00 0 0S r+}p@ P#P0S  0S (%#v$0 |0PM 0S  000 @,0 0 0,Ѝ0jjjjjjiQ8@-@0g aQ 1Qe 2Qe pdQ hQ cQ@ iqQW oQI ,kQ `uQ xQ tQ YPLPJ0070SN0 0{0SH 0SE -B0S P R0060S pPE00 0S P9000K0 0G0SPP P P R P8@- 0 0ZUij@-FcMPlP u ;9 CAq@㧄l0 㢄46p,P1p500S 1: S 5 0 b0PP0T0X0P\PpXP3xpd ,pP  PDb/0P 1E500SS =A-@< p3<0S9 դp( ,㿥pP  Peb?P01E'PxB Ụ¢pX + 400SS A- h p h嫤@DZ0S 噤ltpoH劤|f0S d値X\2P0S L0SX0S 0S,0S $0S 0Y h1<&@0p1<'l0x1<'\ZZ"jha  P  k`PH v0SC 0V#1H00 000(00(0$0S  p 0$00$04p40ppcW)0S L0V1`<`pH00L0P0pT0`0T0P`0pcW)a@ P0S al P0S x00,0SY$ RVLPX RO |X0-+G(lljjXk kkzk#kBk7kjPkvkqkkkDkk6j,@-0  k@-0  kk|0@-0S@p@T@PP @00 00 ! XeHkkO-M۩P02^ "0 A S1`00PPpPB 0.S  3p (0: S'  Ҡ0[Z R  P UP~`0ا002~0R P0 0P"U a`0r0 R P 㓢0PE 0C02P0UЍ腵klk l"2O-MP 0 00a2B`'0P$ l寁1d0 pPP`ԅP0 "0P S 0bS.储p$ [ hP U ؇ YXa WV ͟p hPa؇H@(gp $ Ѐ P`Y[{ '`0P 0S |P P00S 0 2P ߡ0Z`'PT0 PoЍ zDlT< l5lOllXL 0@-@  n000P e @?0   dl0   klA-hM Tާp H100SP 4140CPA$0,`(#|V|<"tt 30S S ! 0pgV U00S 10dSx20S h U T10uSDhЍulllll%2l$j8j-jll@-`l@-xM np 000S@" 0@00@lp@l0啄P \0dd0H0PT0 t [p u@@t@3xЍmlmmj7m0 0 !@mEm0 0 1Emp@-` p@000S p*0xSHP `|V@ @pbmWmtm8@- p@000S 000xS@$@!W p@|t PIu U@ H@ 0 @00 8mmmmmm@-P@p00@` p T00P <P ( G nv@-@pf P0xS_AoS, : cS dS LuS xSS tS ERN 30S#R=R< R10dS6 $ 0a\!̠̌ Č#̠̌X<%ČY WV00R  R)20S&P# $R 0l!\#̠\̌< T!Č!SR10dS 00B @mO-0Md @ 0004T :PP6P / $4 0_4 a1V 0S DS 1 ?x!!ppd `400fSf TSh 1S:2S4DSu ESl xcS$ XSf aS dS& eSqSoS *hSg:iSkS buStS*rS5 sS YxSW`3V0SPx3 tc0L `` VTLP,3 8P03 (P `/30b쒟*P20 P2P2 Pl2Px20PbP@b<0.0Cs0S᭜p ᩜp4PY 9/p0 BpF 0000[VR  00c0;{6 0.0Cs0S~p zpx!6/P 0 R1:L1ZHq P 000 Z  0 pu0000[Y " C 1 ?!cPc#Ѝ褕GnMnZnanDgnTlnC%Xmn Cnx qknon |nnnnnnYnh0 n0 5n(0@-@0S +0,0oo(0@-@0S 0(0o o(0@-@0S  0$0o&o@- @$+o0 @- @ $BoG-A0 M@0000@8pP ,1P`PY 0@SP-0tSp   pPP  900P0S vX0S U`000S P 0@S p(\ ЍWosoooo@-M@ 0  !  0,", $ #,,<!$4 0@00>Ѝ8@-@$0s8000S X$@0$0(0s8L,P(:p \@(yțp ,P0(PP80P008ooo@-0S] 0S  dU0R0 0Dp PD|||100S  8 08@t0AR0^p 000SAxoApjd00T 08H0  Rp,p@pTXpupp1j@-`@"pp 0@-@$MS 2|1PP  %p :|0 0$0sa $ p l18P`pW \It0R0埡u0R0Qp p3?t0R0 0p s00`p Wy6p u0R0np ItDllǝp 0S T 9|尚p $Ѝpppq"q8qUqpTbq$0p@-@hMs 0S fP 8$勚p .08PQ0E0R00Su0R00S01`k00 n0St0S 4 bR140  `R 0SR|Y,P(͚p P(y[p , 1`0S   0Ap A-ˡp( (P,  0 (0 0d(i p e,0@p hЍpyqooqqqq^\2O-X@,MPp00$0S R:D` 0`cU`2P ,0-Pc 0SY 0R:TN$șp A000#0 0A:P 0@S P  P  wP0S 㼡0X0@S 00(pFzp 0S x 0R0 0 `V Q aS:,Ѝqr*rXror8@-t0@0S ddP X ^0 0 Q:k~0P8 Dor@-`M@/pƠp$ $!p<^2A-㳠p0 p ,N4@p 0Px4 P0 000!0V0P` P PP 4 P$400S  }| 03P@00S W P 3`P000eS ES +S -S !SD ONS( LsS tS' nS EH3\#0 L3LR 0CP0S00-~(~$~ ~P 2404 R   `R 4 0S RP VP P 00P(VpY `+ ! 0@0S0. 18PQ G R `;00>0SEp ` 0P @100S FHh 1@p 4 A-㲟p( (P, 0 P 0u( (ip 0S Vsp Ѝrr2kr@Brr Hx ` qqss^o's@s@-@`0p`P4@ 0X@`PpD0V:W Vs`s0O-00`0p2@l2Hp(0SP XPD0Y:0(0$0S 00S,0S 0,0> 0P0 0S 400cS0 040 cR0XD0[: Ŝ0Pe\1UPUP/  ᴜ@  +\ @ P RU 0S S e *$0S &% 00S S000080S 0 P @q^QP-@-  @-DR0 Q0 00@ l8iuWuru@-@`U0p0;PfPP@T%  20S   @=v d pW @=h7/00N?Pm0@0F``8}up@-@PPp,00   @Tp@8G-p@=`2`P`PgPP  sT ` `p00    nT0 =   e0 qGu8 @-`Y @pT0, P \ [00W 00080QA-P` @  0000`0pP P 3pu3UT ᝊPPPXP qPT T P Pr A\8uuE-P1p@10000@-S `Va1 $ ? S`= 6V P   * 0`0 0P 0000 00 00P` @$Z `80@-JM 00 0 10$1埈@P 00  1 0,0$!0  R 0S Jߍ8P8@-d@rET0@$Q@  1@0 18 Z0P  !88<@-@PB@A*}00 (0R  P 0/0@-@P P 0]0@-@0 <p@-P@ @0P0T0@0   0`0d0 0S '`@TZ 0@T@00000tp<8@-VPu0p@-@P000P [0` <00 '0Sp82G-`ᐢ@pP000P,0  TW00 S 0SY P0SA%A/P0S 0S 0001S0i00S@APt1q? U:h1W ,  0x030 1S 0PPbW1iWYQU P 9X40S Z 0S 0S `aPT0GXD0@S@T(0@8Ex$ d Q@-@͇$P 000S u0G-`00CS000   Pp@ tZ t Z Y  AJp0X0000GD<88@-P 0@0S8<@-L0P-DM8 UU` L Yu@-0 0@000000|00    B 0`PS sH s<qs4 ЍpPX8uu v0p@-`@0V~VP!~_3:hQd00   0PPP P000   `f`p4 8p@-Px@ p@9@-@ @:8@-P@0 @@88O- lM@P`*S?S [S0!P0\P0/PP ]P \S` /SRP `0SR10\S00 0ST sP^|1ZQ*0\S00L1TD 0T0/S, 00DPPA 10T/00D0Sppp0\S00# .0Y0.R0S ẏPW |0q  0Q0 /00qD0 0S lP ḎW/00FlЍ蠙58@-E   脙,p@-`R`@P P000PS p0-S0S0 0pV Y p.v0A-P`@T*<0Tp@ W& S# 00   0P`p0@p0 0     0S R A 0@@4 840p@-P@0`c00fS*p4G-`t @SPpZ Y > PP~00@DT0px8@-@P 8p@-@P p@@-`0@p   `b000܀xWPp  pS@ \S  SPR@ 0/S\00 000S00pptxQ008@-H0@P U030#P0S  884$0@-@0 0Q@4O-p0@P0ѓ09S0Sv*$S !S #S ~*S1 -S y?S @S% t222020P ^@x2@0T"  1 RP"@!  0S*}\ l2 0 0 ``X0S PP 10pW@h + UU@ 00VS U U@ h1X xuD1ZGPC10 P>P0@00a`W =d`a= !P  0kX  P `pWV`V  UU@  0 40U U$0  d @8<x 0G-@`P0p p 00 S 0P00XZ 0PV000cG4<A-PY  0@`Ap0Wpx0p`0`=0S 0 ,00c 0T:Ѝ`b8vG-pY @@0:SS %S `iJ0P0S: TP  0/  P X0 %R@@ @0:SS0:S@0@0Gu4@-@`pPPT 0(1 0Q@T 10S P0  0W 0 1S 0W00Q: 0pP00P00000H00VS 80@00 Uv8d$4X@-00S R R. 0-S+0 R' -R R R  :R R :P 0S@0 R00@,0 0 訙`v w8@-LP@P@$PP8w8@-D0@ PP  00RP 88t@-`x@P`h0PpfV P vV P 0S@P~`p@-aT00   @00P`VP`V@TX@lU@PP 0@H H0@ Q<0  ,P0Pp8^v|`@-p0@rT@@,pP 0P`V =pPp  "0S    `V 3[`X1G-pP@ 0%SJ0`S  PR+S%S -S TQ@P8PT5 +P W00P*0@@00$0Y& 0㘐?S0`P 09/P XhP@TX @Z 008 8@-P0S 40@04@5@ 0 088<G-Ph2 0 X2@0+S-SPP-S`0S -S R PuY{S90800Ss 0Y0`cRX`_oR;10pW 1P1P& XU\-+ U ,11,!(1\$ 11 Q-+ pq<W0 Q  !lRQ0,0 -RP0,00dQ01P 0SUT-+V R Rl8` Y% x2xxyy@-h0Q 0@0   G@P@$00S@ P8`@-.P00$0ST81p@-$0S K00@0S 0`V- 0S000``0%S 0PU !  0 B0S PfP0S 000`0Sp8`O-P(4@QM t 4`4 0$0#0  a ^T0@0 0cL3`0 30Sc 3pጃ0 030 0 0PS0l3P 00000B0S PP7 0S PU00 S Pp&0C2 Pp 0S00U*0Spp P t PZ PPp00U:X0S`0S p1p 1 0PB1p2X#PP 1`000 吁p] P <0W 7010S a0PEP00S P0 PU  +0` |0 R PUH0<0T8 0 R0 ЍXx48< 8t@-@30  #000CS)  000P  0S P0S 0000 @T$y5O-@PM0   : 40   p `P0P`SPV 4pP0   B `1 0PU   #X4Y?00H40P CR `V /P 0 00CSK  p!  !`PB5 :0S* p P0: S#A!`PhXP 0: S QP& QPS r00QAA!`PFBzP0S  0 P` o*` P#E~|zx 0S 0  "@P @1  aEw!`U   rP`C`jP  p  X VmaPU1 V Pu  O U I0SU 0`USP00S@T 00Y00S 00Ѝ<8u0y4xAyWykyxy0@-JM0 0 0 10$15v@P 0 0 T0 (0S y$1 00S 0S jJߍ8A-P`@V``;V 000S x00   > pP c@V@YhV 0AQ8@-_1\0 00 00 40 00$00 000Ѝ8,4@-P0  P x00@h00@@X0@0@ PD00)4@` <840 @-@ x00S 0  0Q~6000000(00 00 @T蜙,1P A-` Y* PPZPX@ P Pp L1 Pp p$1 D p0S0 S @@00UP PP0@0W@))`)`)((PV h0 X0 RPD00S z'VE0  @E-mM<0@? 0 ? Q  8 Q8/0 Q1 0 $00 0,000(0> 0 00bS P'P.*,**-62 .`.x.P/ +/D/00 0  PR0 =@0   =0S PP@YQ  R ~00( 0R0\T0S @l P9 t >p!c0 Br 1R@1p !0@pP@TxTP1p !00@s0 S a@pPPUvU 011  @0 0 EH@"T'T L \0t@0y1 P@0~  0 0 P<0S l80$P00S 0~  0 00\T00S $T`T  R"T 0~  0 0N P ~00 0@00h Rw0  b R 0SQ @( U 0 0 S 0 (0 R 0S0CA0|0)0@08$$ @$0S 0C@$0))P  R x00, ,0R   )0 0S&T>PFO&@1T @@ 0Sp  R 90QSH  R 94 0 9 00D9 `RP>Tpp>T<T >1T00Y) SRP\w80!8 0 e0  0080 b t8PQf 1T/@< R) P @0TU_O` P PU?UJ  P U00U?0 R P 0 S R h7L0   X7 p7 'U#0S` `WP 00E>P0) |P0& &P00'!>1T00401<P >P &P F0P0P-P0   00000P6V`P@6mߍP@{P(P _P 0a0Cs0S!0@S%23 'T (  $00(T(P p}0{T05000#P@P}P @ PT_T 0a0Cs0SP(_P p00 Cr R 0a0Cs0St00 Cr R 00@s0 S !@DT$2D 0h U``}P`@V=U6%T #T /T% :T y:P$P@ 00@s0 S`6` P`ȃqP hxPPP]PPuP ` U/P`P ` P R0S `<3Upj`00`V  R0SM I 2@ 040qP 2  20t20   2P0@@S 5 T20 !@   QX $20`10S `PP@  P/ \P 5<@S2! PP l10   `10S `P\P $P  0r03"P0S \`U040 0 00   0 0Y< `000P c^`5P`V 0Qp<0p` `R 0p P q뼕PltyyyT, yty@4t80` 0S 00 80P0S1PS  Pp00   01i04!00  R0S z00U{0 0 Q00S0I0y  Q  0  00, 0: 0 00, 00PK1p@- R 1p|10S h10 `1 P P@ 1P #P P  P\P P 50 000 000S  P` P00   0 0 PҸ`P PeUPP` >U&T L0`cH0$0p&@ 0p@X@Plttt@-0@0@T T"00S00 0DP p0@cl0DA@L00 D0P 0S 0   T  1A-@P I0S-0`00S000pP TP TP < P @TOPڔ#|0 @000 0S`0CS<0 APAP Ty@-q 0 01@ X P@-H <0@@[PP 0@5@l0@-M@  40PUpP~ 0Ѝ00 4PA-M@0 0,1   qoP  (0S ,Gr0@TY<@H@|@@@AAAtA@@@@P@@X@AT3EP3L3A83@@t@3 q0@P 2@%n21 R  @ 22@D0 Ax200s03SS p2@T000 K@3/G,2 R> 2@T  20 0S0@1@*0@00A0qPP0apV1 p@ 1pP_0PS00(A@@ @01@@0,!0 0`@1   "0p$0S $@Pp0S 00 00p03U  RS p0P`P@AU0 ,0 0 R 0S ލ8\R_su<%\r0?\hLpO-M  0 @%P0  5@%00I P0S 00 ~R` ;W9 /W :W W W/ pW  0ScAP Y 0S 4 pDp0 cK 0  0 @cpd4`4p0pc  `V 03V0SZ    0x03R0Si Y  c p:V @ =V V @@D0@P000t~Sx 0FSFGIGG`EHxFX0 P 0S S0S -@x3 R@Dpp @`200V0 020   \2pX20 c Zp )  00 qP _  PP F1 Y) 01 1 p0 W  0D  PZW F<11!0 0Rr P V c 0 0@Dp`00F`F`F0S`pgd0`0S  3[."Z  zЍtttt4xtX80yO-00S 0 R  BR  R  BR  h0 R0 0s03S <0P,00S0  B 0Pp\0E-QM 0Iύ1 0010<1xj@P%10    8!  1@1P @ 0`001   0B 0000000 001`000 11p  B ;%X   . K0$0 S Z =²:/0500 00/`0PUz8(A-PQ1@000 0 {P UtM`P UT(L@;`P0000 00S S S+pW :pWZU V 00U U 0x00X0h0>U D985Ѝ<Szgznz8zzzzzzO0p@-S 0-SP` P`a@v@Pp@-@VP@ vP@8OPT $00P D@Zz`G-l<@P /T100SH1PFp<1H600 00015(6 0 0~?0? 000W'5%0   S5|5'-501Yf@P/ x5@@p5@l50@ @^\5@T5@r5A (0S8ST< 4Q9  R6S5*{T T T %4P00K4$  gP\4$0 L4P@W_j00@@TX4@=\P  @T PUg2 K@P 0/SnPFnP ͍ AQP L΍QP @{,3 0000S1  HC00P @2 0RPU  7 2"`408<SųP P040X205 R4 5  <201 Q1R0U 2 0 0S 1070SH1 00 "01 0   @Y0 Q)p1@40S `P P !P X00-S0,010,0S 0\10P1010040S ,Y0P 0S 0100 R 70S0 0 X00sH007 R R 40S 4P(00G"84< 4H0\@ zqdu`8 Tzz{{{G-0M0@P񟗏nn|l|l|l|l|lXn|l|l|l|ll|l|l|l|l|l|lkj|l|ltktknr0@0HaP `?`0 P05NP`.GP 60S$ 0 05 PL >5@0S 0 00G(PP50SePp" 0@00 0P5PPP 0050050 0PP 000040SS 004040SS4  4 P~P 0@0Pp00$400$40 04 P 30SZ`3 P1 30 SP 0`0 0 x#  x# P``830 Sy`p03 P P !00 P0@0ZPU@`2@ pP ```%2`0@S`o o`p`pnn`poVV X2PT"42S0@02 P` P`1Y0 0 P@@p1@@P` 0S$ 0W!0S0S P Y3PtP tP 00 80 01 o50` `` ``@ 00000 0#P0 P 000PP T0 000S 0S @@0000Ѝ@T{ ,t2{ |5{@- P0 0 pp  PP@ 0`0@P\0 P P@P 00P(0 W 0( @E-,M@pP( P!$1P@7P2 0 ` 0 0000 7 0R0` 0`00  l` Vd00S   PU@T ,00S ,ЍxX40p@-MP `x0  #0@# z00S4@T0`@0@0@  0 R R|  BR  R P  BR @T 0  B Ѝp0\O-u`<0 1PVx`` P} @0p@-`0P@嗾P P@Tp@-p@-P@Y0`傾P @T@p(@-@.P< @h  G-`=PᠥP 1e0lpl@@ SPp@80S T<v0=000 S *00100 @0S`p 1P X /X:ӥ0 0T0@0PV`Z0 PR0SSPvG}@-@Fb @}0 @-W @w!@-`P@PP=pP 00=0P00   PP[@P@-d1A-@0S p`P 00S 0S 1S 0S U`P`0iS`` P0P 0S x 0U  PAU` AbL0@-00@ 404^ (0 @T3u}~@-@`Pp=ᎤP+PtP 00TP @3(v 0S\8 @-0 R ~E-00@1 000QS0p0`p`V,[P` 0""`0VP)0pW 0Si`0`S+0`p ռ  ᘼ 0 ` R H 0@ R  ,  0 B200(0-~,2PO-@`2`p zcPx 0 Su r P QY3T9<ŠZ04Q AAS000SRdUH k>` $0S `v`300 00 00  bR R S3 10S. 0 S0P"œ\ 0SPU 0Q 0000CS00S HD 0\00 00 09~~8@-j@$0P,0S \<88@-@P@娏NE R (0 @T t8 A~ 6@-@<@0P,0S 0P,Td[<8@-@PP  38000PS#0S 8g~@0 @-0<q ( H< @y~` 0@-@` RH 80 080p\080`0S\05~ 0 08 8@-@P  00P000S0?}P8A-PP1 00lpl@*` ]P!0=S0S 00U0 PR0SS* 0S20p@T}A-@p` P@"0Ppq@(P@vX 00 P PX~~Ts@-`9aPP A0%0!,0@#@@P0PE@at3|~~@-\Q0 \R0 R 0p@-P@P 0=pDĺP<00 ,强Pp0p@qd~A-PpP `:g@X  0P `YP pW}p`LxY& p@-@`PPl PPX  PPD` 0塏X@Pp!28@-P0'S '̡@ e刏0PS80H0S 0 S" 3 405:"#"㇜0H0S 0 S' 3 405:''v0'S P0H0S 0 S" 3 405:""b0S8<O-`1@0SAPPP01S |30;`+PAUN Q@10X-p㜠`";@P `0똰Y  X &Yʔ0 9 +p R ^ 0Rl` -QX0 -X R 0P`C8Ls@-@wp0 AT&0PU) =㽠`P g 岎0H0S 0 S 3 405: O 㳛@pWS Tp@-PP PPl0@T0UL0S`X0`/VT X0 eT ! ppPG-@PPP1S``XpQEPb0FQAZ L@D`VZ @-`@T ,10l@墌@T@PPP 0-S+S PP*PQ@T'0@L0X`SpP0L0V0`0 0X0!RT0@-   { @-@ R؁Q 2p@-@P` `0 P0P pp@-@Y<Pጸ p@8@-@ 0PS \屟P 0\ 0000 P 008p@-@d`ᔟPPU 0\ 0000 ` 00p8@-@P0 P 008@-@0P`S0ppqC@0A0j` 0@00ppqC00q0@-0$M @000000000pP h0h0A!0 P000000 00 P <$Ѝ0TwdmC@-@H P@!,00 R@0@cO$ET1#@-@00 \iW}8@-@P800P,0S 0P,ϥ 0A-@`PS&AGPpp W0`pPX \   0  00U@-@R @68@-P@P 0S0S0S 0000 8p@-@P P P0$0000(0 S S S S Sps00S S000S000 S0000p@@-@$ X@0@-@MPSB 0S?`V> `0 \R R 0*R[R5 ?R3 0 R00c0"QaQ 0S R `b``;0PS`PЍp ᇶ 0`P 8@-P@p @T80@-@S P  R0S0H RY)   R4 5:P p0000000-@- 000S>@Ѝ/@-00/@-`P03/pp `P\P03/p@`$P`P \P pA-P@p03/p`N (Pp )P pW ZX03/)P03/'V 03/p''P/ "V 03/p`" "P \P03/``V \V03/p)G-@0P3/ p 0a0C`s0WppS03/`yv03/p00 Cr R 0a0Cs0S_P03/p`00@s0 S 03/PVS*P $P#P!P (P` ?P@P_P~ {P03/403/}P`h Z #P> 00@s0 S703/}P᚜P0X.Y 00Fs0 S 'v00 Cr R" 0a0Cs0S_V Z#0FST!3 R XX p03/03/(P 03/+ `q 03/03/p00@s0 S8 a@pP3$oPv@-@Pp03/P`0S 00# 0p"t P1 03/\VpP 03/ PS$VP`V c`KZ=V0SSP00Y* 0G-P@pSP `V 0 R0S 0   0 00SS0S000000S SP00s0SpXm Xk Xi 0S`Ԓb ;P ` VSVQ 0 S X 0S 0S t;0000\b $rp00 p0 R3 00p00S 00000a   0 `  00M\޳P0 00S N20S 0SS0 0Q@PP S Q wt`0SQ0Pp^0 SXP{ P !\ |-p@-0  0 KO-M`P @`H:p000&0d d0PdT:d0P PK03/pU)V( `pPV0S(0S90  B _ Pp 03/p$00Sd0St0S )W;W L90dWP < 8 P90dJPZ`|0SS=X`P0Px `sP Xq$00S,0S Ua pVpO`I0SE0@00 0 00 0姲0@0 ƲP 0@0S "@ xD03/ 0 P00S P q@ ` @c03/ P `LPE000`V p0WUZpY? ` P;|P}X$0 Rn Rk0Shd0Set0Sb 0 R;(0S8V00V0S1 ;0V0U0S+ )V ,0St0S#`$PPU U` PN ,0|PS 80S 50  B XY<X >X-`  P,>W 03/ `  P<W03/P >W 03/ 0*|0S(0S0|0)X $X@ "XP #X 'X< &X} `XQ ;X\ \X |X }X {X d0S 03/p Pn 03/`Dfw03/ Pp[ ` r o0t0Q`0t003/p'E'PA `<0`t0|0" Sl00#l0`pIF1@$p`P903/;P 03/,0S040 0,00|0 `Pl&W03/`P\,0S |W03/,0S $00Sd0St0S (X$p%t0SYd0S `P20SN 0S(&03/ P P )P03/ P P P {P0 003/ P P P }P ,0Sw qP0 pU PW`{;V H00  B 0p0uЍ0) 0Ppw giw{0G-Pp@dtP` 0S0S f\Q0?S*S [S [Y@0S Qdpb@Y?8@-@T<P4@@OPP {8y85l1s@-@P0S P0`  (0R `V$C yP 0` 0S `V00fS,0S l0 "0 SP P`QP `000S @ 00fS*|ŀʀ 00@-M  DP000 @70  @rP @T$%PPxp0P@P`   &zO(0  fVЍ0ev@-`@?0S V PU1S=O- PuP$ QpPzUpU V W1SOu X 0sᳯ@T 86O-P4M 6@0000`00 0V 0S 0S 0`S3 0S%0`PpU 0S) P    P0`` 00`P` kPIp`qp$,00WpY V`` 2 P 0SlP0H`0C0 mPT[Y~ Y  4R0S  `d `Pp>/pY,03/p`M0,0⌠0l]<0 00<0000` R 1 :0S 00 0S 0Y0C`00<0N댠WY* = j  Zi,0 l p  l0R d0SY$0S `v`300C0ppv ㊲$  Z( `$D7P 1I$0S0S ZE SP 0S ,0S c@T  0S lLUP 8R($PY_P 0S  0S G1M   0S0000S 00Z 00Z(+$p0Z0S0``0C04Ѝ P h 5v4O-PMp@000(0 SS R ( R S R 00C0pW$0H` 0$040S(0CQZ``S RV R  V R S P   W  S`H`  CRS$X0( R0PH`X R  M 0 0  S S S 0XS&Y 0 p0``e  V0 P  R `p xP`p qSWl R Rbe 8  0p 0 H`80P Z \  BR\ 8 \ R PP=X< R%9 Q 0o$ 0R0`$Q Q  0 `0!`R0H` SSpR ( R SV `H`SV00 PU$0Z 0C$0`00C`0 00C0Ѝ PT !P0A-p`P@Y)  PUH@0SP$@- M@k ЍO-M@`0`  60 f ᎓ 00 00@S7 *S 1 !S S #S $S ?S +S @S `Sx 7070P 70H0S70TP@4`p7`X00S 0   !0  0 ;X0 R 00S  X0 R p \QppX0p ;T0W X0pͫ 'X00S d0Q u 006`Pÿ5"@@l,@0 $0ƿ @ፓP⾿PU|w H=K p«8?@ c Xp pG ,W @T03/p ~ p<00H0 `0 04`P x x04|0|40D10S0SP$P\`D 0ᭀ`` 0#S0pP ڒ0X Z p P :XppPW   P000Cs0 S 1@30T PX0`a $`U V  p`fZ pc  #R00#R%R&VX S  #R Q2 0SP2P20 0p3/U`8P`P4Vp W ppwp3+Qp'W&  ?R "0S 2=Q`00pCwp#S Wpp `!p   `Y<p 0 V P0  0 Pp V Po PO 0S000`㎑P0S  U0S0I0  ЍPH0hX`ppvEx Ԗd ' .V#V  0A 0@P NVCV  0xA@P @ P0S0SS S0S d 0z 03/V 0 3V 0@P@,ЍS`0S 4 j`U ꂄQN, mC@- @D Dj>$뺄@-@ 0sj`@- >jpɄO-aM  fjp *2jP; ip 妶0@@x jph<1p0 00PS P: gP# @ T@#T|Z0U @Q0;0S d   ᩢ  ᤢ0 0@ 0pl0@c͢@ T寺0Si2 GENAք d>@-: 0ip@-P000Cs0 S@p@^Pp@QpA-@-C4 Y% 0fP  :iP p` `0.SS  Sp  pP.00P %p00a1S 0 R R0S  h0 P@P>@{ PTw0S0 hgKD Qe nTmC G0@-tMn  P0t0Ἁdٹ@P l  @wH & n P .AtЍ0O- lM`Px20 , h2@P0S' (6 hpD P0`pW  ᜡP00 p(hp x`c ᎡP0 Pf е1@0S VG`T0S% T`A!IP`P@@ TH աEKHP0|0: S000\00 0S.  R+  R(`V! |`FM M p 0vV `F |0 v R00?0S S 0   S  R@0^ s0 0 0S 0 00R acP:00Sf ?sX0@$0s Pf$p  f(p  0kf@0r  DH< GENAυօ܅X0@-@|Mٵ|0Ppl00t0h00 \᷷ (GP0l 00[$d;|Ѝ0݆HmC2A-HMP@D D01@01<0<00000 000@01#l<AW1D`q㮲1qS@@04 `偵P,D!D1@P?Pf`@኶P㄁`"P@00ȡP#00  uP(0S2S2tS S S2S| St p`W \AP`pHЍ4PHTsqچ+9FM@-y;!1s@-  0@  .@P/   &@0 S900S40P Y @Pd囲 @ ` V0<S@ `@0T V |[Dag0\ R0/p@-@P 0dd S0p@8@-P@J0PPPP8O-[Mp`  `4pG☔@00-Sw|4 :+ +P $ZjWh0SF S SY S00U JS S3 EdS7  SLI S@F ;eS1 hS3 6# #$ #(#,%## #####00000# #$ #8 Ss0 3( R@phaW $@PpG`WXx ݴF `2`wz dp`<坝PdP ~P ᚝0S Cr RR Q"R "S0X"S !1P`1SJ B` rPF  dP5       <  0L0 00000{}!0l  p  t  x |  d h0j}0 @Q0 @  0 0  0eP  @01 l0T  e[ߍOP ]bopj D ^"2E-@M 2`P0: S 絰p 1@ᳲp0Px!0Q| 01t0 rrG 1垲0p0 h1dP唲\qx0S00 0(1凲P|0U:I 1~ QpV-xPt0Tqq Ppp P哰 0U0ZS Y qJpWZ`|0V:L!pЍ'}DTˆ H @#{, :lP@008 ,40P/0 ,0P/҉1US/P/!40!8!0/0 84 0 / @-@0/ @-@  Q0S'@-@P 0S0S0S0S0S0S 0S 0SPp3O-p1QP @0\0#0"j 0ja0000 e1p4[ 0 {4 PU!PE" t4 4 0k4 1?0040[00  Z4 P!J" T4 P4 M4 Q 40?Pt$P0P(:400, PQ  /E-\0@P`p 0"44@ 4 4E-P0@pn`0TPp0S WZPPp@`0T:O-P0@pn`0S SS S0000 I`pP0W:@- :@ 0A- @0``[dT77pP` P%p%4d!4 4`0P tp$0h p 0S`3<pj 0o@BۉDW,00( R/$ Q/80S/o{A-`qW@Pe@DW3tP0Pp@p0P T  1T o1@T 0!Y0 S:P@0U: ЍA귋1O-@,M`P0Sf 00s03Q0S_0 0p0$ 0? )00)0 0@$0 S A$0? L @T 0Y0Z po 0ko$ 0fo$0 S 0  0[0W0X hSo  0LNoH 0Io00CW 0X ?o,ЍƋ $:p4oꠌ0@-@0S 0S $0SP$o0S@o 0S0o$0S omˌ1O-$Mp`$0^ P0 0njm*X@@T# ? 0  ?  T n0S  pP0W$Ѝ"[(0@-@00S {hA;NP/ U1G-`@PP*zvPT(0SS S <0T000T$0\0N@0 P0T  S R @D0T&0C0 (T D Z*j  (0S |jV  \a\0:0:pW0`pGpn``PF(F@00T``T$ GH0@-0 "? 0QP Ѝd Ѝ8@-P d0@0^_0P\0CP0x! R x!000 @r R8@-@P 0003O- $M@0100M pMPP ` } , (P ,0S| SSy Sw (%( n0P* m0 80 ?0 0C40 0 4Y  0##00  < @ m@< 0R:|  @ m@ 04Q:X  m$0X:@  m$080 P  S R  8 00m0 0@ @00b Q:QQQ : pm P1 Ra a0@( T0@(0,P0(0 , 0(Qq\0S0 <0 C#Z঎@( P  RUS 5m !\0R:1( S<  'mP0U 0 $0Y Dm R 4m KЍ0cˎVO-4M2@P͗`P P0U00Cs0 S`V`l"h塮lr/( ,``V| pPxzP Q * V0pR0$0  Q p!$$ ᕗ0!0S@p 00Cs0 S000~!P0 p00~, P0`(00 0 0L!plY  Y*?,0S / 0UPE000p 0PUPEpP R+0 0 0$ 0 00(xP hl0Xz(PP 44ЍOj4Ѝn[Nޏ@-|jxjtjpjljhjdj`j\jXjTjPjLjHjDj@@j 5Jnߐ<]z0p@-0( R$(*@R d*<*R d*P*R d*0T#(*R $*UU$j  厭@@0P0T0[j,Yj<_ 0厬P"ۑ-|6G-PM@00/>Ao 0  URp` ppU 60Y =P =PUq k^, P U\_0S h 7P00 Q \k0 0 $00X0T0P0L0p7P0T0 0X0P! ?0 R  X0 ?0P\ 0  0 ^L P0D0SL0ST0S00H0SP0SX0S?0 0$ P7P$4+ SR S 0 0` 97P000`00040 `S 00 0.P$@0$0PPUPLvinp` 00SS S0S j@stP@`V0T00Cs0 S @D im`d uPVߍpO-Q0#03`Q0pS`"`2P,M0$0P 0$PKi0"P$20^/y x!200 Cr S R-S +S-S-S+S6 帰 @ 0  0@0Cq QMS @ GS KS; CSgS cS kS mS -,0S 0 $"\` ꃰ@@000 0 Br RT hP00P03SKg,Ѝ ? !0 ! :* 0ء 0 0/ @Bʚ;7O\07@- @00JTP@ ,0 05#:0Sh>ev0A-Pp@`n` P HPT@p`W:T0h(@fAX5O- MM@0( @"*,! < B#Z0100MM,1 0! S 0S Qh4 0Xp,0S``V 0`$0\0`FS < 1<00I\0p```F,0SP ,0S@  + 0P0Ys0#IK1h0.p4!  PH1 01U0 PX UU3YPPUH1;  U 3 "R g0 # U  R ,0Sp  081 E+81p@+ I?KY 00U,0S 0@Q10 # QYpPX  0H"0c :\S0 :0SP04! U*V`A"U*V`A"0 SUeX00Caa,0Sp  * p*W% 0L!IKg,0S p  * p* I?K00,0pS 0pGWp( 0X0 H# H *0(!RR R0S0H0 0,01 S8 0@0SzxS P 0 㿧 kA0@s0S pa0@S`==(>l>FFFF>FF>F>???F=?@(A0A8A(0S+0`@#Z0SS S0S =f0S0000F&0(:(0S 400cS400 000dPh1P,: :00s03R0@* R0T* R0S0;S \0S\ ǟP7^' 0f pPPPPllP\0S eeP\0SP]bZleUR )pPI 0@#jpWY XP@ \lQLQ ӣPPdZZ  Z  0SS0 S00SlfZ z20 He0E%0(:,00s03,0teuW 㶦bA0@s0S pa@P<8AABBCC8AE8A`F`F`F`F`F8AEE= F`F`FPFXF`F8A(P`Z PpW P WW W-e4 I 00 zpgW g0(:4&00$(0$@S L妎pdP`U ddUP 2`P0V:U )p %0Wh(0S c(P`<P \`0@% pF&*: :* Z V R0(:(:\P_ PP#0E(C) j zVPE zE* j 4g . -f '\ a#\ a0P00CU#J'J(jZ z  Y     g k0AZ> 0 CR0>1,00D3 ㅥ|L1? 00 40 HS bk+ bbbbbbbbbbb}b{bdЍjDvTȖ:}ח!C Dbř  >fʚߐzp@-P@`T @ vP :+P@Pp/bpY@-@ 㲥40a"00rQ0K2 0hmC1/!0,! 0/!0,! 0/D00L BQL/ !L R/ / !8@-0@ P @ᷤ0 0 8 㮤 Q^c붤00H R  R4 5 :sopTl0 0  P yP@ nP T <a4@a0 0 8H8@-@PP t0 >P:Q00PL%88D,@ c8P 0088Şў0@-@0 00p@-@P`5 0PH00S bjP0@0#n@a2P, pblUP @a&H 00s0S000H0  B p$*X8@-P@p88@-P@p008h1p@-P`@40040D00S,00,0:<P, b 10 P00 <: S000  S 00 0  S(00(0  S$00$0 S00000  S  S ` TbD 00s0S0p8`00D A  p`H@-@ 0 0S mŠmC-%M M00?៣+v P Ѝۍ@-`PP @%0@㊣+a P @0 <<p<0b00+ Ѝ@蜌 Ѝ ޟh0p@-`M@ P0S8004஌P@@D@ `@Vۍps@-PP`! 0@> U: R00U:X5`0%09Y + P <  0a00|ޟ @-00pP H0`Q^n@@T0S @-00pP H0`^n@g@T0S @-P= 0@>0P7D00S380@`0: S SPp S%pW480<0`P NP{$PU0S ]Q@-M Md1@N@AT814P2LD1T*8`P<HDp$00!4`S #p0T0!4PS `00!4@S  Ѝۍ@-00$pP H0`Q^n@@T0S @-P: 0@>0P4D00S080@p0: S S`P S"PU00pP nNPhPU0S Q@-M M0n@3@A0 T*dP`LD\p:00!R4PS q`( 0 0!?4@S ^ Ѝۍ`0@- N 1R+0101000㚡+J P =\ 8@-0@L R  @Q/   J`L0000L  L 8gl2O-@@800: S D 0S*,_00. y{('{ `0 |0pp0PWU  0_HPP 0PY 0G U 0U80 E#` `XV  0<00.S0S5 _000X V VP& _00V k00   0v_ ||0*x R  l_0: Si00X:Tc~ڠHiHl2O-@@800: S D 0S*,;_00. y{('{ ` 0 |0pp0PWU  0_PP 0P0G 7U 0U80 E"`a`pXV  0<00.S0S5 ^000X V ᬉP& ^00V 00   0^ ||0*x R  ^0: Si,00X:Tc~ڠHiH< E-\MP <@0/ 0005 <0,P0x^Ģf$$:lsIE[pA-PA0@` AE Y'0 0 0'Q0\@@ #\# !Q 0'@\p@p @  Q0R  0As0SS 0\@'@ @@`Q'00HE-@1pMP`0t1  l1\10 0 0 060 06p, ?P:P 00P  0Z 020S P0 Z lP 0:S00Pg|ZT00dZ00X@Z$ 0S ݛЍHXTLwGG-`MP@```@UP Xp-WPpp p2l @ nn0 E 008"424 0"02 0000 09Q5oW``-`2S(P @0:SP 00S:S@ 0P0|弘 ~ 2 p $`4oX0S `ԄP τP ʄP ńP0 )  0S  0S00t00 AaS010 Ѝ H6L=9DLQ6marTE-p`Y 2@0PUC0P0 RkPhX20CS0eSp20fST2 ꀘ0#SS  7PV0nS1A 0sS1!1: 0 0vS0 0 RSP ῧP0SThd1U0q1@!SPpG6 ИP2@00 Cr R 0a0Cs0S@0 S 0 Cr R 0a0Cs0S dP0H0S 0 S 5 405:if`P@kVP L T +)0@-4MP@d4Ѝ0p@-HMH 00"11~P@@ 1;P<01P8DU@2@ 0828"04202U(2(0 "2+U'U102!0101`  *GpPR`0SKߜ0`S S$ 0P  T40St 4)GdT<0SP < G@TD0S, DG TP  TX\ TTV  TL P0T@TڈЍ/Y>cȭҭ{E*wp|v0JOrmyOQeцBJTʮ_'6ٮO-EMC/ :P`@ P&@PPPP 3  @3  3   3   3   1 xP FFph 8 X0; ; 00 | 00000000HT0S (tF?T0S kF6TX P 0EPZ0p`Sذܐ導x $PF刋娋 0\P T@F<28"80420020,2T$ 0E` 0E 0E0p E0J0ZɒP 0pS1U:N: P Ep`園D,0P$ 000030\0 0d00`00h0Y?0l00(0SD0S $ESL0S LEST0S TESҏ P I ۔ E ֔ є1Bįoh8vR}(A-p@ D~@1@0%5@@`PPl `/-YY< Pc 0P@S0S00 (0\Pڰ0 RP0 R4P30 S S+$SP=c`P @J@P V|=00p@ 0 0 0@P-U 0S <|$0S P0 倔`VP@=0As0S@J c @cT10S 0S00@%R0@ R`{P {T { P`00%S00@ PQ @ 0@a @DdP 00P 0SV@ cP l ᮓ#P2c P ``TP /SdPP 00 t/000SPP@ናP[1P.0崀 0kP 100S tᅏl1 Q0 RHi! T >QZ!V  ϑ0 ɑL JpR 953[ T  >R!!&YЍNZ`h`wjZ!@-@`"{p@H{P WP1P#UbP<NG-PpMPV@6!IP( zPP$ 0t.S #&0*T 00P 8#4"420v00"2@nx ÓP当1UX,嵓`宓PP >p  㨓PPp00h0@0 S  zP } upWX!0OYV40Y.V) Y) pԐ㳑`ΐ!p@pW ӒPp!p ᡒP  U MtHpЍN5вN&4@au8@-P@U8 0 P/0C/ @-`@0P0 0p̐ Ѝ@A-`@P py!y0 3!b10@̠p\wpAyO-0CMH*@0<:<08: <000000 $0A?    ( , 0 4 8 < 9Pa໐ 0: S 90  P 凍P 65% ;@ P`0p QP $90  r00 0J e!uk(0WVY+0WVZZ80QWVKJA+D R D l1  XX0H <I U(5i3: TX⩐ J  0`QP;R2Pm H 0d 2dH h0 0q0HPS: S 0`0X`lh Yp  PP!H\KPlp00D05QD0 \2 0QPa0:V e,NH`p0d X 0 HTh  ,0 P0 0 $p(pNX 6 D0PD0  N5` V: F50\ J0XL0`5X H35\1 0T0d0 P0( p$pT 0@0L%0P3D ( \  H3d0` `!0@ThD׍Pԍwq xY3 ptҏPX\ gD 0` 0 `| Px h0d儐A3 Pdp0Hh U 0 00q0 0` 0C0 l0bPQbb0i. 0 H0ἐ  b0c   0dlh x g dlh U:PX`က儐X P# P 0z03 T0HS$L  <#; 0 0 !t0P Z:P Xpw ;|  0`\V:p W`3:1T 04\00  @10 0(  `` 040(0 $00 S 0 tp`0~ zwp\0 `o` V : 0`000-00 G0 0 `0`pG`\ ` R 0  0`q` _\ 0@0Cߍ<HDTHtֳESNJ1/!031/!031/p@-@Ph <4 @@D$aP 00`C^P0@S00T:@p0A-@1(pWWCnQ><40P0`PPPX00U*$aPX00U:,(0Q~pp0P(0Ui0@- ?M@P@P0 wPЍ0T0@-@00 S64H40R(,W0QK@MȦ%0@-@0?c+Ѝ@~O-0M4P0/;@0+00030; 000 u;`p , 0SY& 3 S 30000001PpW d/㞍` PPv04pሀpP᪯ʠ gP p 0HW^ppv0/S 0C50 Rh 90S x400Sh40?R0qP &V7P (04 6 : S0`3] 0P ]0  C^]1P, 10Sh91 00S000P0 S44 P1 y㳐:6I*0s0[   0 0 pppgX Zqᶀp  $ %u %~u븀$aZ0S00X: NX@Q >44J0SJ J0xJp JU 0\00㎄|A<'87 00 0% 00`S  QpSpppf覟%60006%0u P 6 J00Z000 S|5*:a$ 00 00000000 S00R:0P ݉`  ;U0$c 00 0UP  3Jp`W  0 00 0 R0 04 5 010ᴀ! 0`Sb @p0094 050```PK XV44+t 0V<40`p`P)  Y 8^Z|4p4vt {+lt0 V, 04 `N`P 0 0 SY% p WZ [ Z4np` %O0p 0p 0R 04 5 010p 0`S  0 092p 050```P pWN|4p+ t 0N<40``P*  Y VR44 s]+s0 N, 04 ``P 0 0 S ZʇX =[ R|}Vp0$c(0`W1pPa 001\100p匊L1,0妊41+00p~1+0噊 1%0 咊 0%0$勊0044QP @d %{d00Ѝ^DTtƵ)6ȦC_O ȶUٶ=E[p$'O-M0`@ #' 00@@@ @@@@ @$@J60QD Ꮚ`rP ဇp0: S  S 0Sd, `p0 0 0 0` @p h 6@ TLᆋP 1 05 QPue { 0o  XP[ \ d%0WVP@AWPP@;U P P@ 5  8P?`尽 0d#p#SR S-R SZR #S- R SZ R 0@0@P@8x pP[  0P$q`\ X $ R0 0 0SRXT 4 00K f4 PT| :`Uxi Y0P`uP`\ @0 (083D@$P ` 04G44pZt0 P/ 0#4 000000004QP p00Ǖ#40Ǖ@+80 08\4!08P8R"08$`,-!<./#0V4%0V8&0&<'00000120)0B03D\4CD0\8E0, U@P p@ P)d`plx@$0@%@$@"D@ <@@$8@@$,@$0SP$H / @$$@ (9T, P "WpWLY@  PP PD0<8S^,Q00^$  ^^ ^Y@  ^ TL@^00X^00Vم0X0V  R X``X00S0`SYF000TX  R" 000Cs0 S0;Sz|@P5 0S墅0 00 `m02 0Ԣ2 pܢbL <0<P#800$0$0jS㔔o,+fP @U00YU@@@0P4SB堂.0S*T0"R$T0S0DS0S U00R2S 0P S 40S 04S)n*\2S022RS{222S022Sdd2v`Sk S.>+0 202a@P,k0+0 0.>^@PZW<Z]8o\$ qlUX T?UP3A,$0S000 00@fP8p @-+gP#0O-|Mx@ 0! 0]PP H*kPpW ,"kP'`0/S\S  R`RpP X P rt.2@0t W jP :*RP t p{P% ppW!0: SP`p 0P1@0S S"~pf S`VZ `0S 00S t p;p0S)dqp0$vP H RP0 0Cs0SS ~0#S*S S ΁p y YPY3p Wp00p00t WpP XWV pD0 0R0SQpW<`~|Ѝn"d  O-dMP`@ρ0\X0T0P0 0-S0-S\@`Q$4 T00P x40X0@PZ\P0S \8 \($4!P .@P}XQ (iP,0 0$ (0%? #?`P 0S $0 @X0 (0\0,0M\h0 @ `P }# 30 0MP } @0 ip"@ @` pT"p"7QP  P Qz0PU iP iP iP iPXP RP TP U '+nS0oSPp p,P`@e PQP0S,SW,PP`W 0S @P0S @` v z0P  R 0傁P` t0S | V0 \  `dЍɼDѼvT pFP@- ^zc P7@-|Z@-P! 1  1@ 0Qe|% y `DP |i0#,,<!$4   0 Rh  pPP| 08=ЍpDN TtT.|U|mC@-P =5Y) սO-0-Mz_15%e15a >0 }?T1@0S @ 4hW1~ 0!D0P$a ``  Ƞ Ƞ \P0R:Q 圀0   RA0S:8 8b="|<nP.>`DHP xhP> !4P< IP,{0P0v/>#HP  {1AS?S4P tSTS WS wS1#Y *80IP L p`(0{S 0S [X=A(0@ 00<0(8(>8P C@P$!B @PP"UT 0:S P@L <0] <YUU @1\O  Z.gkG{ {  HP{<{0{<@: .`p!P"$`0 p  ! 0΍" R0R< 0`p">C!P"WV:400^40 E NP< HP,1 P #10C`< j ΍F !P A{ 40{N< !P A{l4t {B<<9~ߍ۽D K^i#Ͼپ&.Mb80@- M`P @NPPH 0 ?<  P  Np3Ѝ0Oup@-@(M`PL.0 0000 0 00000000 0$0T00S H D0~| 000(0 0 r|(ЍpQp$@~p(@A-0PM"L0<01 D00@00L H0jY<@PP1H0 ` DR`@ @M<<0VS H`- j;| HP-fP  8 ~P\#z80   <0{PЍCL|N2ƿ.7p@-@`00sS PP t eP0@0T0006S 3S 0PSRw:P z-tMp0l#}{D000nS40  P ytЍ 0p@-@ 0 00nQ P0P ) U 0@PP yePP`P \00!1Sv@0PSp\Db^pTC-lM @ P+` WV'0: S! PP0.S0S .S0S y 08} P@ / lЍpC-M 0P`0"X1XTP10Az{@0{8؀,{ SR $PP v P0: S p)`p0 SS`` x 0 :``P yl9{`@{0S /e|{{4xDT5X*M}@-0@  0P0.v{P0+@Ph{ ?|`+} x 40+PX{+u{l{ЍpD'}TO-0R$0S7  P3@ P 0  P 0Sa0S A z%`azPjXD@zp0@0Szp` Prdp@-PD0@ 0S bcPp@z@Tpd8@- @P`JKP@ AKP@0T8T@8@-YX0@Le80S 8_8 0S $Y8 y@Td;@-@PXc@z@-@z@7@-@P* P& 0S#0SP 0SP PU:0 0<003/P 0SP4U`>| 0S S 0? R 0S0 $0 $/ QZ/O-<M P00;@P  aP R` aP4  aP. 6` aP' l aP! X aP 0S0SS0 $ 0S  C0 S S R0S 0 `d V V  V V0 0  0! "0#00 $0% &0'00Fpt0凂ᓛ+~ ` k y?P' 0Ps \<@0 0`Pf T  laP+@ eaP  \'M,0 - ".0/0 d  0H &1#P7  pP 0!0vP+ 0HsY p<0 0f@P W  aPG`` aP  C ЍZG-+HM0@6P 0PBS;0DS8|0HS(}0+S% 04 8 <#l(l<"d~ 4$d"d v`$"+q&0p 0P $ 0Bs0S%t B`p0HS0+SXSh 4) (0*P48+P<#\(\<"T@ T`0#,,<!$$:0 0Pf  04 8 <  $( ,", $M # $ ((<"xR0H@ "̠̌,*ČČ< ",*/ P *Y 0P$ 0aS 0 $ 0S 048<S 0 4$#4 s02GHЍA-s@- 00@\`P , _PP | D\TԮ8dmp@-@ =`$A# 0P0 [00P0 00P000w@-uPuP t@&*p@-`.@PDPP [P @puEO+@-@tPtP)P  o3P@s@ sp@-.@D`P Pxj[P 0ZS0S00@\[P r.@Ca0000@p)@-@ ^rP)rO-Mp`@T 0-Si0S@ d>oj0Pe0 \  0P`P@RTQ 8/PPLcsK0 } 0P`)GP 00n :/ P`q T [|0S ll0t0pxcUZ.00qU r0S 0SЍ  P@P`PH @-@咻0 @mT@-@<傻8084000cS$0    @UTH@-@<Y h8084000cS$0    @; TLH@-@<N8084000cS$0    @!'TH!0CS /O-M` M@p D00 R 0!$$ S D0  RD   S0. $+ B$+10 S 0 !QDP  R@P 0Q S( , ,0 P( 0 Q@!S800  R 0"!r 0"!!, C R0 R 0"!R 0"!! ,0C0 S S<  H8$嶮 H4 1a S0f SGV S!0E 100 ` Q`0 S00 ` B@A0CBQ0E 100  Q0 S00 BIA0CBQy$= 088$0eQ1 Q010110010000 B \ `Q  ! !0K B \ 10`S 0  I z Y5 0j fS0 c 0k iS0  c0F4 j i f0iR1!ڶ 0a 向 S  0 Sa 4X0 <0! P P`Ō0  S8 00` 080(, 8Q00(Z0S 0 0P ΍@  0 RY 0KXߍۍ@-`@PV@`V@`V@`V@`V@`V@`V@`V@`Vz@`V V`@Vj`@Vd@p`W]`p``WW`pWQpWK`pWEpW?`pW9pW3`pW-pW Wp`W`p``Wp`W`p``W p`W`p``W  P`l Ql @T`F`ZO-MM@ D0(5@ p3,5105P0I,1Q cteW00Q0St Q0j0l$\0C 0(H`LPX(0L`P0 e  @,H TB0`e4``0@<80 @, 00 0400 0 T$40 D 80$ 4%@0  P` @<$` @<,08 $4e0,0!0S @( @ AK( r @4e0S1! 10 Q 0SQ0!01` ``A \ `cP  KA \ `   cR !  J aZ `p,1Q cM e 0hS0 c r  j 0kS0  ch  j0a h HeP00` P e hPb `Pep\` 0|P 3 1 ! cQ 1␁Y  R  KpAߍۍ 0P 80@0D00 Sh X00X0/00S/4P/0@- 004P ,@!\#A$P R0  h4 R R R 8 08  8 8 08  8 8 0 d8 08  8 08  8 08  8 0804 0A80800800 @0K( @00@0H04H0L00CL0L0S/@- @0,̠(@@00@0H04H0L00CL0L0HS @c@aČLHp@-@P$,T(T$t p@p@-@PT$t p@G-0`M \ @$d00h\dh0dSdP0P0d‚S 000d S0 9 qpWp@pphpW . R p B0 l00 0lh0 0hRp B¢ p  p pX|g gp ⱀ0qpq 8\R  B@0 lb000`lbhb00`hbR@ B¢ ʃ 0`0PP! !܍ 0p@-P@ | p@0 0 r 8 804000   p@-D03THAO-SMpAP($tq40T4 G0`$㲐z B$PLZ4  "R㲰  @ğ R $v("$A10SZ 0, H 00 Sl00 4m ,`ac< `D@ ݭ, ! C< Z-@`, !`Ŕ l8D f8 \` R,`Y0P0 ,0P` @T 0&60CS x!0000 (4 x0S060@ T@P0<0   RA05(6RQ@ \\-(,  0-, !S( AA R R @0ZZ=(,0 !J@A=,01P0$0 SRX 0c   ` ?QS(`@0A4` S A|0C!P〠ЀѶS, X,RSߍ@-78PM@pU ` "0#00!`P0S 0b08 0Q 0 0SЍ jBd 0$O-TM@( `$BQ 0S $  , `XPږXPKXPXPPp 0J 0 RF SW SW 0C a P P\APpGWʓ<|0Pp0pmb R0S P`p 00@G SI 1 R PQᴁ@$0 ̌<0Y屰0 <0Ɒ0XڼP⁠ഡZZQ p ᲀP0S 4,P0 ̌ 0^R0) 0A.05   <0 , Q p- Q$X0\ L(͌0 ]$PQ p Y  B pp^ɝ! ɝ ͽ$͝ $ [͝ $ $Y} p p} ppI ^ɝ! ɝ ͽ$͝ $ [͝ $ $Y} p p} p0 p(0 1(1}$$pqp X p  ΐ } p}$pqXPL1Rq 0 ](PQU^ 0 RPS < 0 LĠό ĠR0 ,  X  PZ 0H 00S p0H0Hp\  H0 R 4 PWpS0\ X \0S Rp 0 h0Z/ 0Sሀ pfX h00 Q Yp W㈀ pP L F0;00Xp ;W|p Pቀ 㓌(P !0UPE 0U [| YpP0`0U1p$ WpCp6`Ⴠ 0VP!U`TЍ80p@-@PS P0T 0P0?#T0X0S0@0  800(0X0S0L0H0\080SYP  Up,Tp@0hZB&YA18Er@-@0S.0 R D @R(`0p D00D00 Y  B    D@ Q R 0S P000S 0S/ 8<Q+00 P40U SPr,` ,| ah0 0 &P800P080 S R0P00400    B  R S00S<00040Q8< Q000xSvE- $MReg2` pg@Є[g$"PETg Pg0 000!<000,40\pPA 0  b |4S`|媯ʠ JOZQ4|4Ჰ 0C|4 ?$ 0 B B$ ᴰ 0 0QQ=0000P0!00x0000|4Sʀ40C 40 0 00ppQ Q㰐ಐငP∀.p P²PWʢ⋰ഐⴐ 庰 W PpYpep٧P  Y 㲠 p盧'pQ\P? pCpGⲠxZ ~ ppJLⴠ\㴀ⴀ~ppഀHⴀp겠\AZ ಐY iఎ 纠ᚐ)0pGLW0C@S$ЍO1A- P0Rpp``010@SR( SM^PQ`00R R M>01PPP3 S3Ӭ3óPPPTPp`0 R0Pp`Pp` X1.@-P00@ 1  $@ZP0 ". !# ^-b-0  / !.,@ 0.0@ Zp@ `p. !Q01@T$U U M>0130H Tʨ30D30 DW0 @ U@0 0 P ZP1O-`@>0SF Pp0j= 0P00p0- 0Z=00<0!0b0 Q f `X,0 ⳀX30^=b=00 !0GP0 Q  `>>0WP1:k ЍO3@-@p $@@-\00 RڰS R (S  R 0 0!C `2O-M@`P>  0:  ~Q pM4k44g 8BH20M>010S`FV> 㴞  "  2!0R ![00\0S! >  ㋱tPPp p1 0 (  R xP@DT;P K, > +0$ @ IF0`00`M>01xV >.    )Z 7,0 > > Ѝ8.O-P|M@PP~H=+0 p04x(p0hP !0H`D  0  0 >00K=,00$400 M=$08$0Q='  0  0 hP0f-0> P4 P0QD0Z10PA\ǟ PP U0Z=(/0P0  ^ 1Y  0@P\0Si-( b10APN\0 Sd40 0. S  d4 00 0B- S. PPp f4 I=K-.0 bC0SK=K-02 Cd0SK].Pp  p2WEP8 P)GY:0 [% [  [ [ [ [  [ YS :\Y]$ЍC@8HhggL@-NMKO ^^, E@P YK/ %E <)@H0,Po(0% S:#0PgPc 0(% S:)  Z0% S:@P*N? @01D4@P5(0S1 S)0S0 S)0S0 S )0S 0)0)00Cs0S@ u @ 0T: \|@P$ @X 0?I  Nߍ fwp@-P@ [  p@J4@- 40`@-0c <@-(< "440  <@-(< "4 !d[O-$M0000Y PU`@ `PE`U@ @ EpPUU0 0PU P`0    @ ` 0  0U @PpUc;D0C`%QC0a @  UP%1CX` 00 10c0; 00Z  R 0S 0  iP00_(S% PU"U 0 R F p   i0JZ0  C0000  0   @P0  0   @?U3 DU10c` 0R0X 10c00E SZ VQ PUU 0\  iFp  0 0    iU00 0PU 0`D `"I I00 0 R 0` 䉕D`"I IY| IXC PVS  ZSP U Q0F  i000Z  R( U(PU%U# 0 R F p   i0Z0  -C0 000  @PP0      R@@uPVFPU 0  0U 0E0p@PTW:` 0TV:@k@0@k V@ #3$ЍG-PZ`Z(0p S S S~Z'y[OKTc 0  4 0   O(0S 0 S 0 $P V Q*(0S 0 @#!P0S  0  0  R#! !* 0  0   YWYrZpZnZЍC@T0@-MMK/JB<10  ,    2V ,  -   m.B  0  $  , R  0 0 PY*Ppp p,-:B@p|T b@,yMߍ0H 00 HX0p@-@0 .*PP 0BP $pp@kXH00c/@-0#@ 0 0 0K_P 0T*t0 0R1(#  <" R@0#pR Ѝ@PRY > nUkU0l ^d0000.]U >0S ,0 (0 RЍe}@-M P 0p`0jPhRV 0@0 0 00W00ڹPP@U+ >+tTo>T `VV  p<!R0S4S @Ѝ9~X#0O-4MP,0( $0 0v0@0 `P#0@00 3 #3 00 00$0 0, 0(0`ɞ$ p2R0 R" 㴂"0 "             @    , H"D"<" 4"    0 Z Q /Q 0P00  P 0S0S 10\ 0SA0hIQ0( -R R0@1$0 Q}VP(QT,P SU [Y0+$0 08/P 'P  0!P 0x Q 00 0 0S4Ѝ (TDNLTt8Ԯ4 k(yp@-(M@ P`  (d 00S<(Ѝpp@-` P@L$ < 0@ T ? p@SG-pSpMP`<,` < $d p @ ?|  ᜐ g`fkkS 0S <  S܍ 5G-MP, @|~< d p$/d0 yl 0t0t o0 d

P (@-_R@d$ P N@S7@-0@0 0P 0QP 0 Ѝ0@HS Ѝ0O-@IM$pAPA` @>T$ T+ TAoY lY1 nY Y 7qY vY' 1P&P$p`!F:#R @y"YG dY xY@YF5dY5@  $x%F^pXL0-SPQUP,:@  @?"Tp00Y p 0 0INhQZ PV V 0S 4@E hSd4Q \4QX \SᶮQQᶮ, $9RQ@/GS +PP P \! >d㼮/ ? Z8{*  0Q0ڢ 0L @I?/8WX /MP (p0SV0 Px a80: Sr -(p0S' MUa 80: SU X T2pP P` nQM AQ NQE `rQL yQ [MPAPpV>S ?/(0" Q?/ (0IPt>/(10R TXM?̍ QP ,QW! 9 pP p?`0P ,PMUQP@Rwt V \ `  IߍLO@ ZxPKPK=Njo  )O- A$M0HpP 0P@!` @ $ @)$i&iQ%:@\# T Y jj`&Q:@\ TY  X X X  R*\ e\ S  C\` L Õ0  L B00FR0` `` \ 0 P` V ` V` V ` V` V` V  T BPe @DPEARP@0A T`PE@DIDQPP. Y  R* ` V  TPe !U@D`PE P!PE 0 UID`QPEQ PEPECU`0P0$C0@ R+:P0k 0e$Ѝ TS> TPL Q@-p`P@0 00P& PS  0 P S  CP @ Õ0  @ B00AR0 P` p P0  @d@O- A$M0HpP 0P@!` @ $ @)$hhQ%:@\# T Y jj`&Q:@\ TY  X X X  R*\ e\ S  C\` L Õ0  L B00FR0` `` \ 0 P` V ` V` V ` V` V` V  T BPe @DPEARP@0A T`PE@DIDQPP.  R* ` V  TPe !U@D`PE P!PE 0 UID`QPEQ PEPECU`0P0$C0@ R+:P0k 0e$Ѝ TS> TPL Q@-p`P@0 00P& PS  0 P S  CP @ Õ0  @ B00AR0 P` p P0  @d@E-p`pP`U@ETbX:lZ:@TpPEP*@TFT  Q  Q @PU @@p`PW:plPW: PpPpXPY@T{@pG$AGhPUp#p3Up#Wp`Wp@pppv?TTQp@pePqGWP#P3WP#UB`PD@X"S*TP  Q  Q P@T PP@@p'qspg1TP  Qo  Ql PpW PP@pE@'qspgWyGRpP@$AEqpgPU#3U#XW`XPp@pPPW@#@3W@#TE`@X=:@@@Tp@\@ P`U):plPW : PTppTP@\*n\ : b b\ 38 b  b b 0@-P|M@ /S`P 00 t/000 0: S/ p+200S"$ p200S I$0P R0Mp`200S XI : SP Sa0 pP0M8 S9  S6  S  S2 > S"  S-  S80A kL`!M5,p'\100S" S 0P p0$ !I"p0IH0  p`P QPp P QP` > : S 0@%0 $0hh0p00l0t0f|ЍnM0!M@-0$!1/@-@<L@Lp@-@P`$ 0R *b5PHh000S `Pcc00e0  000$0 00S 0e023 UpA-qq YP@ ` Lu00Pp`p0V┎0HL@P;@10CS <0< 0 0@K0P<HL4I@aO-zMM < @ H$@P P ~ ` z 0'07VU@ 7'UV@ iP@ cP0P \pP`$@U6 Q 0P0CzT!As r `Fpvwp $;0@S 4P4 0- 00 S p,  V` Pz-0 T2S`VFVX5pL54W` p$l`P@ZzP 0 00=0 P0U@H4  \ 0\P R $- < 8p P ,DL!0@T (0[0-㛣+ⅽ>  ^0P((U]zPPQTT ^P-@<垕.k P*  ቐKJ P e\z΍8DKnTp`A 01WXH+20- 00 S(@p @`4 [,01X4,< X0 0 00 S1  00$ *H,Pa0 34H#<0C8 0  PʴH,8  c S~0c8! P3aSv-8#=>010SWpPSWp6W  R`LzTQX X aPE`u`$S0(@ !Y VF0Cz T"R 0SCSz΍L% T1Rp!XX1`Y,,^ I}H 0 S 0  !z^!XČ0XXSV 0Y 1s C4 00, $0 (`@ߍۍP8ErYA1YS&(0A-p@PSpT`< V,0@ `F``.V,00 00B0`8 #V ,8P@(0SC( $!@P0$B$ S$S0$ 0C004 800/#804 0 S p4  P p(pp0 80,s@-` P'I @0?`P *`P "JV v00 40R` @ Jv0`J$JI|'7@-@ PJ0BS0ZS [E>O-dMT! XI@ I$I(I4 TJP$0Q,LI0\00( 00S* pP`00 <@a0 f   0 S?[ T+I Y  aP0g1P0H`8 Zڌp @80AH`,0W0L 7  00`a7<01<p 1xt0 p0rWs `$0p@p \ W00Q0S p,48 @H0 p0A`!`a < (0 WA@0 ! l8 p0Q @  +I)IPV@ DD00B04 0 (SB aD@ X{eWpW$  z0P U X$PI kRp$0d0LZ4 00D (0 PY 0pPQP @H p8Y&UX $HPcH$aH(_H4]HdЍ7h8@-P@(H0P&D0P008 @-@R:0 400 0$ O-DM$ 0PH P0@T PH  p`_q @^00 480C@(040 ̠,<"4 #S$44040 ,40 .$<008 ̠#.4QPVG <@DsN@MG0` 0S tGP@P R:|0P U 0$  p0 0 P p{,0 0 R00*0l0 \*b"(W  0bY 澋  0`da"BP a  x:y4 0h0,!$0S*0`` 0`\,QPP* '  \* aA` ` Rቐ#Y P`$ PR*00 P*b" "B aa  剐 `YP `8ypP400 <"4U $ G400 <"4P  P 0 %P * +c2 W 0f0pp0b2CQ b0 *! 5P0 *bS"0! ≐ : c"BQ0c! 0#:$0 %Q * +c2W pù0 p4 0h0,!$2Cb b 0;0S*d1 %P * +c210 $b2CQ b1 *K1 %Q * +c210 b b 2C 10 Y 0W㦞p p0S*%0 %P * +c2 00b2CQ b0 * 0 %Q * +c2 010⃐0 2Cb b00   `  ` PP*  0Š S*`@ll 勰`FV P0 W`3A 00Y 0ቓ6` PR*00 P*b" "B aa  勰X*@KP[ ` Rː [ I᫿k0S*r0I 0R00c 03 0%0#Y 0`   `P"pP* Q  0Š S*`@ll 剐`PEU` Pp@ p 4 0h0,!$0S*P400 <"4U  $ E400 <"4P(00P0[ 84 ̠.$<8 ̠.4QP:84 ̠.$<8  ̠.4QPt: $ EPP P(E&E $EDЍP 0TX @0 0D00H0008<0/ \@-0 @0@$@!,S:@`p 0 @-@@DP@-@LP0L0P0@- 00@$,00000O-^MM QpP0 @ &U@D D0,0 ^0S@!T%R00& 0U. !SR  `@@DUTQX(@Q1:T1U QJ0S:^>0Q,J000M4U΍Y @T00Q ^5 0S:U>L0Q1@P0̴ 0 ᘵp F i4(0pee0\! P 0Pap W:0 S00U0#S0pe^  0C Z ^  H 0 !A5p0CH 0ō31a1 pb0  ^ PV@p cr X8 c#* 0R*R-0 `D  - c4S0!$ < 80^$ 50a #0P$ U<$:04  @$ PG Q.@!0pGPS B U I Y `( VD,5QR0yߍۍ@@-NC-@`Pp00 40R":"RP/$ CP4|00"RR 4004000000$ 0 000b000S:O-QM M 0Q^`P0%0 @005 0C50% P B%r ' :Pk \0Qn c` &1 0 5X!0C 5 0%X08#8UB 5 tPx0C|000: 0 Rv @ RA.F  RG.= 0 R0 5X4!0L00< 00<40  0xSQ>0 # $04 P   %Q^0P % *5p 0C50 50C 50|5apW[0C5`` R, 0$3QQ `V!% B%Y :0 SQ`!V0L 0  Q.50  0P%|2`  5 0 L01 0R b% RQ1%0JR 05 0C500 Sha B`r Q1R 05 0C500 SOa B`rQ 05 0C5 00 S7a B` rS S`1:L5 PP 0 050 !0Q>0t0 PQ>0 #T0P0P P %7Gߍۍ[[N \@-@d0SD`T0@ )80@L0QqUcUI 0PE@D 1@00c D00"P@0 0U@D 1@00cD0 H0 0 SH009CU 0 (2 @00 @00 \0D0PeX0DP<0@P0QqUcU0PE@D 1@00c D00!P@0 0@D 1@00c D00H @00c ! 00b`0D0@PeDP`0H\ 88SP!P1`0YeUP! e\ cR : (H00H0`0P`P `0PUH 0 H `0H \0 R0S0 d00H0Sd0 ?0/S0/S 8" ?"&P !0 04@D0Z00 0: S!> ?" 0" Y 0!0S 0: S=0`0000 00000PH00H`a L00L`啕03/P 03/03/" 0":>8>?2> 00 H0& 0$0000 00000L0 Q 0003/P 03/> 0S03/P 03/L00L`H`V0L0=LPЍag@- 0#  uC00 SS 9 ЍG-@P"M0,0h>`P7`M  V'"  0"0Sa1S 0P000 ,L> P B0p00| P* h t%P$ 0S 0SDV BS 0ZS 0hS 000Cs0 S V0 f0?05/P mT9l0p  0Sp`0  0 Sp`  9B20 SS VW  ,BVW ,0S000Q1`S VaqSN ~aq00`F0v`80VppVS0S d<P  <1P  < 0s0S $00S0!( 2(#  <"2(#<"  |t`l0 04 RppW a!l0R 18<DQW 3Q0 1Q" %0Q5Q. *:6Q. 7Q dNQMQB*KQ0 LQ& [VQ; SQgQ6 xQ4 Q/8P 09 0J 0 : 0 0!C 0: 0: 09 0:4<<48|<<8Y  =" 0"<!0 00 ᢄÔ,m= 0 0}<40 0S004080S0080`J P 3 P 8/880`3/pP03/Vp000 03/呑^<" 0"<< <"ލ褕4.Ldch80@-@0$0 0"P (h0 @-@$0<0S0S 47,o 0"P (h80@-@0$0\ 0"P (mp@-hM@,$Q`VXP` 2 PU8P !x  @0v> 00<00 0800400000,000 00Q  :hЍpB@-P;@0;$000 0000$0s@-P `f:YIp@<7P#6/#J:|fs@-@P` N 0QP 4000S 0Ѝp@ [7Ѝp/;7@- @ P7< @ ( P 06" 0"-P >@-`p@ 0_P 0X`p$ 01/" 0"Ѐ0p3/ @-\6p6A-HM `@P< #<P 0 S ; ":<"G 0""< 0"F0`SG Q ?<`pa 0/S 0 S /S`1`A: : ;" 0"C `(   $ " 0/S  00P:T600Y 99`6 0003/P03/ 03/!@@ 0"^HЍ|x &/@-? J@ᨂᗂ@- Ph@-P 0S 3? 2@ᐂ 08)A- MP9@ႂ ",! !, PPP"0S` Pb00pFH0`7P "`VP UЍ8@0@- 0"ӂ@"9 Dp0 70S` SX SP L SHDE  ,07]dn})RO-  )7 05 41S8P*0066   ᶤX  005,ЍT )@- P  P @&\ @-@LMP@`@PDP3 p 0"= 00 00X ] p"㜾 \T ` H $$LЍ@- 5 >l h0@-@` \ \0 50P0 P< S8y6 $05 LzD)@-0 P0@P 0` @D0  P8P<@0C0M 0 00 5TЍp2 0@-000P ? 16 04V`@-  @P 2-8@-@,0P@E 04TR>p@-M|Z6 2PD2 40S S S !Sa@!@P01 @ j @@d0 0SB  7P ;00V E 1Y< V4 @㚽 .P$ 0Q  @ R  Q   R @@x x0x ThfЍpjdznt~HNx`@@-P/`2P6p@W 0T``"P@ 00@ }6P6@-P@q3Qd:Q4q3s@-`@P``  `0 0%|&00 R s Br RR  S~E-P@` 6T U 81 00(0S`UPpp 0spSD6Z d^@ Z D@Sm1[?C0C*10hh0P@D00S<0pUmP aXppHVI* 8@-@P @I00D80 A-pP @0 ;`0v00@ 0S cV 000d0d}`@ P 0r0@pWHO-M@ML~4p   4 1AT ^ PO`@vn `@ PRP@ 0S {. @'`h3^p0둮% 0(4#(y.4>W0 #( 00y2%0S 004 0 Pp W0㄂T0E^pP$  .A\0 30H">00P`,N@p700Ws 0 P@6P  U㨀Y?PP d10P.1 x<10S.1 na.00c01 c0 0S 0 `20  `  e⨠ l0  bX:0`M 0V 00c@ T {-HT03:6BO@CpC-P@\0T@@F`P M4V NX0P0Sp@-@|0@CTG-`|1P 0A1`S00$pP- P'' 0~Y  Yꀐ)Y Y $C2 Y00 @L 72 X`0SziT mpsp@-`P@0-S $ 2Qp@_ s@-`@ 0-SP Q Pa00 PU| x0x [|p0U- 0 PAaT0T 000`0PP@S|DTHSs@-@P`P0: S 00! P0 /xP O/|wp@-0M @ 000 0 | 0 0   Q ``@0 X 00000᭖P@PЍpLDL T ,0@-@ qr 03/P/8@-@PPN,'1L.1 0R@4300P(00;.5 /<}O-M@tP0PP`p *0  0S(,"!"`  3P p 0(,&&r !`"'$p  DDR  Y* 0S 0@S _y` 0Qp@-P@p-Qpp0H0S 0 S 3 405: < L0H0S 0 S 3 405: ) p@H4!01E-@M$ {10Q@pဟP| @W2 zW@ 2zPU``T`V pP@ @ P1PU 1 1zPPЍDT!1E-@`M h!h1h z`10 c@ Q@RBq01h,!  .`P< .P7  -0  `PP`  _-0 tP 1-N-` q0P`S }1`ЍGDLcT X! q0`/$4O- D0 B0"yP(?w 0S . &wDTL xkH/&4G-0M<#@0030 ,#,3 000 0000x3Pp  Q pPBaAT 0+S@` @ 2PY- 0S .S$0 0 Br R 0 Br R0Sp@W  1W     `0S 4) -`00`IP @0000  PTs+1001h ^P +T!x x@0X0 x %0Zz0x@  @ gx%00S 0 t cl0PX@0 0DЍD4LTx U16? 2"8@-0@  /PP B+8@-@ PP`@P  0 P 8@P  0 0B`O-M( `pL`0 P`=@pP 040oPi(Pp!5PHP!4@?P,P00nP$*p0 Xp( pP!X4ќ@PPp04 0p01P* P#Pp Pp`X-U p00p0-s 巗~0P30 -v-P" Y% (p0A A-h-0 p0 1#ࣽP ⅽP0: S  S 200 1#TP0 .P  0 0(P00_ 1#8P0|V .`P[ p0j `B*00 0,V! 0! ! 0!p0  f`p0t ` V1 t00St0  0P:t`j V 0P-p0 1P$p0  ! 0SRtQ P  0 PP@)@Ѝh i `` P O-|M`#3 t v@PFK t ㍛@.P 0LS@  Q 0y+2|"| t201S`\\`P p8)V jPvPUr tP-P<P Z)$0 000V0S Q #T@"$"#0@0(0 c# 0 bd С rP P  > b08 0|x1"P 0rx'0 kx 0` |ЍD&/?IS]bkT\Y@-Wp@W+ 2O-@"lM0 2d[ u1P 1pP1W@B y,P o)P ṻ  +]1p@ {p(S)@& V$ V[H0SY& 0 S 3 405: _ H0S 0 S`405:OH0S 0 S`405:p`W PPĺ땆 O+4, 2,PlЍDT (0,@-@0w @` 6A-hM P}P 5(1  h10  1 R !SRZ0@@: S`a 0R λP (00F 0@@S1 010 0S `xP5 y0: S*`P0  ( lP p0000@0C0+uPP00<00S ,0 0R|@hЍHA-;@P0,P <0100 {t 0 `  &0 +  q !1   Sl  ' R 0 PNPyx0 S  (5Kr/DTMbA-pCpI P@T@> 0-S0S `P 0`S0nS eS\P0@SU0P  cR 0R 00Cs06S ) 0P00S0 )X ))&7@-0 @0"11s10Q1S -R0SP .'.0S.P&P@T =P x0PU v@Pq3@00 40R~   &HDL*LTQ\3O-$M P@0%ŕD300eS834#0  s` # #3  ws`` ი2P01SY320)0 0pP0 0 200eSu S S S 0 0Dwᘫ a LL2@0TS82 F*3s`P^ @`@0 S S@`@t`a;k1H0S 0 S 3 405:  qHX T00 S 8!0<O,` 0!@D`` 7`0S )rPp @`pp pP &0 000WD0S_d0P 0% pLlX~\cDT` \YCad 0S 00/0 R/0R/p3/0@-@S (00TR@@P@@WUMePSV8@-t0  PuPqP 64@-5P8v8@- l0lP 000SX 40@0S <"0S (A>m뤕Yu/`00 Q/QP/Q Q (00SQ///H 0 02O-@MP 0 -R 0-S R 00Cs0 ST3%P0S< o 'P᫔201S20*`Pq:#:S%Pw W@B 0TP@:10D 0*Y& + s R RI$ D1H0S 0 S 3 405: R @i  :  b[:Y 00@qH0S 0 Sp405:ppT YmP L"0SmXkpT H@-Po0`0A1SP `3%ppP V [PP "J0ST0G-P`S# -R 000Cs0 SPEpnP cP qP vP A p1ēA`p @T!f1PH1D Pb1Q0#U@`PP8 10U10T  P00S0IH0S 0 S405:}Y H0S 0 S405:pRlP !($00S YlL uT}  ` |0@-S @#hP@-@ (00S0S8@-@RP x~t000#0T0S XsH00S 8T 0 Se8S8mCHBEp@-@Pd p@p@-@Pd p@O-@2 "  m2p0Y d P`ꜭ`᢭PᜭW Q@Z@ |@Vl V@ L@ )$@00+  0gP $  0[0S0 W R R W 0@ [ |k @T@` o s@ #mkDTY% bxh"h2O-MP` P"P2P 00 0Qm82    @ 10Pk  $~  cQ  c 0E0  !P(0: S 0U`K0S  zPP = e#Pj z$Y P W P vdP#Hp`    垭p`| @ pp0P0pP `pWЍ4LDTt @ $.P@-0-S= @Y"1O-|Mx P@0"1l0Dpa10Q0T`%"`1P00 pP@ "~K@ # ^P  P0: S   t ! VP  0S  \# X# ݱh0Yd 9/P m D#0S|ЍDvT  0@-@MS  @1,P @ !@ЍM}: SI /0P/: SI/ 0P/P0   : S//   SI*/0P"//P@-0  @J TQ @.T@T .T R 0!RQ`@-lM`pP @LR@T P @00 %P 00x" @Ph p lЍ0P/0<"p@-@PPp0   \\  `.V `V .V\ \!0 Rph1p@-@Y00 O P1PH0S 0 S" 3 405:"WP&""S0H0S 0 S\ 3 405:\B\P0H0S 0 TS405:1T@0TS`0H0S 0 S" 3 405:""p0p@<HG-P @pM d0p  J T!@@ 'J@0 %0b A@0 fz8@0 x$1@0 `30@ (@H$(:,1  $@0  30@ ((, @ ! 0: S S00 004S#&0*     4mph$@0 " ` ll X l h0l0 0   @l0 @ c1Y 0  0S 0 0װ R D  0@S p0 , 0 X : S R$ @0 0'P9p0S P&  }0PS u@@*!0  W 0H0S 0 Sp405: p@pЍH  %,3B9?FOO-Mq@E P P  UP1 0@S0   P0P00 0埡P`P`ᖡPSP2 7@ P0 00 S*T d  0 @0  @ PX:t0 PH0S 0 S 3 405:  000 R:Ѝ^Y 0%_0@- @QdPY* QXX Qhh Q``a Q     Q Paa0 `ЀO-`|q0"  0S 0000 PP0@0b #0.S 0S 1.S0 0  H  BP  0@ 0P@ İP T4 U@@TU) k 0  EP P ZZP 0S P@T `0S#E-MCp `3P0'0 0N00ڊ; 0/0<#<0C043 0#03 0ph p ~@00 21SP | 0P 0S p}P 00 0nS0 t_P ddddddjP 00070022002200&RC>01 0S  pGPppt1p01`S\10(0S0900@!  r 3DP0p 0`pZV. aP ppW0 wSOp`VP bU Zv3ЍdLTD Z# @ `T@A-`M -1@0PP`<sU p5v`P1U p勄`P2U p̈́` P 5U p呄` Pv 7/*P`  6/# `X Ѝ C `B z  Y? O-@bg1`0Q1S10%|s@H hw8@T T3᷋P-8HpP (CpP PA@00pP HP wqP@ &$ gPU t  I`P@ P T 0ST ' L0s@- @00 f` 10!wPd\0``0Q1SW@ t0P@S|jLTXTp@-P0P0`0A1S:PᥧPP0SpTE-@0pP eZ)a0P" 0 0pS Z/喋d  呋 t 0Z  0AmPT|L  " 2G-`@M 1! Yf1P`eVQ0FhpP@e@` @Ch`pPOW MP TP @1 <P92\P7 P2 100S  rPW WP  P xᔫP  u]P %P@V 0SЍLD{T UA-P@ⴥp`Wc0-S  0nR 0RP 0X;@!㦊P ᣩP<$(00 0R ~  7 0 p@-@` 0SP P A-P P p:A-Y<PPLPPP $뤕 &A-`Pp^@vQ0 0 P 0S W ^^2pc2 2^`"'P0SH^L^H2 qP 0+S `bV|0 Cr R xSv00 Cr R 0a0Cs0Sl0xS 0 0Cq Q 0a0Cs0S0S0xS PP00 Cr R 0a0Cs0S PP000Cs0 S P9 0.SR  2R`  ` 0S R bR4;0 BR5 ;000S 0 Vpx0 Vd0    00`=kR^DX wTp@-`PU@=@00PP@P@ 0Pfb@- @ 000Se@-@0p`"S'S@40P006/PeO-0@`$MP 03*Hp1@Y 000SgSeSS*XS5 ESN GSL ecS dS `sS, iS oSuS! xS TSPT!P 0!Y!XC@ X:7 1 YX 0  X 0! 0 m!YX  X   00$Ѝxzz`O-M@㣪p 0PS -R -R0S P R @300pS 0 P00 @ %P \P ``%Q bQ0S Y) \P00 Ru0000P@xP````0 *R 0`0P @ `000 0 Br R0 .R ` 0*S ` P @ `000 0 Br R 0lS hQ zQ TqaPD |@E:pgW p` o p  0 l000`0 S0@0 00 00   000cS tp00C0k000PMT0SPCT:0SЍ{W@-@ G8@-@P Z(000S8 58@-@PS@8 00@-MPM tbp0@ 0`0  MPЍڍ0(0$e`'}DTmamC8@-0S@P8P (P0@SF`0 p@-P >b0@@@ 0@aQU P.0.S 0S .S0SPPT}PP0SpDT0 A-P b0`0A1S0PpP  0'S `  K0p.S0S0SL[T2E--M@`P0&ث a1p1Pj`U0 0 U U"H A0 000  A0 000PE A0S0@T `P圫.0 hUP1S T@1T @TPPpI{P`  0{`jF{Ik kY<F{{00{00SV ЍO6?T@-000Cs0 S (P&3@-$@0@0S耚E-@0P`S 0S  0S0Sp20S ?\2 p1X00 "W Z0 Z0 JzZZ JzZZ0Z\:R R  L|\\V 0CSr L|\\ R  B0S0 R  BQQaa; @  CpPP0Cp P a@pP0 0S0 0 B^P ė0 R    aCqQ 0Cs00 0S2O--DM`2p`Vl2` <P 70@S8L00(Da< A8 A<0U80T:TL H G{HIG{Bk[@[kZ@k:{5J6@k/{.+k@k"{$J' ( 0 00SP P 0[ c 4 A1 ANjJ0U 0T p0W0[0Sn[000  k DЍHK]E-0,M @03 #3 000$ 0000_3 ! R  0S  R P)L#0Fh`k;PpO10 .R+q00D$,QXPpp!PᨂPg0h>=0SX00U0pS0pY)pQP00S0S$20a1@PS 20&p10@ 5_4_P  @P#]0S10S00Ta0p p`p PP<1 8;`V61 c0 00` P0p1 `XT@|00   !6T0`0@p p`\ 5V\,Ѝ褕`DHnKT ~0O-0$MP"@0D2D 0 00^P/0  1 0LPP 81  1P P1UPpd Q1 10P0a` zd  pL*PPC  (a 0WVAr@@0 yR 0@Sa  pؠQ  ? @ R @ZĿ   P@ 0@f@ 'PU `$ЍD T%X` @-Ph0 @\`@"TpP^L0pD00Q7/`@Pv3DDT8@-@P$0P08O-0R`@eP)%CpP#0%00 0@@ Q %Q @%f 0;/T ЍO0@-\M@ PP L T404@0,0@ 0\Ѝ0H(p@-hM`@ P 0|003/P lT 0L@0D@: S S80@, 0xhЍpHX!  jY*p@-P@s`p@nQp@-P@`' iU`4 00 IlU<8HtU$ATU0 R 0 !R 1p@bUx "fUq!aUj!sUSUdbcUT["dU8T"p@Vcp@P  @-0#0 nQA-P@`p9 NUs0: SPP&P$!AdU$ DU iU&aU!AU(lA0Q TU P 0$ #0DsU# BU(6bU$AoUw8'xUH XUlHyUP YUaPzUXaZUlTXcAPO:3 @P 00ӗ/p@-@P`P 0U 0  0 0p3T  TU3  TU32 0p T 0U =<<, 0 0  T0000p( T&2 0 "P 0@2P   00 0   00 00@TpP T U p@ T UY?00 0 0uH0TU0  00 0 0 0K1T !T!|1 U T Rd1UT@@ 0R>00000 0050@@00 00 000p0 T0U;318 T U++@ T H T U0   << 0 0 p T 0> 0p(0Tp00|0000 0> 00;0ph  @-RP 0 h @-RP 0  @-R0 @P0-0A-@`PP 0P pW X hP XP ^W?X!pp (0ppp0Pp. ^aH 0 -p@-M0 0y`@P~V @0S  00 R  0S: 00 @0#0P0`P0V S00Ѝp@Ѝ/@-@ P D000S8T ,$0T  gn00S/O@-@p` @@ P᎚P H000S @@Wp͡V `͡}P mCA-@pG`PPL@ D@<80VP@W @z`z Aep@-(M0@ P000$000'P0`000000 0$0PP $0P  0` V0@$0Pp3(Ѝpp@-@`~zTP Tpp@@-0 O-MP@4蔟0P000 0`  -R6 P + 0o paR gR FR g @ d@\VTh `RZQ 0!1$$Y%0P`I RD vP= {P Q 6 L @ p. v Q pPʂP@PP P !03S~L g L0P 1~yp@0p[y 0 S SV `W  Lp<  Pu`\ X  9/0 -SPJP L ;P L `2 `PʃP P P P P P l} [H}}L  L LP@ @`qW& L` pP P< |3P < ]P 0280< QP @Ѝ` <8 H mCI 07@-@P40P @ U Ѝ0@ u^G-`P0V @T) JO10000Sx! Sp!M0Ch! …- … S^@0~S0•0^00?000 ! @T@p v0 'X  0 S00 S V Nx V  ZHNDH0p@UWG  h G-P|p@`pM `p(*KPX P000#YY 3Z 0sS@0  0 S Gt@Z Z8P#8$$HP+8#8D4 8P,(%)5 +PY0p@-@|aWx00Q1ST@ `@`V`Q``0@St3pT @-^O-0 p00RX1p0@T81{P5 PPH0S 0 S`405:p`  t V0`P 0U0v0S ` d PPvcv0SS " @JZ0 0000S 0-S +S0  {4 @-0 MP-hE-tM@PP#`pV0 00Ȝ#R 0Pt  K@P 0 tЍ O-KM0`$1P 0+S-S000Cs0 SH@` @,&(6( I?0.G?tVP @ @5%ԕ p 0$g0  (P ⅜P0: SPl5 0 `pzP@800 (01p`ZW  R  X3  ?R01$8`P4 ,0p (0[0$ Y 44\440X.0 0 0 0P! T  R 0R 0  #8 yЄ R 0R 0  p P Z\ W !*0pd p   B QpW R0BR@b ;T9   PPP0d *0 Q BA \0RYP Z Z d0 SIYPjPPa h:X* `  eY3P0 S N ,0 X,F:P p U `$ @(P@, THsPF$PA+QP<΍ QP6㸛P0T  T:( @T$0W X ; *;P`Y: P$ KߍTDT` 'O-P`XTT1pP@0Q @d` {pp 1@`000000-S0S P 00pPp0t 0SX 1 PH00@000PL 0SR뻔TB` <0P@-@,00$KP0' ӧ @T FX  P@- 0S $  04@h0@- @P000`pS40S  ЍXw 2@-M@ 0P0` V@0Ds0S&@P0SUTZSUTWST0'SP0 SP0T0C0Ds0ST05T0/T, P0'hƚP! P0SP0PSP0P QP& QPЍ@"PA-@M3 0#P`p ``P %P3P0  0`p  &P TPHP 00S 00S 0S0` V T `Y&`v`3T` T` ThΙP Jb <PT t0 Cr RCT T@@ p)P2W`T/0I,0Sc# pW W 0S 0 0 0  P W 0Sa0```? Cr RTI TJ TJ TJ TIIx`jV``&0Cs0S TK TKLx0`` T)R``T`叒T`冒V```` 00S\00``V`pЍ@p@-@Pd0`0  !0#P0C0   0@ 0@@_p@p@-@Pd0`0  0$P0C0   0@0@@_p@@-@0[S0@DS 1 ]R0S  rP @(010 >@P0P@  0@@0 R  Q @ 2 @@-PR0p0A1St0P`㱗P 0S W B!㑘PP-0STA-PM`@up PP,0@qC U  ܍O-pj@P<Sl1P 0\Q0 c@-P  R0C@Q00[Q0 :RxXh H Y 0K Y   Y[0000:S @0ISYSA000[S@Y00S a000{SY&@0ISY 00@ 00@00@00@00@ 00@0IS 0Y C^Q'Bsp P aAqQ RRsQQ0@0  Sr &R$  A0s0GS  @=R000 R  =R ]R @000C00  @000S1E- Pp m 0@l00 S!1 P1p0P PP 0SP 0 0Pއ 0 ė ćR:0  0S0  0S\QR *90P   \ UPP P DkTq /8@- @0< rPP7(0P@@U+dN뤕nC^0 p@-PM YP0@01S  @PPT@`ЕbrPd ` X0 00S <@P (NLT)G GG-0M!@001 01 00 0 P10QaU 0-S0S `KP 0S 0-S0S A!2`@H,4X 0RQ0QT&  P 0OpPT Z`00  TvW,0iM`@&D/T 9@-P%tP`A-0 @0"<<18O41 1!R$! #sp: P Pa  PP` {( Y 30S  P 0S 0P0-S0S 5PsMV6/1O@P('zDT ?MTA-`P;KPp0 B?  C RdsX*P"<P& P0!0 0P#1200 @0P30  d0=N@Pnd@-p@P'H0S 0 S405 :agp(P 0=S V U0`CS` SVU ` `0D!PbCUH0S  0S ""11405 :"01 U(H0S 0 Q0#11"1 45 :"#02 U HPU  0R03104 5:pP0dHA-MPḓDzT @- P|@xP` 0H0S 0 S. 3 405:..0@ 0Yl0*0 pPD0H0S 0 S 3 405:  ` T1@-M@H P 081`P"0q,,1 0$K ? q2`/XPpUVP#P3:0 0 P@0fP  00`V0 00 t`loo P XLPЍALD"TlH}*@- 00`HS@-@S 0 +  0S 0Cq Q aAqQ_SY % -S \00vP C B 0C, 00.HЍz @-0 40 7S@-P-@ M`@ {kF  0 pW  RpP { : Ѝ@裻<{P  홻 Ѝ @-a0@`VP0Pp0  \0<0 0P0O-PM d 1@T0P7{`pP z  `$ P  P  p`  0W 0S  0 @8-08 P00! PI( P^RX Ps~$0 TPc(0Q:SPZ bЍ8@-@PP8@-@Q 0S @@- , s@-@00 Cr R a Br R_S=P^P00`PF0 `0S0 00DDC|p@-P@`q3p@@-@-@H000&@-@{ 0@O-` UP8 0S a0Es0S0 PEuPA Cr PR 0s000@`00VPP@P0@S  @0 0S Cr RR0P  00S Ѝ0E-@P`DU%0`0p8tI` A`00 \\0p  R, PWTT0$ z{{0p@--@xP 0x000<C@@@{8@t0S 0`P<04PD M.`P 0S PhPU 00t0xPp  84O-0 R  pQ p d  h 003P 00000#S    0S Sp0 S 00 0ZD "Zppp S Sp ^G 0"S 0 B0( /Zppp "S S@`0`0\S U0\S00S0`0`pP0/SP0P@0o00Js0.Z Sh@db0x0 0.S B^X`@# ,20 0 S P10S 00 Cr R a Br R_S 0pp0`X0S0 00Cq Q aAqQ_SO0B0Y<00   0Bq Q aAqQ_R  0 (RC [RDC000 0l # R  &  R  R    d@p M h d @800lD0D 0S( 2!>#O-4$MRp 0 2P`倠FX "Q 0@0R=0( ~ P S Q ,% R40P0 @ 0 0< SQ040 QP@d1@ 0 SQZ QYP Y8 YD OYK YE JY5 Y DY Y ?'<@0P;000<. 0 80w ''<0' T@ <0Ht W@ HPP/0U $Ѝ%>'%!>>>>@-@6@-@ 1000 @p@-   t2@ 0 T PpDRPU 4 2@< S{  S`  Sr  S\ x1 S#  S r2 S* 3 S mP {T0`0 0PRT000p@@p f`0@0p0P 0< S vK00 0 00000p>P @T@<0p1P0  000 0 pp@G P0 L00pp@M%>%>%>%>H1G-P0@E 0 C A,,<u,9 Gd0H0d0u`pYp @n000040`,`@t00S `X90   0 0P%>%?t0A-l@P`LpP L P<PL0T0P 0 00LpP`0p@-P0`C 0 P:0P@1: 00SZ00  @`0 T:P` `0 Rp0S p_@-@ Q00 PCR  `p 0aP 0S ߵ`VpD0 W:H0A-`@ጀ<! S00S @@P0p`V`` {P  gh{O-M0p0` PYH2 08Q42 0800[@`$ P0p x IU= `0hp 0/\R0 p( &R Q/R!9R&R00B00pG p ∁0x tPPb  Cx p00` R P @U 0X 0p 0S ` T 0⸣P p i p0QSЍO--M@`  0Pp0``\` 0   T0 T0D0d0⨀p` 0W  S R*W*<Y Z D< d  D D D      TX@} Q+Sg A&Wl0<! S 0q44t4Ix D5Xpx0`t0:t` 5Y VxrzDXD{G{0{j V `Wo\9{ f{{*x@T,`X)`T% T `X`T`X` T`X6`T `X` j@ Dsxt aBpPZ  t00t0t0Sx{H #DphYXL200S Px`g`  `  `P V`j oWX{z|1Wq|Dp`j 0ᯥ0 p10=QD9Jhp40 D`peP,4004p040800801pD z tD8 400c: k z g0V# \dpH`l{00`0@*\0  d0Hd H\0  0  @VЍnO-M PP7` `;p]@0S %S0%S *S@0S a Br Rg  E [@00002c[[00P  {*r   s[ ,  0   00UPp0@T@N 0@Ѝ0@-@2 O-4M@0(02 !1 =10Q -bp@1Wp&bTP4Ѝ!1,0 $00!H0S 0 S`405: &`H0S 0 S405: 0 V" y@ v  40`0(0$ ,0 Y S0$(ӱQ V v  I;ehDT ?xU0 P0c/P0 /P/4 R# R$/  / vH@-@P  d` pn0000@-,S \H@-@`PWV @dz@-@\?0H R  R4 5:flp `p 0 0@s0SS000+ PP [s0  A@Q   S     SZ S_PP  HO-@`PtM48 g`0p 0gd@ p;; 0cc 0S  0`稀`0 0202   0 A  ! PQP 0p q0RP`U`Pd 0PUU0\ 2ppeW eWg0CP ``0X0egh0020S 5`TVXh0\ 0l 0 `V35:0P S 0 0 S02b< `  0  ` R < 0S !('00  0 R0   R0  D C`0S  gS  !0 Spp Qs0PpGP:30@ P 3@KY 0 pd 0P``0LP T@kD \f (0AH@ Q 0Pe 0 㐋.UKH@@␎ P<@ 0<@@T 1 㞃#0^<@ 0@ 0TDT 㞀 P!0V  $0 gs0 0r $0 T0 a`p @PU@Y1:YLPP`T@1 !0 㒃# R P0 D0 !(61S1 8401 C4 8p!01 C1 4 0   ;;S 00 0  P0 U[ P0UtЍ HO-@BMPa8pA 2H0S 0 Sp405:uٻ10  1H0S 0 S 3 405: `` pL 0H R  R4 5 :Ҿغp0ЍO `p 0 P 00  `p0H0S 0 S 3 405: ' ㋻`p0H0S 0 S405:w ` R0V`p@` XwЍH5O-lMP0`0d05`:^p@P 0 00 0QP0SHpH P,d%P0T $@T`0PU``@dp+0寻P+0᩻U UP@U |$0 pQ Pp0 P@ST W (40@ XH `(@3`P0 0p8X08080S C! P 0CY8 1 B0< @0<< R\  8<!P BD S9 {   P  S3 80 H@0@Ѡ @T PUTp@S X @`8P <0X YD !ז{i ,20 Wc @`T  0Q@P 0 Q@I pC 80@ `@bT@`X @ !V`Z+-`V  +T `dX$ZD@፫8 `< T XP0 0H0C*X-00H "+00L 0 @ P`@X0Y%HLT@`6d}6lЍ@000  aHO-TM0P`P0&L0L5@ 0 44%00% 0L0 ]850Q`HD`V``H`V4p 0@ 0 -RPhG!r~hG!]p`Wt4X 0: S 0: SD 0p: Sz WpP` Lp @0500#3PR .W 0X 0P`PV 0S pq 0S$ PQWU `U` `V 0T0t S S @B@t8(H$H@0S0S00 00Ń^P%.P 4[40,S.4 P (8S008$8S0,80(8$8(84(S0`08$8S08,80kS4hK cS' =S -S .S S aS fS! iS dS rSg pSC ElS< wST zS sSx 00,0Lu0,q0S S S40SQ带]O40a Cr R R |A,8P1I0 ,0,(84S0S (~0 R} B ;PvB40 0ySn $0S S Sd40S] (8S0080$P 0S 4,(0X X%P$_$@ T T T(9%ݹpP3 ``չ0P`00 gR pR   0 RY%0S4 R0 %@)@V@P `xu0k 04p`00v 0P V  h`@P`d 0 `R00!   0S   h k 0 00 R`C0S  <@8  z0p 0 0 000   0  h  k0 000p0p0Sp0S`@ \  @P`p UW28=.0S S Sn(84S0080,80S0484HT] 0,! `PxPH PPp  0P 9P`p 0 SP* ̦0-SA .S A ((R @ 0岦(8S,P  t<Ѝۍ蕖 *GlN78@-Pp0@  0 0$0P yP 0S ?000v8@-P @pPPLظ`p/RPPE `UOPI@-@P` 1pP ᛳp `FVTM4 O-MP 4$0|40x4 0 P1- +  V('V1$P@( $P1P U @(#PPr 0xP /X@P 00 y?/00i?@0` 0t b` ,  DX T 咲@mpY㺥 _1p@}00 000P0 锰P 0P勰Pg +R 0 0 0 0 P0U00 0S Pj  @P ,0 P 000 00*1@P7 0S"p@0+S-S S* S 0U$ V 00P 00  P RC 0 He   0Y  坲T[P   V ᒢ 吢0S  B $ X Zv,0SY 0ST$Ѝ0 Sꤕg Lrw|c!bp@-@ P\U T` `VP PPP PP\00p8@-0P 0c @PR ]\R @ R^\U \\P [\r  \8P @\9s@-`P 0@ 0d0g 0 0k0|E-@`PVXpPPf`@d@-p@P00 Cr R '$S0000! \S  \S/SR0/0vPP` a00  W0PPdp@-0`  Br RR0@@P UUT4a UPP>U\00p4G-@TeQ  D:@@P? P@0\S;0S0  8刷0pS- #S 0nS000@P! ((P c0@,S@ ZP\ @0!SY$00$0pWGsW&p@Z  0p 0?0 Cr R 00^S7  !*p pd/ Cr RR  (gS ;S( IS #S wS }S pS  00^S $00$0@p 0pSp0S 00S {  V RTP# 0S0S cWp0 S\S@ 0Cs0SS@Ap0 0?@k+P 0S0S i&0@wSW 0%0QP `@ኵpPE .@?yW5 pj  0 p 0  p20  0 R Q @|ǴPlS0P0000Sm00CJI`p p@-`P 㠴P@ 00R r\Q 0 DJ0{TPp@98@-$@P U0Q008@-(0 $勢"m:@Pma8@-P@@0Q@k0@000 P008@-S@e:@-p- A-`P!   B0s3S S0$Q H0S 0 S405:U[p0 ᩡ0 ၟ000 P0 S0`0A-Pp@`W W H0S 0 S p3p405: 㠲  pR0SxpXHP 0 S 3 405:ㇲxpX H0S 0 S405:t׮pkPpY 0  M뤕 O- P     \0PP  P1PPDU ]P XXP0P0vQ, q)-{$[ <U 6  tY00SU NPPP @T0S7 07PWy <Ѝ!70COO-PB|MPt00 xpPl勝0x 0"p0PP282H0p0*<2p a (000t7Yt0S p6 *P Vp0S P`<1000SPpHX hhfd1pLE0-S 0SX,1?/YPp* X5& ;p 5 wp Oi$ [i t0 00d I0 0PP 0R|ЍeoDT,] 8 /<  0 P/o0@-0`@A@ba$00 R/B R R/$00AR/! Q  /D00    ApPP/ Q/AR:/]Qp@-0[ )Q0( [Q0] {Q0} }Q0{ 0)P @ `PU  U BRpVPP:Rp0 0 l /000Pap/P*/PDU/]<0p@-&P`Q@`fB@A0Q p0p@-PO/υ2 022<2202020Y22h0p@0 0X\ Sp0p@-P@`Xb\X 00e~XD S 0Xp0P-lM 0S  pP0 lЍ@-Q0p"2@!@1P`0 Q:QT:T*Q* a0`f` `0T @F"`V 00@Pp@-`0@P@PR 0 S0 QP 0 R000 MVp@p0唪@-pQ`P)ڨ0@0 00 SP3: b #PT0Pe0`T0000000  g f  00 08@-@PP8-7@-00@0@@_\3 Ԯ 0H0>@Ѝ/G-hM PcoP0: S `@BP1p0X:0X4nP10: 0`~ @P00& F T T`dFx 00 0 Y T00D `~p=0X&*p W< .pW00WW WO~0Kpp`  G 0p(]0Q pS @p`wp?p^`0t`Z VO  `0`c c0X*`800V:8 Z`jO~pVp*  f `Y*  i PF 08XS A`0* ` 0P0`V0pq ^0HXDoP0X!V`S f  H0  0P400CU]:< @D00Ѝ0p@-`@G^Pᅪ0L0`% P P P h PP   P`F 0Pt$V @Q`0tt$*Vp1A-M@H0S `H p$0R A0G00 0$0QYpdӐpd[0_@!8`080P V`# R ^ X p  志P00P0 S`0? U:H0SVL0S L o}HHPU PeF80P0CU0H0 0H0< @ЍA7?KW@-@ -0 0L j@r@-$j P P@l@-PL0@84 q40 S:40804 S:808w@z @-".(wt00@^cz p@-P400@LP$a^p@Jchz @0@-00,@ @QG-`@^@PP10  ]Qt1@PP0PLPPF0V SO  0RLJphXQ Q 0VF S=  0R9G- Q @0PP ᧨P  gP`(`0 T@@T L`&@P \P PPp@-P`0@$ TPU gPV mP P0 C$0p p8@-@<0P0P: S@C<PTP!*78O-`0GMSI :S010 1`1,=p0PEP`0 S S %S0`1A !``0 S S ,S 0 S S C``0 S S 0 B0qQQ` C R00`p W Wpp  P!PpP{@[P PtUP`PY Pj6ꌠ!Z#P X 宕=Z0S 1S(;0  op YP1S:0P@P 0*:03 =PJp:y3@ 0SYd   0SP0S 0S< v} Px0S 1P 0 &01 0S 1P 0 &01 A:`PPPɟ1) ^0 9 0`Hl P1s 1s D 0)S L04 @P P- ѧP ,! ŧP/1S80P?@P``s .` Vp VVV^%X@`?`v`W @T ᏧP  ቧP.Y qZ70, 7  |70tp7 0S 7qZ qZ 7,0AS xcnZX,00CQP300< TP6 0S$& 1S60@S  @6 ` PpP0@g@@e0!HƟ^ D& 31Sx T00sT P5y30 RY$(%A  \ Pt 0S @~P\5P`d.囒@5@0$"00pt0T\ `T x, ǦP0P0  5h00 p4`00 4Y00 4R 㤦P =ߥE/Ǟ1 CR`0@0 SS@0 S 0SsZI`¥PPY! ppụP p1SH3@  1qS1 1 @  0TP f@  ~gX@ XZ:p! 1Wڕp 8PD /P  )P  #P xZL0SI 0S1 y3`0SYB0d0 1pP wW<20ŧ (GN0 0T00CU1W0 $0 xR 0qS nS XR QS NS/1W00*p ͥP!1S00PG@P0` 0Pa忽@0 } 0@GߍyV?!Z` TF[1q *-7$;Z1]'tA- M@ ? 0 S #30S%?P0St~ 0 S00 TT  0&(?P?P0St Tt 0^S񟗊Џ D   4 ď Џ  ` ` ؐ  8 D x \  0 d X X X X X X X X X X  d ؘ ؘ D p Ț @ Е D  ؘ  4   D \   ,  0 @ 0r04@I04@M04@0 L  00SCY" 0U 00SC0 ;PD@0 Ux 0 L  00SC0904@`0SPPv(;0LP 00SC0 a@P:0 a@P :0 ! QR 5:z'P|:Px1 `R  BS t!t1`x!|`[ a@P900 1RP01P%  #P PT pT 0 CP0 pT`90(P010S% E`r0`1 00SC0?8Pr7`00ܢP P PPP0U*p W00 SGPd$8 00SC0;80d R    @   R* Q d QdP  00SC0,x70d R   B  B  R: Q d Q 00SC0-Pp0S0 ?> pxtt`0 0 `J0S 0VS00 R`"PT 00SC0N86 0C ?R00 00SC0n5 0 ?R P0C0P5 `0P0u 000C00PT P5uL0S<P ,0P 0P ?0T4000Sڴ4 00 0 B 0 P`p Q 0k pOY#p <T0 S, S $0 S`0X>T pG:WBE,0  Q  y 00SC0BTP WTP P3000 0Cs0SS2 `0y 0tWT 2 `0j}p`0P S`PPE0P H2CT02 8D@cagP g0 0 00X100 R 0 1P00P0C00T 0 4  BQ0 1 00SC0+k U 00SC0J^<1P  BS*  0 00 0p0 S S P\400 0CR000 00SC0-7P`T00`v400CV:P0P S+bD0 PF  00  mCMi]EUXhv}Px@ 00SC000XT0  Q XT B  d0P0&sTm ZP w0P 0S0 `VP P BP p10,n 0CP`zw 00SC0P1bT``P0Pe:00CPa0 0Cs0SSeT 0?1Pp00As0 S 0a0Cs0S_Q 0V0S:  0YTyP 0Pu U`pE yTYTpP( cT2 S  C0S S  0 R R 0 2p0 $ݟP 0 z,30XϟpP 0 ld3p0`PY$@VppW cT 3 `00CP dT/YU cT dT $yTYT 8 04P01``[` 00 R`0S0QKPx  0E 00SC00  Q   Pd;0 d0R0d0t 00SC0w\5P`00As0 S 0a0Cs0S_Q 0o0S  0950AR 2 55P0 0Cs0SS= 0$j6.P8604PPEP-PT6P04PPEh6`GTrP0AN 00SC0~J60 aBpP BABpP  c7P0P 0087P0P X7t@P0|!S:!SᾞP t1x17P`ta |ON0@Dt@ T7 00 7P@0`P SP 0S@D@dQ  Ѝ2E-@000 0 040804 80 40 S:40 80 S:80084 00000idx1t1<@=$0bUP` 00T00 `0`0`0D`x0x`t`p`l`P ;@P 00@@0 S 0S TT1p`PA81@0QUo?:ppPipX0P Q  l0Sx0S0U  S R ~UʌP 0 R0sp0`0'p0l09PP0Sz hz P@-P8`$1@0$0Y%00z0P 0S RP cP HP 00000S spWppd pX00,PS(0000 @0SLTO-PP2@D`qP pp00Wpe ^P ? VP= p0W,WG 0Hs0SS0 0Cs0SSy0S ls0S 00Hs0 S aHxX 00 Cr R 0a0Cs0S0 S R0C0p  P p c P p  D TpW011p1W` PpG0 R 0SpUO-P@@p`V$0  3/0 @pS@$ PX$0:S/0+S 0/-S 0P/ P/0PS/ QP/0S/0S/0  0+S!R-S!P/QP//0+S -S 0 P#3/ 0P/P/0-S+S/A-@ `PO 0qU @!  0G-PxMp0h0t0r5l`u Pp0@TfPg Ppl0p0p 0lh0 1WPWt00#t0Q W\%0t0hL 0"W4%0t0h( 0W5   7 W0ht0 W 4 h  "W84@hP @t@xpY&P@0S0 ;R0S 0P00PD @HA 0H GP@DX W!@0 R(Q R0)Q R0S0h ,pFl3P0 0GS hH Wpp@ p Wh @ Wh(  <W"h 0bS: cS: dS9 pS> fS9 lS : sS9 R pl"0~WhT0p00 0@%PlWhW WhR W h pP00RW hp90 0EWh p 0S6 z WhD p 0S$ [  W h{0p0q9W hl0p0bj9 PXlxЍ p P p  и 8  {` @ < wX ض Ь  dx O-1qMP` 0@ P P -R !R (R0S P1SUL1P01 00E01 00$: P 0B0 0 Y[0 0ZP0X00IY Pc80 x0 00X pL 0 0000p}.PWЍ 8@-P@X P00c< +R;P8-RS8S8;P88@-@PXP0d 0c +QPP8-QS8S8P8QQ@-@0 Y'00wP0S 0p3Ѝ@- N[p38@-@PP 0S@Q 0q/S0/S R  2[p38O- M@p0, 100M `+0,PI( F(0 A 2 0 e  40 40 ,( P(0| 0P Ι0@0Y0 197PP$@@Pu3 K0@-@: STrXP @- $~0@-鏅G-0`@PX(0X'ʠp 6 0S u0: S0X  R0 рYX 0S@-@06@A-@Q`Pبp0S0S 0S $ 0DR t<0$@0 0S X ,†L00 @ Ẇ,0 00 SA ~0HO-p$MC(00)0P30@ FP,00,0 :0$0(0 0$0uP X 0S 0000S0X (3 Q 000  ,ʄ  0Z Y00I0C\0 1S, 0lP pP `PJP 0P`pP- PF  J p P P1p0 * @ X&@00$00(p 0 : $0 0 S* 0  0 VuP!$00$0(0p(p : W  - pG0S 0  0 a`ZJp007W00S 0Z XY(`P`0 0  H0 R @,寅8ᬅ$00  0,$ЍH;7@-M0 P #DCDD#    ( $@530   "% B R "00000P B2(`010V z`t20 p`p5pi<zPP2 0fS2@10  eR     ( 000R10aP[;`K0S 0S0 0X1P0    0 0@1P,p 0-S0S1,0(p0  WP 0: S0 ,  0 00 0" 0Q+|0P,|pPx00,00)Pj0S 0S0Su3ЍDH T 7 p@-@PO`P L0080  p$0,@@ pHO-0,M`P000$ 0 0H: @ 00S0($ $40040`V$`!-p+@ P/5p :PXW5pe *% Rpz{ p $!5 @ 00 R YSQ  S 0  0R! 00IY A .[ 2H0S 0 S 3 405: 㶔 <2 f 0S@2H0S 0 S 3 405: 㚔 @. z1G9H0S 0 S405:   H0S 0 S405:  Pp Y)'y[Y[3 P00PUP~PR|P R/B}PR{PP N 0SH{UU P  0|XO-p@`T? 0p@`0H0S  0R04 5:冓匏p00Q % 0Q@ h R:S0h0V0P  `0ƭWP Vp00S O-@MTP`pt 0@@1H0S  0R04 5 :18p01[ $\TVU USP`N  S S S S S S[ [ p \SC 'S"Ss`P7 P0P  iR:\0U)V 0'VQ0S ိ@p@3T Pi P@ ?Q 0PPXPP 00S ЍP@-MJLpm`T뎭-b @qSt m*d0/ P*H * SPu,* b|ߍ n(07@-@@0 0@P0   PzSh PX0{NP D0uN40OP 9>+D/6 P40/0S00/P/ሚ@-@M@_0 000c000000 00000000302= 0<000;:0@ЍA-pᨀP`@)᢬P  ᝬP000S0@T @p),*Y*  A *K @ꈚ@- D-@}-@-됬@P7O$L- 0p@-MP@~00 00P`1`#0C d0 sT rq 0 ` 00F0CЍp@ Ѝ/mC@-pp@PN ``!|@XP!x@L@!t@0!p4 !l$$!h!d !` \2 0PS! `P 00S 0S  PPᠿP0 f v;0S d v T T0P`  m8@-@0S +PP D00w80 F87K4K8xy@-M@po-T@@PP DA T0 `0000003 0S0P.P1>Q T  L1 1@0@0(00 ߍ*1090@-,M W, 0 3iP@ F,,Ѝ0FP 0 PrP( 0 . ' P'0 SdJP 0!!R 0 ,)@0@hJv>L_0p@-`@0 g 0Pc PQ mLP 0 0S@Tp舚@- 0SSleh0  0SH@0@00PS X#3P0@-@\M  l奪P L\Ѝ0P @3@P]M$PP QPPY+ JJj[/rVPT KP U nPU[nOU|SxQtOQ d rPP4P,1#R  ""3PU 3P .P 01S0S!uP% Z PU% d*@@\㘽  P۩}f,1@0 ++ &+#+  @@O@@@ PPP P@ ) 0e'H63j5   D d < @-P0P`L0Pp54@P . )p`X< @-@L% K< 8O K @}OP3jnHT0@-@0S@ 05L P )T舚ͫ#@@-T4@4  T,0,@, @(0  gE#!C#͓0@-0@lMT 0S @yT nT۾PPlP PPT0LH0| yTVHP A냺lЍ0@-@Tp0 S S @t@X00H R  R4 5:bhp PyT/@-PxqM@`0S8P1 p岨 ic <<0<<0H0<^?H02 ᖨ0x 0GT )G0`H: WPP P0 R R   R0T Gx) Ѝ茚h Y, 8@-@NPNeP88@- @Pӻ000S84/8@-`P@-@P@w@-aP@-@P@j@-@SP@-@-@P@-@-@Pd@- 0Y @-@ p0 s@i@- P008@-@PPE @U8@-@`pPP   P P@0SPp@-@`P ٧P Pܧ@0SPpQ 0.S0S .S0S o/h0p@-@P` P0PL0 0}Pp"NPp`妻pO-qpPWM%@5p`03/P`  }NP`500S = QP & QP$ 0: S[ pG P Z 0: S ᮿMIPM~MNPLY OPp aP ں,  P p OPOZMFP ` 3@㘃8/P@pP8/  SXW ST pp P HP%pPHP[ PT`1* R` :NpppW ҽP5  0QP ppPp᤺0: SB hZ 1 0 pP_ڀ : SBY- `PV wLpoWKH  HPB4 Hq= S S  S  S)AHPp ᳾p$ 000000LP J EP0 h;0=qEP@ <4wЍX!  j&ZFr  $ |Pp@-@M @0xS*S0S,1K?0B <P,1S@l@0S@ \mPP@  `@p@3׽ ấލp-8@-Qp0@lPPP * T<0T S00 0#Q1  R8 @- : ӷ@P,000SxŹFd @- 㼷@P,000Sa容Fd A-@kP-LpPVPU _M@-P    D @-@ P0S  0Spኹ0`S޼0 0@000Cs0 Spp00 Cr R Cr RR/S+0 0e`0/S_`000Cs0 Sp00 Cr R 0Cs0SS I`0"S`Sٸ`0"S`k0 R p \R  0 \   \0jMO-pP<X 0`@x'/ 3%S+ P.Z 000Cs0 S000Cs0 S Pk 0` sZ` _Z0cSpS uS`@0S 0v'PU50O- M ` 00 @ 0PS@0%SSS;0 0Y.S @廋Pp᳋P.W000Cs0 S 2000Cs0 SpcX003 R R Q0S&XYlX@pD僋PO 00,3P<0 3vPqP002sX [00004[  0 ^_X)0 cS AS aS pS uS  0`000000oSdS xS p0 0@00#00<0pῷ00 .%[[00X0000g!p0@j@ @ 0S  R D厷000S"0S0  0  S`V@T+ 0S 08S  Q c< 00 0 0S00S  0@s0SS000 PS0@Ѝ45z-.0@-@lM0P L1L IzP0w0<00000@0@0S= @  / S 0 PaJP0: S S  S R R0 # 0#xPl0 vP S  0#" 0 0 R00 lЍ0 O-@@Ѝ/ᬕmCC-Ph0@T f7!0i7 SRЁ YXP蘚@-@ p0pH`0P@0P6aT``P`VQѲ`蘚A-Q Pfߚ ,&@ PP!}0SP7!0700A@-@RhM @Q BBP  PhЍp@-bM ` ApDP㞮 P@,@ⵄVTTPbߍpPY3</ @pPP/@-@X@L0A-Ka@`P@p >0> 6A7P5 G-`@:60CA0X㰀 .^ 0 P0p C \R0p<0p Rs'P"PR  P  R$P <00SA.S wp A.    &W&W;W |W qWP >R<R>R|W0A. pW`S0 `P pGtPp0pA>00 0S(Q  (Q{QRpV00A. QA>000)S  R}SPHpG8>000S X  W0 R00 RQ  ps0 S S<S >SWppW 6000cS 8000dSp 0Sp 00QCA>00 0R S<S >S|S &S B Aq 0'S"S A>0@@0{0P00Q11 8P0@-@(喘@P, 0@-Y4&@ A$嘶$0 !PI-Mp@㜶02K0M P(@ `2`0S(K |0P0 K0@ 0kP xT:0  S K@-pNP@ʯ` 4wP\00@0P0@Q㬮0p@-@0P`1`!Vp P0f0U :VPf P㘮`VpHp@HmPe`000a0 e p@9mPP@-nPH-Mp@ KM@ 0@ aQhP0AwzK`0@-@ $0P  0 0S 0:0$000 0hk000P`00 0R/!P 0@-@ 0R:P@-@P$l l@lh@-00 0S @ PT0p@-@P Up$0 e!S00C0ep@HP 0@-00S?@P$0 A@-@0$債00PT0p@-M@$00S 0 ` PP? @ ቮۍpPH0@-@0  0S 0  B PH0@-@0  0R0  Ps@-@ ኬT0TP `/0P1f\딭T吪|P% O-KM Mp8P`}l?@P0F0}Pp4 P> xP@ @> VkX ``0 0S 0S0`   ``BF$B΍44K0440B?4>d9d/d`$P  "JP@ p? p Y53EpT Dpn p p p0 pE pPy P& | P P% P6 P q P P lP  P P dP P P ]<@$P@W<@00 0S^Cn`=K ,0S/~<pP48 Q0 @ @TK^@4 0S :S0SK^)P:A}0P 0SPUpP@8:0}0P   0S @4@ fK^` Pi@%@/>P\ U@ܕ }PL0.S 0S 0 /RB0S?0S<tJ(j @=P   =P+X: 040R W}ᬕp 0 @ 8 * R S/R/   R 9p,0 00,A000p,>pPx= YK>U a_\9@,P! 0PA`X Q \PPE,0 `00,p0CV:11P0P,0S 0 R(,0SS |0P ,^   R:0PP( 00S6@  @0 S/R    (P`4``c V!7 `C|0`| gp 0`0cj [g7άI,0SF 00SC  P` :0p,0`UPVPPz-PP-Py.QP` ,0咕" 0  `6 i 0[  eR, `72P000S[  8P0: SZ Zw 0PH8 4ݤPPT  7lЍ@-:pV``#:&Z $Fp^`P@0 @-@QP 0nS0oS@P Ppᮐ` xP0S,S ,wP@P%00 0(00$00 0 00!Y8%00/#EgܺvT2 0O-LMP00 0@S `0؁q "  డ0S `y  `0Dp`X   p ,  "< `V  by" 0 qaW0p 0`0 0#̠0X0 0 0cy3 `pX p  * \`V jy  0 00@0 LЍ'TG- @`0    b㸏 0!.100 8SP\Pp `)@V8pU FC  G菏A-@!Pp 0!@``U`1 }00@S0$00PfpUP6 p@-L000P-`hP@ `P PPQ0Q 0PSPS p8@-P@xP yPxP88A-`Pᙦ@`0 r0S@U@`p` 0O-`Q@P @PdRPPL0S P0C Pp W80P a Ir RP A Ir RP0 Ir RPP 0;vP0 [Z0U'p0CWXX T 0S P ,,d7AUfz8@-@P弦P幦P8O-`PM@R4Pp0j 1 0 00 ᎎ <PZ 0S 0C R  80 uw0S R  ӥ+0G Y0 SY90?v u0S {uP0 R00 S00 =w0S RY0 Y 尦 /Ѝ@-@Px`@5@-1/@Pȥ@ G-P0@00Cs0S  000S0 P0#Sg hp`,SP] 0P!Pp al!QT P-Z+Z =ZIX,10p 1Q+P+0aa`IIo`II``V 0QXRI  R 0b 1`0S QV X4 4` -Zpp0,SS0Sp̡P0@-|M! A!5PP 4P00: S00L S0 h@⟴ ㇢ 0  d Ѝ|Ѝ0TE-p`@P0 Z@@  b0Ppz@0S0 0=p@- SP@PouPU{P U@PU?PH0S 0 S^ 3 405:^&s^oH0S 0 SP405p8p@sp@xop00@- xR 0 P0@E T @W@D T:\ R0C A$T 0R R ( \0 \ 0q0  000Cs0 S'0Cs0"0 S/0 0@0A   Q00/0 SQ/@-$M`@P|pJb EƥP000P: sR @0S 00ĕP@DZ 0b$Ѝh#O@-@4P 4 啤哤@萤@-@匤000@- @ꨚp@-@4PP`#7Y:3`Ȍ?  pG-@PJMPM1-p|`@ 夢p000 0C 05p P 5`P Y4`5`P@` 㲟0`SZ 0S \ a qh 0(`B F  a` 3P4804<04F `0Sr s P ) t0(0 J~Cs hp 40d0400', 04P4@&@0400D0 0-S `J~p'$  0300xSd0ZSW0 0Xe0<0N0 0f0  UsF qPw  sP  şPpJ>0#Pe  sP  ⴟTpJ>0#TT T rsP ⣟XpJ>0#XC  asP ⒟\pJ>0#o\2 -rP, J 00p(OpLpg'udr| 8sP `9PwXH00H0 -XL00L0,+P`0p`p  plP ]  rF ⶢ00S 0 0 `rF  qPX PR   NJP 2 Ѝۍ   .~ g) / = K Z i t cqA-0@`P "R0S0r0 VbPP8/ Ap    @-@ 0  O- tM@p(KdP dԈK 0! &dPP1dP# |KơY;&`T Zt h咨p!ᖨW 00g@P_[(K ܟ(`1`FVږd#0 0PM* ᨁ q,01 0e_ Р`0K`p&G%0p`tP dL!`0 _ `Ԁ0V 0cS` `0 00S @ pp`00Vp0S  @dԈK R 0RTQ |0l! W&@d#P-#<`)#<@#0 40;_ K}       ?./P P./%P5;/p@-@`P$CE`VPZpzP `P;@/ZP@P5@/9P-P.@//p@-@P! `%%@pO-pWM`0$SS X@ᐉP   @  I$0 0H   Q uT@D TQ 0@@Q TQZ  Q"Q  w"Q  nY Q Qe@ 1TI1 @PT10  0@BTO < Q܈WߍO-pM@`-06Q X0|$0P0  0 pPP DD2 $RPϠ35:$R !  `J^P$>pf P1# `# mp$ 0 00彈P p $46QD@ 0#03@30 02/ 4/ n 4/03/ 4/ 4/ 4/Y<< `0 0@ύ>T**@C>P?@(Q0(S?(2P  T 0_ ".㔇 㐇 ጇᡟ ៟ߍɚ;y tz   z A-pP@᥮`-``p804``FF pWp f_n⋻~≒᮴~⮵~⮶~⎓~⣟᎑⎐ p)+pY=)+@Q). z+'zpA}@p兝}p q.v}.p}p p " 0`V"RR# H SqS0-! p͎ 1! p̓ pRπ %  pρ ) p͋ p͉ p   =̓ 1 1 15- 1 9=0'1@k$g d `$ЍO-@0$S0S  $R 1Sᆝ ^50Cs0S4PU3@D!ꆒß࢐   , @R @0@S  #sP xQ 0`0`#  B 0@S<3@3P,3U`  P 0`00@S`0_008S( 0"  '000S 0_ꤒ  唲Y I ^ Q $a,  8  X X`^B(B ᰁ X X @^Q  ` 0S q0!  00 S0pppqQ  R  0S %a,  d0P剜 0s0@S $`,P000踚  ` O-MP`1p00P  MPg@P  ងX@]00x0T2 fPD 0 0 0)P0 R7 0=@ 0\0 R00рȟ)0SY>*2 3P    P0 S @TT@00 Ѝ /O-|MġR@p` S!WP001᠀03/P @R p100SM+PH 0: S  09/ 0:/@90 0  0:/P* P@, l,P@!DP 00 0P@ ,P + 0S  0:/P @@|Ѝp X!  A-hM` @:+P100SNoJ0: SK&CP"PpP t1tp1 0 YPM ,pP( P P PP೒N,P+P 00 0XP( z&P$዗PP z"P0: S }pP L0`H0 0X[P )PPhЍj! 4 V r @-@0#S OP0Pp@-`QP H9@@3YOJVP T D'MOp 8@-, @P0 0 08  p$0p@-@PS <*Pp,*Pp00p@8   0@-Mϗ@PP"  PP 0u @ 0Cs0SS0X00@ jPP  PdPPzUЍ0  @@-`P0S Rp뒖V l(U`00P00X 0 P !ڢ Ḗ-cM )E1ASQ cߍi@-bM @(A0Y??AS Abߍi0 R 0/R/ BjA-@P`p!P 巘徚U XPaU xl0l QhV0S D寘<嬘0婘,A襘5 3j LxI 80 0000,00(0 0$000"0h0/#EgܺvT2h @-D@ 08@@`p Q@P@ 0$$A-P"p@(? 0@``"  ȁh0p@f3/@`T* A躁0@-(P @0 "0h00 !,80@-,@#$ <<$ !4T0O-@ءMPP!Ѐأb"#" ZF?'^Pi@آCCh` d 嬮H匡ᨮL娩ጦP嬩ሦ(TEؤ+ ],à*P &Ġ@̌X"Ġ*̌+ \ ؅ό`όcdЦ )# (04 C()P 0SiЊ@0@0أX2 &9 7 h0'97l0&79p0'79t0G&0#[ "TxP[T|PاB " 0#آ! 0 " 0#! "0#A  0 _ )Q " 0#P _(QP(^Ш RP)^RPH+\*SP\SPI*+ B 0ФC 0 \ Pa `0@С  0 ! 0ؠ!! 0!" 0آ"" 0"# 0## 0#ߍ G-@Є 0pPYX*$ 0$``P |pPf`U* GoO-@@PȀ 0P P` fUD@0Y@D0L >q000H0~aUPP@U  ЍO4A-` @(`p ?0( @P` ,U$ 0qh03/Uh L0R  0QX#̠̌<%Č40:!Ah O-(SM0 @X"̠̌,%Č$ 0@S<0M/,, !4 ! 0S0"p`00 0t!PS %  -,` a Pp P`P0`( V 0' 0#g1p  P`pؠ b pPᭊ P 0` V`QO p "b( p 0ᭊ P`V@   00 0 0 PPSߍyZnܼbO-(AM0 X"LL,%D$ 0@S808P@4 @XY%,% CbI$!$  0S@ 0`Ppp@ Tpp csu'|'p*,  p(bqv'b{' p  P `0 @     p p000`0`PPAߍ 0/X@-Pp@` PḒ@`U@- ᗒ @f$7@-P @᎒ m  I$>@-@㛒-7@-P @w V  2$>7@-P @o  ($> p@-M@P` ~`Ѝpp@-M@P` ~20`Ѝpp@-MP@ `~PP @P`TЍp0 /Q/Q .Q/\\ .\ /\\S s/R QS /R 0  /8@-YAP0/SP@,Pg8@-0S  R ُ0<  P  /0S/p@-`@(0PV @TTPp ACqQ 0s00 0S/p@-P0`S;~@@gPP@p8@-P,~@0@DT  s Br RR0a@ }008<P8@-$@P0S Q@T8'P 00S / p@- @M`000SpL H`gPP@[gPpP` Up  @-LM$`@p@D  dP}`0 $0h0(0@0,0000040 080@P 80 S40S0S0000)S 02S 0 0$QLЍO-TM|Px`pတ WWpp @Y6 @ HL  K}, G}0S 0S0p00000 S 0 S00P 0 0H 04  8 < , ,`0D@0TЍ7@-P@ 0@8)2 0@2> 0A-M`0S  0唓P,@PF fpP 0 pplMPN0P`V Z`00C  @S@ pp2M@00Ѝ @-@!p@|@-$@0SPO-M@, e᝔pP`& 6@|,`0|0(S St凑P0S``^L4P-$P 0SsPU ᚐ0#P@oHL {YB00`FD-0P0"P 300S w+0 009090* * L$P<d`09 *@Pe ( Md0P  QWY"3 aR :7"P20 B: 0d 0pd 0Qp|2 (|P $ xQT2$0`4dpP `^ 00pScS(0:c0S :Q ycp /" 0`JQV p@!Y d100aSp ,<@100dSL  310`YaV``` 0!Q  #0 0 \\ WNP t%"` JNᖓᔓ咓ЍJP$&U ; / max&mCH QL FHp@- Br @ r@P%QP$R`@A`RP,C? @ R@ RAp@-EPsv@-P 墑 {{{"@Pt@Tp`P ᭚@ l{@DT5 @-p00`P@ !p0S P@- p 0S 00S @-偑0 0{P 0)40o00 0 0S0 0 Ѝ@-@@-@P,0P 0-S0S /` 4 40P0 -R R 兏/` @-Pp@-P֑@{p@zO-0M@P8`-S+S< 0Cs0SS005 p YC0N0S* T' V  wzP( P *`pW0SY00Y03S Ѝ0  0! W | @-`0@P+S-S10-S11 0-S`P00P0S  ?` 0@- 0!1@-0  0@-!01@-0 m@-0  b@-/p!@-0  0P@-0 J@-EG-M `0@-S+SF 0Cs0SS00?!p 0L0@PS3 V0 X y0P  QP:GPpW0SUT00UT030"S Ѝ# ] ZW | @- 0  0Ѝ0@-MB @Ѝ00@-MB@Ѝ00 S/S/0 S S//@-pM0@00Q0P 0`PNP ა0 S:w`P   ⣏Ѝ . @-@Q`P  <pPP @@ B TpPP♐@PO-  Z ,K^P C0P000,00>Z p@-@P J` pp@- M @0 ` 0$׈PP⒏ PR  Ȉ  w Ѝp0@-0 0 0@-0 0 p@-P@ ` Əp0P7@-P@ 0S g @  U4@TuV0 ٍ塏>  p@-(MP`@_ 000 㜉PP ᝋ(Ѝp l0A-@P`@P֎@pP0"S q$儋wAŽ @-@φPmCq0A-ps@`GP !d਎ @ 0w@-P3`P@ 0(pᡎ@ 0(@-@ P ;I-p@:i^PP` P g00M `X  《0p00SP ppP 00 00U X  d<000S֓P00K@- @P᱊3 p@-P@.^P:^P :00@ZpP(Sp0S0p@t @ O-$Mr@ P2p؀0 ht 00`01/ R!`j `o V {waf` 0Rx$ЍO_Lo `oVYEdc')- S'RV%AQPtAxQMtAtQJhAlQGV@Q=@P:A0Q7A(Q4RY@QQ,0cC:<S <s00?  V0@Q V V 0  0\px x0D X0@P(0 00R $ЍP0-DT!!?!3|@|! @! !?!\3&?Фri7f>kA>,%jV?lf?>UUUUU?M-Q<(M 00ş@Pp` $ S 02- 45` 0pW2oF`FGjtv!!j04 0@4P6SQ 0P V 04$@P,4b($`p 4[ 0k 0YFP#3I 3[ 0 AV  0 t#`pl32h#p3, 0 < 08 0 12 0 0 0 "2"2 0"2 0"2  0"2"2 0"2 00  \20g Z; 1 0V  0 0  -!1   0\!`pT1 0 0   0 0.V   0 0 0  0{ `p0u 0  0 0 | 0$ 00R (Ѝ0PPCd_ ?B.?v?˖dF?Y"$I?UUUUU?x ?xq??Q͟O-=\M @4P0 0T0=QPV  0K aV RPXSQ  0 ,[XpXHAAQ4a3qSppg  Sp?aXqXppg pS5<X160 x<VZ@ PZ@Q8<XZ  0IZ 0 <ZP ;4T 00R\ЍO* 3 0R V Rx+VZ @PX 4@P Raf` WQ꫿K L 0 0*X\:XA3CV :VZ:VZڬ  0 l:s "@P:Z |*p:T  YG0N @:G <*<:Y 0? 0N 0 5 )@91 0B  0< !P7 0 V   9 4 `/B BF*dfH d)VX)V@HHH@4 09Ȁ0!I`G" " 0 $ 0!00 ء0@P  0 " 0 0  0 0  0 @P 0 '7 '7 0 '7 0 '7 0 '7 0 '7 0 @P  0x 0  0 m 7~ "| P0  @ _  0Z 6g $e 0a K 0 [  0U P"d6@: \&P64 #C 0 > $&6' 08 !6 H " ", * 0' 0 P@ 0  " 0 LpG x4 !` 0  p  0 0  0  0 @P 0  0!0ğp Sڿ460@$4   0 0 P #3 #3Hğ ^<ğ   0 0  P $4 #3P3aV`Fj6WoF `FSfVAAP1dfafVa`f @ 0  P d3o  0} 0 x 4#43a 0# 3Z 0 j YH 0d !P@_ 0 Z 0 ? "2: "2K 0 2 "2D 0 * t"t2; 0 " \"\24 0  0)  0 1  0  0 0  0  0  0 :PC*RP 0 y 0 @P@LP@P804T 00R ps\Ѝ40??C??AC?u<7~G?D] T>пUUUUUU?+eG@Cy 1NEJ(~?eɓJ?A`t?M&Qo۶m?33333?@ ?[/>:@G<ː@4o?YnC.?9B.?9l a\ Фri7f>kA>,%jV?lf?>UUUUU?G- b@P2` Ÿ0 \000 0s 0 Q a Q 0w 0 @PVCZ5*PES 0 aP20!Pa_E4PE66 0 0 @T0dСO 0pAPXP pZW0`R0C2 h @ᢏ 00 q00:5@6P$0 00R H0G-qTdP@H4`00 084W0$W  P00S  03QCS@3W o7CW\#3 3+ PT J3@PW+ 8CW 0 3 1 0 F pP@5 83 3 0 3 pP@"2W 2 2 2 0  pP@  0 pP@p 0l 0h T"P2c H"H2u 0 [ 0"02m 0 S YI"2e 0 K "2] 0 C !1U 0< !1 6 !1G 0 . !1? 0 & !17 0  |!|1/ 0  w 0% 0 0P@q 0"  0 0Z@PA(0 00R Ѝ0D!!?-DT?u<7~??@?":? v$K{?Q=Рf ?n LE?$I? UUUUU?/lj,DR-ޭ?mt?q#q?똙?,2@- M@ 0`p@ \ 0ڬ\ڸ P P P !7!f!.00![ 0 00R + ЍЀ0!?<07@-P4 @00   0R  Ѝ00C-PXAQ*R`L1p@0000 10; 1QQ*`p06 B R 0Z) R UR46z5rP3 U 0 0 0t t046 6z\0 `p(0 00R  Ѝ0PCRO~>>wQlV?LUUUUU?23????ɟO-@)M P C p (Dd")$ ! 0C'`i @ V( Lύ`1@CT@ 0 0f!1`/Cp 0  Vښ1@?CT`@,PP1`?CРYK x8 N/`8 PEE 0 UύT1`?C LU  5* 7& 0 6 0 +W 0D1 gT`VbFT`0gVc 1X`k @7\P`V?0PU!TP`PTP`T0SWW W? D!T045 Dύ!T045T0V 0hU  HX 0   0PA 0D 0CT SR4/0h1T0S P#?( a 0ZF` 0f!1`/C 0 Vښ1P?C0U@  0 P,P @D1pGT0S +  g 4P x4 N/`4 @E0  U?Tpύ T p1T厯J 0   3 pGWp0l#1 ?C!`  0  V0hV0hύ1Hf?CX`$`P񏐤p 0!  pQύ1f?C@D  TV`p` !pGf/B 0WV  !("  p/1pf?C WV 0 YG?aqfoFfG ! 0 pWpGaqfoFfG ! 0! p W ` ύ1f?C@D v TV 0`0````pYLa 00010000 1 0 40 0d"0R `~ ߍ0l2p>p ??pAhO-$Mb@P 1`Hp0001SPg  0 0!1 !1 0 x!x1 0 `!`1  0 H!H1W  (!(1 0  0$ 0   0 0   0  0  0@P(0 00R S $Ѝس0|Z:=+Z>}W>a*??IUUUUU??7@-1< P@4  0\ 1 Ѝ0茱0G-QjqoF`F Vp0 @P'VH!H1 0P= YP@91P1UP@2X/ 0g 0P% YP6SF@3V VW 0F8 | |0L 0P YV@ 04`fV U@0P0  0 00R 00u<7~ Q/t:Pkl ?o/o0B0s0  P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/P8Q @-@A/Q  aB Qp 00`BSoq /oo @ r  S?C S?C S>C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<YN$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# & * Z>>*S 51:3`////SRQPM`-%Ѝ /SRQPM`-Ѝ /@-㸊@-@P`p1$Q$0`Vp0`@-@P`p$Q$0`Vp0`QO-`MSS@P1R=?oS cC0"S$xt  % SJ* SJ cuP  r X[PH*[H p\@pV 0 r0ЍR@oX d$xt%B  SJ* SJ cuP  / XYPH*YH poW g2N1G0> $t    "Ƞ SHp: c    | SJZ: c@($  "8 Y:SppWv Hps r0`4p`.H ph95'$x tH  ,8R0YOK':b60 p(S J*SJ X cP\R!41 SJ SHRK0SO-@ M`pP1R{?oS cS0"%Hu p n( SpG* SpG c ` [ x Z`F*Z`Fx`SooVy f2Z0V4z%Hu7 +x SJ: c p &0 sHY@pG:i x@'$  "( Y:R``V; pG`8RPoW3@e%u` w p(( SpG* SpG c x c @  [@D*[@DxSR!p`p ЍW g4k8% u? ` &HHS@J:@c . `pHS@`F*S`F@@c hY@pGs SJ^SJ@p@-0Ql@M`P@    a080800 00300 0KЍp 0@-S0` 0 ̗o* t wp pP-P@- J,Ơ%F @Zp p p010@-!p p 0` b0  @-|p p 0` b0  @-@ M   @@@P0S Ѝ@- p p0 0c~` 00က8@-qp p0 0cn` 00က@-p p 0_` b0  踕@-=p p0 0cP` 00က耕 0 R 0 0 \  YP0  R//@-p p 0,` b0  @-?p p 0` b0  谔@-)p p 0` b0  t@- p p 0_ b0  80@-p p< _a p p _a ̓@-p p 0_ b0  萓@-q^p p0 0c_ 00ကT@-p p 0_ b0  @-@0 00S p p l0 b_0 @p0 p 0 b_ @ᶇᘀX_@-p p0 0c{_ 00က,@-vp p 0l_ b0  D0D p@-@00Sp@ꩇP@၇p0_@-`Q@ PpP P 0D_ @0 %C Ppz|sPP p p`0._a0 PVTu@T@TVw@H@-p@-p@-p@-p p 0_ b0  <0 00P /ሏ@-Ap@-@p@-`p p0 0c^ 00S`輏@-p p0 0c^ 00က|@-Np p 0^ b0  <@-p@-p @ p 0^ b0 㐀@->q p 0^ b0  谎@-=q p 0^ b0  t@-Z p 0^ b0  8@-O p 0p^ b0  -0@-$  0` P @0S 6p p |0 bS^0 @ꛆ6p0  p 8 bA^ @gYQ%@ Ѝ/<_D@-%p p0 0c*^ 00က@-gp p0 0c^ 00က謌@-p p 0 ^ b0  l@- p p 0] b0  0@-@P1S A qU@-q'p p0 0c] 00က贋 0@-p p 0] b0  d@-p p 0] b0  (@-p @ p 0] b0 㐀@-p p 0] b0  謊@-p p 0] b0  pL0L p@-`0P0Sp@Ʌ@P᠅p贉_@-"p p(0h]a0P@w ܉@-p p 0T] b0  茉@-*p p 0E] b0  P@-p p 06] b0  @-p p 0'] b0  ؈T0TA-p0`P 0SAb @P8_@-p0 p0 0c\ 00က4@-Up p 0\ b0  @- 4Xp0 p0 0c\ 00ကi(@-&p p0 0c\ 00ကl@-(p p 0\ b0  ,@-@P` 0S0  \0 P 10000 0p p 00\ b0 Tp 0s00茆T0TA-p0`P 0SAȄ @Pង贅_@-@P 0S0  }\0 P 10000 0p p 00M\ b0 Tp 0s00pL0L p@-`0YR&P0Sp@ꂄ@PYp蘄_Q@- p p0, \0c 0  c9\ 贄@-p p0 0c \ 00ကd@-p p 0[ b0  $@-p p 0[ b0  @-p p0 0c[ 00က调O- tA Ml1@00(0 T10S(MP `0  MQ `PP p p   p 0R p  P R [0c 0 00  R 0[ 0 0S:  p p L0 b[0  0( 00R : K0$ȂH@-p p0 0cf[ 00က؁@-p p 0W[ b0  蘁@-p @ p 0G[ b0 㐀XlE-Pd`p (@\ ЍE` 0@@S Ѝ蘀_@-p p 0[ b0  蠀@-p p 0 [ b0  d@-Jp p 0Z b0  (@-hp p 0Z b0  @-9p p0 0cZ 00က@-ap p 0Z b0  h@-p p 0Z b0  ,@-p p 0Z b0  ~@-Bp p 0Z b0  ~@-Op p 0Z b0  x~@-p p 0Z b0  <~@-0p p0 0cpZ 00က~@-@0 00S p pp0aYZ0@ꡂp0 p0 aHZ @nᘀ@}_}`}@-YS3(M 0(P0! ` $P @PZ PP@:0`pP`pqZ ZkZ ZeZ Zd ZT !D 0p LD|sxswww@-P00Y 0 0 0F{@-sp p 0Y b0  {@-Wp p 0Y b0  P{@-Sp p 0Y b0  {@-$p p က0Y b0 瀀z@-p p 0Y b0  z@-tp p 0Y b0  hz@-@ T@-+p@-p@-lM0p  p@40@dW0@@P slЍ␀s-@-0p0  p0 0cW 00@ Ѝ/8s@-P@M0t00W 0 @ ` @p @ oop p @$0W b0 Ѝhrrhpr@-`0pk@PP 0 W000<2p`05mP` Po W0$0@-p\M p@P 0RW@d0@ ጄPp0 ᇅ00Pp 7W  \Ѝ␀Hqq0@-\M Pi@P0: S d0!W 0 ヅp P40W 0 0\Ѝ0pp0 0@-P0M@  QK 0R  PP000 P   4Ѝ0ohO-`dEP@Gp Hş 8500?S *S#:[S \S0S7   /S3 % .S#U- R 0U/S0S# W  ğ x400W Pğ @ğ   R 0.SU  0U/S  0/S ?X0S P?X*X X 0&0\X00SW  x#0 h# @[X W 8 (300 S  cYU<P P0S\  .\U  0U/S 0!S^S   0&ڠ\S  R X W  L 粐<S W0  粐200/S  Rs-S ]R \R 0Y 0Rb W  簐x!  0W P匰 绐@  YW 匀 縐  X]S R#.S, 0\S  R 0S# ]S0SW l \   S P0SP  /Pn8@-@P 0 P@m0U:m0008O-@$M0P00000qP/Sp0/S \ P`V 0 0 0ჅP`TX00000SZ`I 0  # 0qU 0  0DP[  kP0P%`( AiP0 ![:0000  S :010 00,0  0[r$Ѝh pz0-T0xg0-T0fO-PRMPQ 2 @ P 0 < 0 0 Sp` \ P Rp`p`A冀@B0S R` !0W   3   ;+0 7>=0@0 0;'>QC00: @1A0 010 1!wT_[_00.00 ;'> R 00; F?>[ @0YV?0000 S=000S@;00`V0Y0D0q 0PЍf($~)s-O- 0lM\0@ 0LWRP 0R 07 0 p00# 0r" 700S2 & Vl` 1 Ⲑ0 0i) S0 # A! B# !!" +@  + 0+DH 0+<00P000+,  X 0+,  T ` f(0+ QP Xp p:  :ppW 1 0 0;00 PP 90w P E/P}  9P`tEWq U dPP KE\$0$!00R 'JߍW0@Xwwws$6@-@ M0Q 0 0 000@ PdQP YX*P < A@) R ЍP@- ## U9@-@`P `#PP08 0 00000 00%Ѝp TwE-PQ0@-`pP00@ R3 R5 0@0DZ2 P1  00 R  @  D  RR00D0S  0P@PDP 0@@ 00  SP 0S:0 00 /M4R@- @00 0 000   8@-@PfPPPf0P10fP8P@-@POghp]ppNU` V E@WNYY?00D PNLsxϟO-@l?M M00l0$  t8 _bPP 002 000$ 0>`V,)N$0.  .  `Vڜ> $ c 0SP d )b0S 00fP 4p,`A0\l0 .Z )Z $ZZ (Z Z*Z +Z\Z ?Z [Z{Z |Z ^Z`0 S2 / CR  R\R  0Sr (S6 |S 7 R^ S1 0S080@dP$ Z jW pV `X P 0 j R 0J S> ; 0\RS0#  )RSQ )Q   S  R |R  R$< S 0S080cP Z jW pV `X P 0 j R 0 40SV  (0 l+Z 0?ZQ# 0Rl0 *Z (+Z?Z (\Z\Z S R0l0 ?Z+Z (l(VI PI S~ 0S080cPq Z jW pV `X P 0 j Rl0(P0S S.0 .0RQ l0 S* \  0 0R @ e  B e B P S3 0S080BcP& Z jW pV `X P 0 j R \ f0(Q S 0S080cP U PeWpV`P0 e R 0 S 0YZ<S080bP Z jW pV `X P 0 j R00 SS 0S080bP V `fWpXP`0" f R`S 0S080bP Z jW pV `X P 0 j Rl00^S000Pl0 (P^R0l0l0D0Sr 0S080bPe U PeWpV`XP0 e R ( K0ZS 000HpPLp` @Pl RH 0Vl0\PQ S P0Vl0P1 ! ]PDS-PYQ ]Q  Pc-P0C Q:S[Q 0C Q:S[QS^Q ]Q l  -R]Q S   ! 0PP qc\[PQ1 :RS 0Sl0 l0S  Vl :Q0]S R  0Cy>:Q0 08@L ]RI$p 0JK$ p3@ BKp3< {P08P%cl R  Rl  8P y1 ! V <0@ 0 1 $00 y1 ! Y%yl  Bl Y0Is0 0:P0 0000=RKSO 0Sl0V lQG 0V l0 =R]Q S Y0p0ͅ 0(Cy΍=R A ]Rp R YYS  0l01 " yl  Bl Y0Is0 0=P0 00 00.R[S 0Sl0 0 PL0ww PblP Vl .QY[)]P R  p  0Bs0΍.Q@]QpP U S PUbR  l !00yyl  Bl Y0Is0 0.P0 00@00f1 P! ]I `@(0LHpY  RR P H   0 <  S_ SPbr0l0?Z 9Z 1Zc*(Z 'Z8)Zr +Z<Zv >ZbZ WZG `Z BZwZ :{Z+ |Z (0 0040R (K`P/ 4 W,0 , b bp Ppb b   S 0S080 `P V `fXP`0 f R000,0 p `  0 0\+.W%S 0S080_P Z jW pV `X P 0 j R A00 gPPAa 0 B  p ` WpGpZ`^,z jyS 0S080_P X hWpVP`0 h R0  4! |  Sf 0S080u_PY Z jW pV `X P 0 j R k0  P!W  g B pS8 0S080G_P+ X hWpVP`0 h R` <  Sa lP{00Ql 00 Cr \  Yy ))l R,S 0\l 00 Cr Q  Zz **l RY\3/z Y  é/   \Sl 0R 0\l 0}SV 80 S PR`  ` Z PH`Z $S 0S080^P Z jW pV `X P 0 j R  f0lQZ 0 R 0R (  ^P0 u Z jW pV `X P  j QS 0 0f  0PB00 0 ;Z J  i 0   f 0*0_lP U P P7l zw` |S' 0S0806^P Z jW pV `X P 0 j R0@ W` US 0S080^P Z jW pV `X P 0 j R00 0S 0S080]P Z jW pV `X P 0 j R0> S 0S080]P Z jW pV `X P 0 j R0 S 0S080]P Z jW pV `X P 0 j R0 Sk 0S080z]P^ Z jW pV `X P 0 j R0 `SE 0S080T]P8 Z jW pV `X P 0 j R 0^0 uS  0S080/]P Z jW pV `X P 0 j R 09 Q0J,yYP^0T4 h0`0`d \0 " RY]&6 0CS`S 0S080\P Z jW pV `X P 0 j R0  ){P ){X 0  RS`4l0*S ^S   \S +R?R+S?S  D  \S@0{S=S 0S080\Pu Y iW pV `X P 0 i R0000PS] 0S080l\PP Y iW pV `X P 0 i R000 Pl RW  E gQ P]* S! 0S0800\P V `fXP`0 f R00]0PcPP PPP(0$t(00R |Ѝۍ0p@-`P@P@P1S,(P1SwYP 0 1pYPx@p`PP 10 1sEP00 A?0P (@0]?pp(ws4@-0 @@   @0  P0@]'4sO- M`3 M@p,0 P0(0 0080 D 80    @T Q U QPEA@Q񏐽"Z$/a`vu]\[X3'000G\Q*Q\Q*qPQڕqPQڊ  Q @ @ { UQ@tQQp@UD@Y^%i EPPd0 @ ā \%#%*U   U(! 80  4 M! 3DP804 P0Q< @P@A 1@/@-\Q0 0( 00R KL'0E-(1@ap Q`X0P0  X P P1 0 z00 0Z0 ؁@`l300020D 0}PPP U 0S p[PP#O-T_ ML?PD M0 `p@P 0H ` (0 0 0dp x0 0St h0 0 0 0 0 0 L0 T0 t100MT ML M M M M M M Mh 0S}PDp0\0u@PDpLPITp 0t S:HP0p03U0S DpD pH D0HPQᐐ DHpP8 l8p X ŀP DPp X Q00U0Ӭ SHpDX0@pp<0 1@a< @4p 0|p p p 4 P x QX0TV HP|DU00Q0S 8PP00<pP0#S | T00p@-@MP  `hP0 @ @00@@00 $@0 0,@0000 00(000@$0,80:@ЍpE-PT@MP`@ Dp @0 Pp cc cЍ,D h8@-Ph@h0@0p :L0U 88,P(  8|,D 8L00@-MDP 0 @8 P cc cЍ0D hE-PAYc0p@000p?0!0 00Pu`` L0pP0 h~h+zh`0ST Jp00: 0V`08D ,tuO-BMCM`|3@ 004?0SX39Ts0PpH3 0c*c03 01 0S0S 2020 !200ap2j0 v2`9 P* jleD2`00 `D Y`p:00 00A2p 9 g 0 P0P030# U1#Z  I9 9UA^" P"*PA> 0U*0SL100  0 h0 -:00100S`1  f09KP 0A900S `V000 9`P > 00 00 a99qb$0$00R $Ѝۍ`0D h,x8Ѯ!xuXtuD-@-   @ Ѝ/A-`P0p DP @@ 0P ?b9b 8b`D h@-+q p 08 b0   -@-0K 00, p0 0c8 00@Ѝ/8@-*q p 08 b0  @-1q p 08 b0  @-M p0 0c8 00ကx@-2q p 08 b0  8@-3q p 0p8 b0  @-~ p0 0c`8 00က@-/q p 0Q8 b0  0@-4M@P, g8Ml4Ѝ0 0Yd*@-@0@ [ 0@-@0@T[A-Pp@p `d0@\0 lafaH0P4   ^aЍh NEZP0 RD000:0m1 Rv7 PPR//u(ƟO-p 6TM @ 0P0L05P` V` 0S U P fX PEP1,%S@%Q9OQEQ?OQ@ a0Bs0S00A0S>QZID0?0[U P@!P,@ Rt00ؗ0 mk [sZ`p  0K0 00?I zR' 0SZZ([ +0d`F0$P0`0̵  <<< En t 0I2PP1XUZWZ@P 8WZ4iWZY@8@40 cA< TI<  d Q q3[O@@8@ P  dQP PqP3je[_]Pe0E0T<0@e8@0<0@PVZj gZ 7 dbB 0P@倐 d@ 20   q00 100S[ 1 00n0 jڐ@  0k @0[@00S  @ I`F0VY 0S40L 00R  TЍ$0NEuO-0dt\M@pX!0 SLP`0SV $0S0Ye?$`X!L R!0S`FX 1P%S0%S OSES?0OSP00Q a Br R# AQ0 >S00 0SV XP1`P0 SZ0P0җP  iPSP3  0̌J0 iT;6  P R T @T R[ 0 00S,X ዱL Z S -[x25T@0202 0 0 T RPTZk 150@Te10PuX 1!@TL  @Lꋰ: 0QQn10s 0#SC@0@p \ S90Cv>C 0CIR, S0QP Br XRL04 RDSd080d?2#v>C 0C 0 p0 0 @000  R@P\Ѝ4v$0 0@-@000@00@DtP U @0PDuP U P0 B @R:0$, :R  T0PvE-MtU4l5P0000D0T5P5@ J^D^<3N@PK,5`PHpD 5PP0P S@@@3 @15`PHpD 5DP@  PL0SC bP 5@P@D0 S@DH0 R@@ T35T 0S c:S@`4P D `,`0 <S06#@>0 P0@ R  lß Q  +R -R P Q 0S@0+S-S V 00Cs0 SD0>CD0 DDPv 0@-SD00cD0 "D0V00`0SYf<q0SP2X@&@@`0,SW @MQ2 0 0 2JQ@m!m!0000MQpN pP@0A 0pNwp WP' T% n^ 0S R@l0 R <D00/SD@P 0#D `V  0S @00 @30 30 00( (0 Qh  04] 0 00R jЍ0h v:xBxQxd Z`@-0P@NEO-PAp ȱ`@ ఐY   벀0! `0`f0V`@Y HV `F  <X`` Qp PBQma```  JAA 0`vn ` dFQAQ t000d000  Q a 0C0R0 0 $00@(@vvwA-p`@ PT0@L0` Y\S\h4  @ O\Ѝh ZO-DM@, 3(0bS00`0PU P0000$p\ (  V>pyig?Cⓠ*$Z I $$v   dQ Q 1`1` `0$,0 0 0C, , R `F`SaZӓ$0m!cCZ 00C1:#`` `0(`,$圁`؀`p!$0Ɵ`!Ɵ`!0` ?`p!0 0SR0<0@`  0<0s Y 00S  0e 00c`[ , Yg)V2<DЍ4w:O-@0Sp`,MP( 0R:c*=0c0 0 `00c$02 Z2P Y P㌂CFPt20  `(V(Y  v 0 dQ00q03< 㜩, 0X 㒼,, B QBcH D0p p  @@JQ[;T@D(MQ& `rP``:V ^`[a0 R 0 T@0ARd@T@D@W  0aSpT!ZW @ @ `p Y :,ЍX(wQ@-M@P `0@` ZZU x0t00P IGT0PL   D0Pp  ZЍ hh8wd@- T@TPT0@P vZpZ80Pp 0  jZ뿀< hd0 @-0P) p p a0 | Qp p p\ a0 4 Q瀀$  @"_ @^dh,@-x@xP@0S0ST0-pH0@ p00 00c 0 P ᰀd $p@-P``F&a V 0RV(( P @Pp@-P@ `0@` Yp`Y hJ^PL  B^80-M1 PP YЍp hd@-`L0 @DPD 0P YYP YЍp, h00@-M|@P0 p @ YY 00Cs0SYh) |P `@P YЍ0 hP00@-MHP 0 @< P rYlYFP mYЍ04 hH00@-M@P 0 @4 P YYSY UYЍ0 h@- Pp p@Tt0/@d0@簀_P㰀-p p 00/ b0  p{_ﰀp@- 0 0  0PЍSp@-@MP `00UP`P@ PT#!V P )R T0@ 0EP e 0  0PT00ЍpxH @-(Ml@l0@00  $00P0 0(0P$ 00R !(Ѝ0,S@- 0 0qP G-(`PPPPQ[ \p @T SpI QH10SC @0CT8>@x;X?010/T  8Y? C0CP@   @\ T:DHX6D X:S,0SW PE?\ @PT@P  pW000PgPpA-P( @dR \! X Q  0{pDPP`P`0 SP1Q 0/Q pApp<@y塁Q Q   0CS Pc 0S0  SL0.T 0  AQ 0Pa ЍX pE-`AMP!@  ! )R 0bLPPpP0pS`1R 7 Rr R & R*00H9D"R  0204Yi<S 0@P0`\0S|0).T 0 s0S0  BR0b\ 0 00R Ѝp0@-0#@-M BP2@ 00 9S Rs0S* !R S 00  0fp_ VS06B,B B QR#S0S* !RS CS R:DSsp#$#4``aV 0`0S` /0 SG SD BS S S*Cc/BRS h`(C BS_R8CSPE U 0SЍHwf@-pH0@DP0P`-P0PP@hLz1!0@-0 ) R P R7 Q)P*P)PAS@BP F F  ""@(@ BP_R (@R*/ P  L 0L 00 Q 00@ S0 a@P00zO-`H8ZT0 -I@ S LP @0S:?C:0S "TTP00P0尰@ 40S $3/P0,0I@2P0 S  @0S:?C:0S S,20 2 0 R 1P@ 0S:?C:0SS 0p0Z:000P00CSP0LPTL@ 0S:?C:0SS 0p0  D0P0 S  @0S:?C:0S S0000 R h0P@ 0S:?C:0SS 0pY  xYj?p@-P@Zpp 0p@* 0'@-  ?*D P 0S000$000  0VxE-818!00`HpWT0,I@S LP @0S:?C:0S STP00P0 Rp pWP00CSP0LPTpL@ 0S:?C:0SS 0pA-`HpWT0+I@S LP @0S:?C:0S RTP00P00 00hWP00CSP0LPTpL@ 0S:?C:0SS 0pQ:   0O-`HpZT0`+I@ S LP @0S:?C:0S yRTP00P0YT1D+ 0  80S P(,YX $ p W  00cS h?pP 0  90VC0p p尐pppPZP00CSP0LpTL@ 0S:?C:0SS 0pLE-Hp`WT0*I@ S LP@ 0S:?C:0S QTP00P00 xS * SS Cx0Q 0 00SXP0 <0Sx 000<000s0  00WP00CSP0LPTpL@ 0S:?C:0SS 0p-,0@-0$  0@Ѝ/ᐽ0 00 uL0 -@-  h @ Ѝ/ -@-0 0p@Ѝ/-@-  - @ Ѝ/-@-  @Yk* Ѝ/-@-0 0T @ Ѝ/A-PpP@`Pp  2p WUBPp@-M@P0@0L00\0@ 00 00 00(00,0040800D0P0T0X0$0`PP`$0 00R Ѝp0W@-@XM@@@@H@@T@!$   (,04@LPT NT 0 S 0C00 XЍ0p@-MP@0 P RR0S  R  `0`V0) 0  R RV PAj P,0t)00S ЍpL` h|0"0@-DM$@  0wS rS00 1X) 0  t  =P l 8Pd @1000b100P ))P(X1XA0@  0~RxR)PP") 0R )00@0)@T 0@  $0H(@TR)U0 PhP P CR=R000Q C 0ƒAP@0V0@@4S80S0( ?X=Sb8@Q TW`( W`,`@`S@dS7` SP PQ,ݵ SV? !  X 0P80`S 0-S(00`(0P PPpN(0@@fWp 80SPS PWS00Spp00S 80U PSc@`@ W@= Wpd~9S 0 03000 fXeSp0p 0S0%  0/Vp@[` p@ p PQS)0`V  P+ @pA0SbSbp` P@4` Pp@.0pp` P0@%ST2M" 0 `42 0$P 0b Yo313/Pib0 S:b` P U U00 0 S00`0X0 0( p  o P> , o 0 aP10S00T  WP$PT 1 #0KV`P  VP@`T  9 0P PP~@ @$0T!00R Wߍ40z^x ^dxld[@-@` !0P`0C0P000 9S `! 0Ap0PP ( 00S0 %P  %R 0P00P`ЍpPz8@-@PLU80P000P80@-S0?SL0 0L P000PSL0 0L P00' 0!R" L0R R R  R HR00 L 00 L  L 000\ S$0 0100S%0 0100S0c00000 00@0@ 0  rQ $R0 c0/ؗzO-TM|t@-pQ@P`0 S*  R0 p0 p P pWV00ƅ$ 0-RP0 0 {7@-@0P Sp64051:00S )OP'0s" 0 S  SxP0t  00  RkP 00C0@a }NP t>p@-P`@ 0_PpG-`0@HQ0SPPGYTD rY p 2 pW 0C! 00<0# 0Z W1 p0 pW 00 0  x0pW  NPp g;06 0000 yty@-p0P@`0S NPVT V !N0  0000 Xx0@-q0S0 BR 0H $ P% P SCP 0PSU0PU0\0 BR R0 R0B0~8@-P@80@-q0sP'  BR H3 $ P% P \0\0\0P  BR sR0 RB0~0 R0C R /0@-q0S0S. $0H  P % P  %|  R S CP P  R0R  P0P \0\0~0@-qYt0S0S0$0H  P % P  %  R S CP P  R0R0 P P \0\000~00 R /p@-P`@xPP@Qpp@-0SRL""A0`S0p0PS0p0PQp0S0p@T 0S0p BRS pR@-0="A0PsP3 SPU0p`s3SQ 0Ps3SQ `0PsP3 SPU l@T  0@|@3\@T c BR cR0@-0@"@T@ PQ @Q @T@ \ Bc 0 0 R0\ R0Q@-0# RS``00p  l00S 0\ LS0 @\0T @0T 0 R 0\:S``p@-q@0TPp@0PPp8@-P@T 0S  R  R R oP008@-0\  @T0\ A-\@0S0 S`Q0  R#  R R  R R Pp@CWRp @TR@P pR@-pPp`@0PSPP P00T00/R R/0P@- 0 /\\ @/T T R /Q 0 /R Q  00Hm|{@-@Yu0 \0/P0 @-0R <@@\P dlh0A-0@PU U @`Pႀ`pPW@Rlp@-`MP9*@P  p 02 @-@0@Tk+`00@-0R \ D@P@P@T0P B0(k\/ \0S/ 7@-P|P P p@0@Q@0CSQD 00 00?$@@ >xj+{ 0 0 i+0P@-#0(| ~0*0 B@+p0Q5ĠP`PDjZ@P0@i8@- @P0PPD0L0000H08O-@eM`0S  2 pW 0S p9#90-bL00S L0 R  B  Br R L00CL0p00SJ 000(5  PP 5T 0 08 :P':aಀQሀರ0S Pq 00S 4 0 0 0S `0P 0S0 PH:0S  `P;0ᑓ! ;0! QL9 =;0DZ3*00 Q? 0#  ;Qᐑ!0!Q '<3Y 0 0PP[?0?:0S?00PP|200+ RR  ;呒" 0WX L AH0R&DP0P (PL\20 D  !+PL020[  p0H 00D00cL 0D H0L0UL 0CqQ00L00•P…0L00e0Yv 00 R R 00/   R00p00P?P0L R    e PP)90") 0S 0-C9 BR/S 0,*/S 0 0;0  S+00S0C0a0 09#9S 00$!Q$0 00ЍhhfeeE-MtAPp`h1@000X10:0S 1RAS _ 00S  S 3:S 3:S 3:s  Q*?#3AQ00 0 SX0  CT00 :0ZXHP00E 0 00R 3Ѝb0{A-pPM0P0 :0S@   `0Pc P$0@0 :0Tލ8aA-`A|P@M0!p@ < PRPEU R 9   ?@P .W`bP`"PV  `00FU @00P$0< 00R @Ѝp`0H{4`0^> 00000 09K0 00>0000000/0 p@-@P0`URUI.p R0 0 p^{_D0D @-@M0 @0<0< p30R `@ЍP^00/0S0/:-0S :A0CS00 0 0:000H^:-0S :A0CS X0k 0 Q0100100:0]@-@0 00S  6p pt0aB0@:6pYw 0   p0 a0 @V:ᘀ\_H]] 㶳@-,MP@ 0 pP00$0婳`P0 00000 0 000A %$0$ 00R ,Ѝ \0@- ↳PQ@- @ cdi% @tE-QTQ,Mp@H1P00$0 Q Q  1000  `100000 0 000 G4XP0 0:P00 00" 0 0 P00  0$ 00R K,Ѝ[0`[ZZZ@- "O-MAP1@`000>P\1i00GP> `P `08@80$ 000S 3/8ЍA-0 M@R$P  0W P (00 `  p P0 0 Ѝs@-P`@} P`  P  P   P 00(0 `0` P|LR@-PQ@AMp81@000P  0S 0o` 0 0-`0S6jp0_b `0 00` " r  r  R/   0jV  / L @  bR  0 00R ЍQ0QP>Q@QD0 0<\!0/ R /PP|x@-9@L'@-@0@0@O@-9@0S A#A-M,AMp$1@004`P6 9 Pp30p S S'p p+p 0000(0$00R rЍۍ|O0x@-@0@0@8N@-AMQM@p1P00 4`Pc 0 03/ K@U|0@SBGFE B8?5=<;:9876 p+  !0pp!TPX2p 0SpFW@ >  Yypl @ 0000(0 $00R ЍۍN0x|yyx3y@-@v0@0@K 0$ /@-0L3//A0Q  &'/8//  . /0$0 000  B", $0 @0 ", $@ <0#,,<!$40/ ", $< /p@-P@0S -P00S L3/%p@%O-pDM P @b!d`!XP@ 82P0` 000r0S0  }P 4* %%d0S0 P <P0 T8 0 0H @1000P >00 0Lp7000 0 0 0  P0 S P003/P0H0S 3/p0hl 00\0000 L0@``K9%7% DЍIHy\ILO-DM P0 `t p0LpB0Q @0h R0S X0L0$000C#,0,<!$040P0H 03/P P0 03/P  003/P 03/P$0S0$05 \1 P XT 0S 0S$K0L0,1 00,01000 P:  cP$P 10 S $$0S  003/P0$00(0 lh03/P$0S0$0 0S 0L0UY 0 03/PIq$DЍ4G@-@p`PYz  p04 2 `  (  $ P`pUE@-@` Pᢥ0U'2 0000  p0 P0    R  P$ p   (   pP P h0(00$0P$0 00(00$0\D 0P80<003/X0K  <003/P  003/P 03/P<003/0X 00002 P 4 0000,\Q0 3` 0K  0T0 05KTK ìp P PlP ` 0` 0P=YE` ]E@3U VU3 00S4[O 0` 0000 PP) 00` 00$p 00.000t 0 p@9p@-P@P  P 0S Sp03/pP p@pE-P@p`  8/P p`V:O-Pp`(A04P@> X ᧝X0S3W0S S-X+ Pp00p @ p;/@YT0#03: R000 \&z@-0  3/Ѝ/@-0S00 S003/S7@-P@T :T  !0Y~03/ 003/P00>7@-P@T :T003/P00003/>s@-@P`U0000003/P" 0 03/PU003/P 0 03/P  0 U|s@-@P`U0000003/P" 0 03/PU003/P 0 03/P  0 U|7@-P@T :T  !003/ 003/P00>@-@00!WP00@-@00!gP007@-P@T :T  R  !003/ 003/P 00S00>p@-R`@`# 0PPeS :S003/P U 0T0 0 03/P U 0( 0 3/ppp 8,dA-P@p`P0  R @;8@- @P -p80S S8 00c8, 000c8p@-@` Pp `fP P 0`f0V0V`53p8 4 ,0V 00fS(S`f ,0%4`%p(p8@-0@0P@0S00S8<,0@-Mh@ dPd0@P (LP(PP n300(0 @00(Ѝ0@h<,@-`p@ lPl0@P ((P00P L3<V3,0V@0 0(h<,zE-R(A`0MP@p0"@39:00 ( (00 R00P 000pG00p 0V2P 0@ p pp=P4p4pPs000@ 0@v(,00@Ѝh<,z @-(@O$0@. 0<,O-@Mp`̠ 0@P8 < F( @(00_ 0SV -P  0tP @0@0S# %(P Ѝh<,@-P@@`80@   0 Ѝp<,O- AMp` 0@P8 < ' '00 PP QV P  0P @0@0S 'P Ѝ8h<,@-P@@`80@   0 Ѝp <,@-8AtMp01@,$00l0 p0YS 60c 0$ p p a( pQ(`@+P(0S  P6 0P P00c8$0$0l $00R tЍ 0z  @-@ߞP@2P 0 0 %Ai/p p0 0c 00 S p p D b P  pកh  z d $0P0/ 0/ h@- Pl 0S\00P000H@@P84 , .D xL hgA-(M@P0@00$0`PPP P|0n p00`S00p  0$ 00R (Ѝ 0  @-,M@p0@00$0PP ` 3 ͞Ppp 0$ 00R ,Ѝ0p@-P@@WP0Sp@NG-M@ 0P}Pp+0 S  ^ ^\ \ a0RQQpWP`PD@1i 0 BT28 0Q( 0Q$0S- S B0凑L^;;P l 0R\\p000 c@Z R RPU1QP@Ѝ@->@P@0 R R@ R@0SM-@p M0pPk00 0 00M$0K04 K0`P$0S "P `      0 0B 0 Y00R K@0O- ʟM@0 `: p00(0 0S S00010  |K: R0SS S R 0R 0 000S0So uV|0K\0 N 00d R70S M0 \0 qPc \P\K0 R R R 0R Mp 0RPp  : P0S\ |0KpR7)M \ 00000 000S4s0 0%0S 0S\ K M 0\0      M00 0S0W (M ` 000P 0SS R `0  `0`V<0 0 Mo%PP` `  P&0 SS``U 00  0 0 S 0S  00S`00S dK ``:d00S`00S0`V V``  0``PKF\P 0 K0Mh0K0l0K00P "Pl0s P l`v50`V`PK`# V``h``PKVQ(M     h   Ph 1 aV0S \S MV0J 0  B ㈀0 K0Mh0K0l0K00 "Pl0s P l0s$  S0& S00"h0SppQ(M     h   Ph 1 !R00SV vs`00S-(MP `P {0S`0(M q0S S ` 000D0 Y`0PY0SS00030\`P000 6 l0h0 ` p00 RM00h0K0l0K 00K`;"Pl0s P l0sX" 0 h0SX K.0)Zq F 0 \p S R00 0 U0  Y Y J 0  P@ K 0 Y ``00尒00 00000 R0( 0 14 000  $ (  Z0    p0 000 WP@U[B  00( 0R : KP0|<Ā@-@PO-`PBLMpP0@ 0*S0S`W 0*S0Spv3WV UP d C>0SW 0S @ 8pD@0<0S8 0 y08 <0 000D0p pQ1D@Q0 S SJ0 $ 1y000{Y0 Y0  ` P@1 00S00|0!S " W  0 S  0:/P 0S p  D^j X0Sp@Z 0S DP   [R [kLЍX @- @P8@- A Qt\0 L“#0T \ 88@- $0|@0P 00P8,0@-@M P P0  0* P  00" d P00Ѝ00@-@,MPP0030Y0 P0W010 0 000Q p 0#00S ,Ѝ0O- 8LM@03 h 00(0 P3PU*00M `D `P  00` ,P S0 0`0 <0KX0 0T0 00KP0 0L0 0H0 D0 @0 XK pt200S P80S@ 0R uy`0pPp`0W*00M 0RP  ZvP\ PP`1h0` P0,P 00[PJ p Wp W\0 \#R(1 0 30 !0c 0,  b0Q RR0Pd0   pP 00 0 0 0S0 pppd0Sf Z  Z  0( 00R  K0x\$ 9O- DM<@K0L d <K0(0 Wd R00P@& P40040 P0@P@ p40 S(. 8 ^ ^\# \  @겠FZ `` f\`V Vp\P `0RPP@TP@p  0U P @pP!00M P 00\P `@ H0 H HXX  80RxH 0Rs0S S[@@0 `F P PD` @ 땐%00C0`F0CS5!10/'V, (! '`0 0020 0V `% _`0X005T000S p 00\  p \p 0D00cD D R`VVSp`0@儠`FP P@0@ 뚐 T` U㚕$0PEš 0`0YD @0`0 DPE0`0CS񏐤-b 0ST 000S SU~U . 0 0 S 0S00S{00xUud 0S TT00 0 0010S SU XGUU $ 0 0 S 0SH00SD040AU>-0S T T00050S SUX)U& \ 0 0 S 0S00S0l0UV 0Sp 00D T000c T D T RD0PUU@0 S  @0P @0㓐#00 0S$ Q! Q Q800 <0 Q0@0  S R Q Q:  b" 0X00cX X R`VVsH00H0 HQe`  R0P@!rC 0⒁" S:@0s03Q0S ᒁ!/d R@@0PS*H P`pi@$(  L $03P03$ $ (0S@T  0<L p3L Z00 S0 <L00^3Ls  `pPLg 00"TЍ {#{*{QO-LMPpx@t0  06t QP @D8萎Uv0E-0  $ Pa`bU@@ PpPaP@T f p`@T Q\$ 0 $$0` H42O-HPp4M8ȟ@0 8 :\PQ   0Sx8t`0$0 0 P0-S00 +SpP00Y& 8 0 700S 0Sq'0 $Q$ '0 Q Ŭ70 R $ Q 0R ip70R 0X'00L70 S!-Q R ' $07` Z  @P $0R  S ;6 $&0 R $R 1-QQ h\  0 ~X  -Q  ( 00X 600 -R \0S 0S/P50000=SS00(,` $0 P.  0 pb P 0"W 0 p P 0 ,(`0V P` \0S  0R 0R 0R $P0S P p, ($SQ Y l4l 00@dPp0000/Va  00 Q& QCY 0!0-S30 00  ඲pSPpc 0 0Q S00Y ,380 1癲RPF 0 0:P:?RPp8X0Q  S \0S -\  TP"Y 0-SL20T 0a  0( V1 0 0$ā  0`0&0S000:VPY x100St100 0)<10 `?80:S20:S1  Q     Q QY 0 0000 ``:V:`?`10`0 0 <0@ 0 d  0 T  0Y%4Ѝ\|L42CjQ{o{{{{| p/|I|c|D@-@-@-000s@-P@@P`P00 cR  pR  uR 00 0P0!0 Px`PP0\,PPH0@ 0PU|JD||@-MUPPOMMLKJIHGFEDCBA@?>98A>59=07.-:;8:'2583('&#*#"!!mlkjihgedcba`_^][ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  gfa`d@y1 0 X~PS@TH3$A!iHg@.@c{*I_O]A[IYxK`P@!3R !p5R <10 0@ᏃPۂ}@T@7x@4J2}O0@.@,A*@(@&@$O" @  B p@@@p@A@ @ c@ K@OKL@Ѝ輂li| 8@-@ @0 R  00wP Y0 0S P0P000@f0008|\2E-@@0P`` 0@@0 pp` 0 000404 P,00 P00,||\2I7@-8@80@00S0@0P00T{\2@-@,r$Ps? 0E|@BO- c M3`00(0 1_L@T+  0S:?C:0S0S 3/MP PU P p@ 0S:?C:0S "P0U2I@p0 S  @0S:?C:0S `20T2INHLh@xp0    $0j$40 pY.2iV0&10S   (4$4100 L P T 0S! 0000 0S 3/0 P Ud1PED1$0  BR ; 1@ 0S:?C:0SS( 0p!00S 3/p@ D0S:?C:0SS  Q  p0PU$0 ( 00R ~ Kz0_ y_th2@-P @0S:?C:0S ~ 0p @0S:?C:0Sp0p @-0  $$R(PpR(  0 0R S~대Lv01@-P!0  (D$Tp(@P!R` C p  bj r`pb&Q p pD `` 0 0R ~u0uuup@-P,aP(M0 !`!Y* $ 6 $I^@F RP0`0 2@ 0S:?C:0S 8 0 P+w0S } zPP (P UPP (}$0$ 00R }(Ѝpt0dh0h H-M0  L0S 0Q KH 0Q }K\s0dkA- DI@P` 0S:?C:0S @ 0pP 0S A- TIn@pW$  @0S:?C:0SPDp W0 2@ 0S:?C:0S 00@, 0   0/q7\P0P 0 4  ,  $ $ 000/dqp@T\@--0K0 O-Q1P0 R0X\ Z `!`1ZI 0P ‚ S:C0J @ $p$1 0I (p0f} p p0 P>030300#1. p p0(E45$ 0s0T,D @ o됤 V!3 ЍOs @@`0pp7$0$ 0  0, /n@-@, 0(0, 1    0 c@///Q@-03/8@-`0`P`@Pc@EQD0PE013/U400S 3/ 0@0S83/8n<p@-`0@Pp@p(Ppsmnj@-@0@0PU.*  PP  V`V |0 0wp 0" 0" 0P 0 0D  0<00S o,0@Y?T gXm1 <0UßP3@-M  0!  2!0  !2R0 !J x 32 0@@0S@SJ @0SJ%@"\1 S:01s 0w@vTv@vT 1s !S1!R SPM@1  1! 1@3/x1 p!0cCT:U 5/@1@3/D1@!0cCT:010S Հ0010S Ԁ00tPI>@ !$! 00 03/ 0 @D0S:?C:0SS p p H0m b0 ,Pl,<X i 0 0- S00ii= @-J0 0P @ R @ @0S000T0/@0PP,0,000ih=ihh@-(@$0@0P0g=@-(@$0@0P0g=@-(@$0@0P0tg=@- @0@0P 04g= 8@-|0P @0T8d 0T80 0 8gf=@g0 0 R ydfH@- P%p a` {p000S P@P 0S:?C:0S @@PPEUP s sd0P@ 0S:?C:0SS 0p0ff=A-HMdT `@pP 0S:?C:0S hY<TP0S  @ DsP00C0X ;sP,4"000C0@4P@ 0S:?C:0SS 0p08 80yPCS@P 0S:?C:0S <  BR (30r r202P@ 0S:?C:0SS 0p2@ PPUPU, ( (T@ xp p@82@d0@@T@@  r2P$@p0p0r r8 y1@@0 qs~s @Dzp 1n00S @0R 0D0U (Q@P 0S:?C:0S {PP@@DT@  Xrp Srp8 xP 0D0h0P@ 0S:?C:0SS 0pDHЍd=dccblfHXa`0p@-@P0P@p@3 < 0Sp@HP@ p_|_@-Pʠ,ʠ\ P0 0 㰀@%Vp p0 0c 00ᰀ__0 - b0 p_o@-DM0lp  p@40@d0@@P DЍ␀ _@-eM@Pp0@001Pyp Ro`PP0 0 ᄺ 0!00R Bxeߍ$^0x^@- /P @-eM@`P0p@001yp A`PP0[ 0 P 0!00R xeߍP]0]@-p p0 0c= 0Y)0က4]@-p p 0. b0  \@-DM0kp  p@40@d0@@P DЍ␀\@-p @ p 0 b0 㐀P\@-[p p 0 b0  \8@-PL@L0@P'P,0U@ @P@8X[H>@-Kp p 0 b0  t[@-cp p 0 b0  8[-@-00 0ASp p D00 7p p $00 b @ Ѝ/ZZ-0@-$  0` P @0S UU  p p|0a|0@p0  p8 aj @@ Ѝ/Y_0ZY8@-h P@y && 0 000000000""##8080$$H H0P XPP0X@88@-X P@O `0 000000000""H 00,08000@04080P XP@0H@88@-X @P' 00$0  0     ,00 0004080( 0P@0H@8O-PT $MH0@p( M `  pp1pg0pK)!  Y 0 0#KwT0 0 !K  @!<0 8  B!8<0` V:e 0( 00R Kv KW0PWV0 0@-P0M@   0R  PP 000 P0S Ѝ0Uh@-`@P  p0`000U" 01bY) P0S @T l0. 0 000 0040 0  ЍpTT [S *S ?S \S ]S QR0S///8@-@P 0 P@"0U:0008@-@PE-P`@ p`P@0 00ἷV 5RzO- $ğM2 @4   0" 0(0 M@0P/᪡2 `Pqp ሷh01`0/S "r3l 0/S0SPS82 x$3lZ0X X0SKxwP 0: S 0Pf >[f  >f  ᔱ> Mf>Hf >f 0 X <0>Sfq 00X R&(P000S0#  t!oP0| $  h00 RT0`VcH00 0ЍJ,JhUJ1|$B!HHLH8HHO-`PP@p R$ 0S0SQ000S 1000 P 000 0 0  hĮP    0P 0H0Cs0\S0!H0S 0:0V0 0H R  R4 5::@ PpxO  !8 0 ⓵0S R .0 0JY0Sa R XճPH0 0 R00 S00 ]Y?0S R Y0YT @-@P0S [@X808@-0@P P@Dl@P0Q0D   P*=000/ /Cz 0 0dC>@- $Q`@qPp9Q q!0 S P S#p7Pv~ pW P e0 Ce0up?S 0U@EpcW?00E  e0E 0e0T0PD0D0U0S 0@0S 004C@- 0 0O-PPLMpD PpP5@T@(lD`FV``o6kD V*0qT 0 &`@b@``V? ⨀ቜ*ᩜကdT@刀T `W0CPfUSeW 0 00R qЍA0B8@-@0P(0RQS $ 3/Pʰ00080008P88@-@`pPU$ ,0! S $3/PP``0 000 R R ! Q  R0` 00cPpeA-`ᰀP@>0 ps p`Qp1 0pp4p`Q$ 0000 (   P" እP Pp1p! 0g `ḱP `p``Pf`f` 0P qPP A@-@  a`0000@-@0" 000  0 0 000   Q    DP0000000@  00X>R; S   Pr   Pr 0 S   Pr   Pr ?/ Q / Q 0/Y* Q  /O-PKMp; @<0 0$ `aV0e0@( 0 0X0080X8800 0+0 0000x0 0ffP0x03  0]fP  0e0 XfP0-0 0 0`4 00 CfP -0Q0D:d 00fP  00P0p00`Qt0x0|p0x09x 00 x0 aV9 0 0 $0 9 4`0!0`00$00 0 h`d94 $$e̠\ @P 0T0TPL1 $ d!eP`d $ e$eP`P@ p P !@eP\ $p ` ep `$  Pd 0 fc!Pd4 0h 0b00 'bP4X`V `$`Q P0ݕ PuP 0C0͕gU00X0SHfU   r 0`# 00000R p000S3#0q0s00S0 p/ S 0s0aS0 9P݅IL Å0CP0Qa0Q0`0gUVvQfofUmVf0 f c p tx  Z c|p O , % p R% QZD b0b  0ɗhyPpPD0,pb( X, 0 b( p p Zp | 0 iZdpڰ ㌠ x$0p  Zdpp 0 j$p Q"Y RaUgU Xڀp    #  Y0# d) p j #   pYp  0 pgU 0 8\  jZ0j0L3000 pfP$ aU0V+`f-P  0Pb0h ya U`0PP HHB0Bp0( p( t0 S a:0d00 P( uP 0S0l aUh0 pQ 0 0h0( 0cS  0 1 000 0Rt h 00t0h0 dP|0 [ U R8 ,p`X@國($D@KT" V < 0@_@00 R/ R/  /@00 R/0 / R#R/G-~M8D84@001(4PU   4P@P@ Q  30S3 00M`PpPົP3v ሻ  P <-5,-  Pp0,=5<=RsPa vύp.ppVP zP '0C0`|"0SdrRe\2P0 P+ 0 P 000S!KPU :~pP =PQP 5PhQPPV_ Paō(10S@P1  0   0pPWX`HPWq.;0P 0S `P 0P0`00800S 3/ 0!00R V`~ߍ$0_ } >_l}_&}^__)r-}p@-l@l0@d00P L 00H 0 `F`,0,P`V`p____G-p@RPM0P@px0|0L0 RQQ`  .0pt0 Y3p00 ` 0L 00R _PЍ0@-0 0 0$0 0(000CЍO-LM`p P0@tP0 "p " 0 p0 (0Px20 0S S sY8200S  2ݹ000 +pXv  H pg0b0c\jp`  P 000 0p0@p@R R  0L <00D 8p@00P00= 0S001@0,   \"C(J J হ 0 㞹 @0Y0 1Y ǹ[ ` jp 000` 0p@D" LЍPD0C-St 0@@! 00` @0`HpH@$@c&PPPmp@-PP@`p-P0P@ `0pp@-P|@@A2"S S 0S 3/0S 3/ 0Qp@8<>@- @0@0P GA0` RPP|0 0 0P00X X0  @  0R !Ѝph<>02@0 @--p0,P#(0岸 0  H>A-Pp p@l0@d⠸0@@p` 0 0pS ⮸0 p`0V:@-DM0jp  p@40@dy0@@P eDЍ␀$0@-` @0MPp  @ 0R  tP0P0 0L0P000 @!0 Y)PS TЍDhp8#8S@00@0s0@0s0@/0s0/8@-$@$P@0S08L> 8@-0 @PPL    ( R8!2/8//O-M@P`  00F?00 p  ]0 03/PO 0#,,<!$400(#<"XX η 00 !*!*   (Q / *0S:01S0 ƧP0 0忧,@0T @0(@ $ ( 0$ 0(@@@00S 3/Ѝ6} R0@-00000@  PT0@@\RP  0S010 000 0R  000!00 00%00$00)00(0 0-0 0,0 00 0400?00100S1 00000000?0000 04 0 04$0 04(0 04,0/p@-@P`Pp``Vp 0      p 0 0Z}O-M@pP`HW008@"p0a0P 0 PPD 并t1P0pS<00pGpp0000p= RD R  P/gP Q%0V< 0  0<0  PD 0` 0@ V P0` 0D0@pH0 @ 0P R 5ЍpI7E-@`.ԝpPPd᝶PU 0H0jU* P  WY<W @T 0SX0 0 *& *Z>>*SJ51:3//// 2RS"|"!R/.&/* b b<055 320:6//QRS00 /Q//0 /QRS00 /Q//!/D//@-0S3/O-LSDM@p0` 4 t4900080WP 8'X< P XH@ P0P0Q  Q  00S+ *W  RP0cP [ 3@ < @S DЍ0W@ 8 Q SP W%R 0 s s< S/000 P<< QSȠ900 80 80Q(0S@@R  RZZ~ p] P0 <  P6 Zp p1$, P(` Z`BpQ  0 0< Pp <QP000 P p Pp$(`, \- 0g(Pd0( 4, 000S%Zp8 (P$ Fp P$(`,p8qq PP@P208 <0(P $0*  Q@@l<000O-M@A  0Sk   P  < Z< J` ࡟0!qqZ PQPE pT'*V! CY!! H 0S00 S11Y?LP0S11Ѝ T`0LP0S P P Ph T0 @0 0 ,0`ʡ <DL(P0@-@ HZ0  #@zHJ0M0L0<0A-@0p`M M P 00@:P4@7/ P P8/ PP ߍ O-`@PIM M嗯 U ` P Pᖟp` ` X`P 0  ;/PV  -ㅳX P`V  -v J几 Q0 P  Q0 ` Q`0``!XAU8 `W}`#!0-pk8P 0 0EaS0 Q  P0  P0  180;RmpBfP0R X pq= 8 !W`eni` H S488-! /! / / / / /!1AQaq/!1AQaq///--0 --@HЍ/--0 -X@HЍ/--0 -G@HЍ/--0 -0@HЍ/--0 - `@HЍ/@-2@-0-M 06 L 1Ѝ-M 0' 0HЍO-M p`@ R* 0S  0C 00 0#\4U0  RH R, R7 Re R PP '0P ЍB00 p @h  0p  RR 0p0 [ . )0P  R 0S   0C 00 0#,T U 0.(RP BUk U U{ RB 0'Pj Y  0 @@{  0@ U. U R U Uw R 0S  @ C 0@#̠4 0&0aP1 [0Y*'0WP' Q R 0S  @  C 00#,40&h Rm 0S3 C 00#,40( U % R~ 0S  @ C 0@# 40 &=0 pQg 0Sn PC 0(#\ !  RΌ  0SC P 0(#\   B0 P Pό 0Όp B R+ 0S C 0#,40 0P  (0Py  B B3 A0 BSB P R 0S  @% C 00#,40 & B -LM 0 $ 0 03Ѝ -L"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlB.?B.v@?Oag?-DT!? s?-DT!?e/"+z<\3&F<`Qx;9@ %z8"6i5infINFnanNAN.,$@Y@@חA7yACnF?O8M20HwZBKOWbjv ")5:AIMRV^eipx}GG$+18?HQY\bjou~-)[[[acpidaddgroupadduseradjtimexararparpingashawkbasenamebeepblkidbrctlbunzip2bzcatbzip2calcatcatvchatchgrpchmodchownchpasswdchpstchrootchrtchvtcksumclearcmpcommcpcpiocrondcrontabcryptpwcttyhackcutdatedcdddeallocvtdelgroupdeluserdepmoddevmemdfdhcprelaydiffdirnamedmesgdnsddnsdomainnamedos2unixdudumpkmapdumpleasesechoedegrepejectenvenvdirenvuidgidether-wakeexpandexprfakeidentdfalsefbsetfbsplashfdflushfdformatfdiskfgrepfindfindfsflash_eraseallflash_lockflash_unlockflashcpfoldfreefreeramdiskfsck.minixfsyncftpdftpgetftpputfusergetoptgettygrepgunzipgziphalthdhdparmheadhexdumphostidhostnamehttpdhushhwclockidifconfigifdownifenslaveifplugdifupinetdinitinotifydinsmodinstallioniceipipaddripcalcipcrmipcsiplinkiprouteipruleiptunnelkbd_modekillkillallkillall5klogdlastlengthlesslinux32linux64linuxrclnloadfontloadkmaploggerloginlognamelogreadlosetuplpdlpqlprlslsmodlspcilsusblzmacatlzoplzopcatmakedevsmakemimemanmd5summdevmesgmicrocommkdirmkdosfsmke2fsmkfifomkfs.ext2mkfs.minixmkfs.vfatmknodmkpasswdmkswapmktempmodprobemoremountmountpointmshmtmvnameifncnetstatnicenmeternohupnslookupntpdodopenvtpasswdpatchpgreppidofpingping6pipe_progresspivot_rootpkillpopmaildirpoweroffprinteY<nvprintfpspscanpwdraidautorunrdaterdevreadaheadreadlinkreadprofilerealpathrebootreformimereniceresetresizermrmdirrmmodrouterpmrpm2cpiortcwakerun-partsrunlevelrunsvrunsvdirrxscriptscriptreplaysedsendmailseqsetarchsetconsolesetfontsetkeycodessetlogconssetsidsetuidgidshsha1sumsha256sumsha512sumshowkeyslattachsleepsoftlimitsortsplitstart-stop-daemonstatstringssttysusuloginsumsvsvlogdswapoffswaponswitch_rootsyncsysctlsyslogdtactailtartasksettcpsvdteetelnettelnetdtesttftptftpdtimetimeouttoptouchtrtraceroutetraceroute6truettyttysizetunctltune2fsudhcpcudhcpdudpsvdumountunameuncompressunexpanduniqunix2dosunlzmaunlzopunzipuptimeusleepuudecodeuuencodevconfigvivlockvolnamewallwatchwatchdogwcwgetwhichwhowhoamixargsyeszcatzcip3!#3#431AC3334!4311333$1#DD3"A3223A!#"#$"111#3A21"4"2122"#"1!134332$11!D343!3!334!44333#12C""313C333131#"413331#13!333x5x 4c< 6PXX-< L<9L(f|X?X $pHXKLS,\!X%Zl+d# .`5.l3P4< | \5ffPP7E$F `H;| G ehhjFH\\xIH$00%l| hT o$$JodL5Y0tsMx]|grt\ pdPl` |uTH<0<(((RH\ R U00bhhph  ti4j4h$k lL T\nh=do؟tp0T> @CH@$ swDH{ x{(| #$F$p|p}D8}s,~LZ 4*P~8f4chhh\fh|   Y) d((,(KL/(-\\,t@l@0|@@ HP7(.h,b(PBȧ THPcK <(Xmemory exhausted0123456789ABCDEFBusyBox v1.16.1 (2014-01-06 15:25:12 CST)(unknown)permission denied (are you root?)/etc/shadow/etc/group/etc/motdcan't create raw socketyou must be root/var/log/wtmpread error/dev/null/etc/gshadow/proc/self/exewrite error/etc/passwd%s requires an argumentstandard outputstandard inputdefaultinvalid date '%s'-/bin/shinvalid argument '%s' to '%s'PATH=/sbin:/usr/sbin:/bin:/usr/bin   PLLPPSFREQPPSTIMEFFLINSDELUNSYNCFREQHOLDPPSSIGNALPPSJITTERPPSWANDERPPSERRORCLOCKERR @clock synchronizedinsert leap seconddelete leap secondleap second in progressleap second has occurredclock not synchronizedSCHED_OTHERSCHED_FIFOSCHED_RR+XaddX-WsubW*WmulW/WdivW**ZexpZpowZ%\Wmod\Wand WorVnotVeorVxorVp|ZfHZoLY @@nonerealtimebest-effortidle   " !msfiy)<FF Ҕ PP&y.2 6 ?GQZApAbH"lCvH$vqqqq6 Y3#pxpx#l#T<##t#4#~~J'l T # ~~#}}#@}(}echo$discardȘXchargen$$timedaytime `"*$* *ܸ0 l \ )))))))J'* |P*[* ܸ #+*(** *ܸPM)p)))عйLC*ܸ///000$0*050>0E0M0T0zZ0^0/333W3#51533333~33I5[5k5555  3?@O?#5? @@@??~3o?@[5'@4@55VO?`?~3o?33}???????? genericloopbacketherinfinibandieee802trieee802.11ieee1394irdaslipcslipslip6cslip6pppipiptunnel6sitgrevoid  ! #}Q#QQQQQ &Zn3Z/4l AZ8$LZPZ8(ZZ_Z8,lZqZ80lZZ84ZZ8 ZZl<XZl@ZZ8[ 0 Z0 ZlDZlHZlLZP 1!!1!!!   3(!)1*!,2 3568<=BCM$w y9subnettimezoneroutertimesrvnamesrvdnslogsrvcookiesrvlprsrvhostnamebootsizedomainswapsrvrootpathipttlmtubroadcastnisdomainnissrvntpsrvwinsrequestipleasedhcptypeserveridmessagevendorclassclientidtftpbootfileuserclasssearchstaticrouteswpad" $ 0  @DC1/.p.T.1Y&8..-|-.\-g.dN6d>dHdcp%*s %llu %llu %llu %llu %llu %llu %llu %llum<hkm}-+?=%%%###:///{ssstt tttt{{{tt{{{{{{"t't+t{/t6t=t{t f d s c m lpn v w  Twp ",f`|a||Ծ |Ծ |||| #| *|]3|=|оC|UI|$O|pU|x]|d|h|q|P^w|P}||X||||`|x|,|||a|Ծ|| ||]||(|||}G{P{X{c{p{y{{{{{{{{ss  } } } !},Ct,Kt\,St@,]t@tԱ~time(seconds)file(blocks)data(kb)stack(kb)coredump(blocks)memory(kb)locked memory(kb)processnofilesvmemory(kb)locks !ifthen8elifelse fifor whileuntilin do done case @esac|4>|@|L||4@<i|`|t |-B>D|WJ|hw:V|e|`Hۂ|`1|$,|ĜLExԙh3u|}@}\<A>A>>B<><< v'uуIFS= '-2819d#>EKPX ]PHfXmr0nv8{ (@ȆY% @fbdba i gtaccelhsyncvsynclaceddouble show s all xresdyresevxresfvyresgdepthhmatchigeometrypixclockjleftkrightluppermlowernhslenovslenptimingscsyncqgsyncrextsyncsbcasttrgbaustepvmovew07CMT_rƛڛ !9QfuzӜ.7@LTaju̝bkm:Xw 1Q}Wqa 5  =AL-1 SeyHWkGgAאÅQJ:I۳FEsHu/etc/filesystems/proc/filesystems ?BEFGloopdefaultsnoautoswswap_netdevnosuidsuiddevnodevexecnoexecsyncdirsyncasyncatimenoatimediratimenodiratimemandnomandrelatimenorelatimeloudunionbindmovesharedslaveprivateunbindablersharedrslaverprivaterunbindablerorwremount @@@  @@@@  $'ztBtHH4 0DLUKS$ (ylE q&TsY ) }$LZO  0000000000000000000000000000000000000000000.zip.ZIPcwbkDkKMD@BMGDʚ;G@bkm @` 0@!`P`  `(Fd.sm<hdQbkmg@}Q SY0JFS1BSFXI"`'@'@'-3h$Dx$MDMa@gLVkii {Qr/v/|//Tm/NTFSGsIeRE=(urXhsqsreebevenpparityoddpnleksanecookedrawpass8litoutcbreakcrtdecdecctlqtabslcaseLCASEparenbparoddcs5cs6cs7cs8hupclhupcstopbcreadclocalcrtsctsignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixofftandemiuclcixanyimaxbelopostolcucocrnlonlcronocronlretofillofdelnl1nl0cr3cr2cr1cr0tab3tab2tab1tab0bs1bs0vt1vt0ff1ff0isigicanoniextenechoechoecrteraseechokechonlnoflshxcasetostopechoprtprteraseechoctlctlechoechokecrtkillintrquiterasekilleofeoleol2swtchstartstopsusprprntweraselnextflushmintimebkB             000 00 @ @   @  @@@  @         bkm     !"#$%&A!a w | p& m& P& M& 'J+"J-"J*"J/"J%"J&"J+-&"J&/%&*'''''!-~-7;?%@:C1P %+&-&!&012  # 3  A   Y   $   IIcCdDJoOpPrRxX<>~cwbk#!CgE#  xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ?pc?d?b?-?l?s???rwxSTst/proc/mounts 8$II }A/jƼY0(M{_9 e?H~+lZЎ:M!h| Sp 6Co!\˴ hpKJ/y–X`5I>/ŒXza ~O6.&@80( 91)! ;3+# =5-% ?7/'    )4%/7(3-!0,1'8"5.*2$       91)! :2*" ;3+# <4,$?7/'>6.&=5-%  @ rounds=%u$@ @ @ @ ɼ;ʄ+6_тl>+kAy!~g jgrn<:ORQhك[2Kn,X   `  %KEXITHUPINTQUITILLTRAPABRTBUSFPEKILLUSR1SEGVUSR2PIPEALRMTERMSTKFLTCHLDCONTSTOPTSTPTTINTTOUURGXCPUXFSZVTALRMPROFWINCHPOLLPWRSYSΔ`!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/= !?! @|@!@zj@|"@%@!)@:F,@zj/@\G1@|2@k4@5@ۏ7@!9@:@:F<@Z=@zj?@L~@@\GA@lB@|B@C@kD@4E@E@F@ۏG@XH@!I@DNn)W'4b<ACcQޫa:n$MBI .)>5D.&pA~_֑9S99_(;/ Zmm~6 'FOf?-_'u={9Rk_]0V{Fk 6^ae_@h'sMY1Vɨs{`k terminatedstack smashing detected: UTF-8``   ASCIIPOSIX SuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_/dev/log[truncated] J㋌zO????xąy <; "2BB&& %m/%d/%y%Y-%m-%d%H:%M%H:%M:%S()*+Hφ͌zJ&xy ;# 0;<I PcXc,1`5a5`c` %m/%d/%y%Y-%m-%d%H:%M%H:%M:%S()*+TZUTC<<..,M4.1.0,M10.5.0,M3.2.0,M11.1.0<<mUTC""##$$$%%&&/var/run/utmp '00G^q P`pKVpq0K<=AIMNQUbd<=ACGIKNpr<=?@ADMNVW>AFIJNUWADMN124;GO56789:q-123689:XZ`25RTrt  */`djp)+*0?@ $0paalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit@  +- 0x0XInvalid multibyte format string.hlLjztqZnpxXoudiYfFeEgGaACScs +0-#'I.Unknown signal Unknown error 2Kn,X   `  % K @B `  %& - g5 =/dev/vc/ /dev/tts/ /dev/pty/ /dev/pts//dev/ )BVm|  - FXnRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Unknown protocolRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error),G_xAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)/etc/rpc<<Resolver error: tcpudpraw0123456789abcdef?/dev/pts/nan infinityinf:/bin:/usr/binafffffff$$$$$$$$$$D&fffdDDbfff`b""FBFfddfFf$"fbbB"DDDD""""&ffa``ffff`ff&ff`ffffa`&ffadnffffbNfaff""""bDDDdDDD$FDDdDDdD&""b""b""""bbf&Fb$dd$dF$$$F"BB"fffdbaffff$fba$dFBfdbddBf$df"b$$FFFdFDdD&&&&"b"FfdFDd@&f&b&"b DDD@DDd""" ""bFAFdFDdd&"B"FDDD&"""f``afffffff`f`DddDADDDD@DDDD""!""""""ffffff`f&fffFff"Fff`b$dfff`` $&f`ffF@f```f&b"fFdDffFfa`f{}{Y@tL )( .],-& \[^1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUVZ S & ! 0 9   R    "   "!Y: Z\[_^VQ!TXUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO   & ! 0 9     "   "!:     & ! 0 `9 R    "   "!a: Sx"*(6;`f}jJ#+)7<ag~ kK. ELhr/ FMis8  V W. y"6*;`CELrAZj{}/ z#7+<aDFMsB[k|~     x !@AVW`atjvukw `a}~RSxY A `a yz{ B} ~ RSx|CPZpDQ[qA=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqc&$0^4{'%1_5|  l\  !m]8V(;`"f}W)<a#gJ~K *EL6rhj +FM7sik    !QRSTUVWXYZ[\^_ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQR    0^1_%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QS%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*  & ! 0 9     "   "!: Q!P%Q%R%QTT%VWW%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%l%      !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[  !"#$%&'()Y*+,-./01!234,-56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnocpqrestuvwxyz{|}~t;- &(,-й-ůרY㡢㡱YXZTKw]YUMf7l?   ah444444444444444444444444444444444444444444444444444444444444444444444444444444444444444#44&.'449o3_*2bi!A[ C`44444410~u|x{,44$DG444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444-4444{\T```^``>7>>>>>>B;5GGGGGG'&u&|||m|z||||1%%u >>>>>>>>>8>>``>8`[>>``>>``>8`[66PP>>``>>>8>>``>>``>>``= `ow `p;`g;4`p `nGG"GGGGGD!?GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG,GGGG#VS]GG!)6(=!44GGGGGGGGGQ````````\|2>>>>>>>GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGmsg|GGGGGGGGGGGGGGSYYY*GGGGGGGGGGG_WLsxGGGGGGGGGGGGG_YYWGGGGGGGGGGGGXIZ+_IE_GIUIZYDFOCYYYY?GGGGRIGG``````````>>>>>>>>>>```````````\>>>>>>>>>>>9IHYZ3W<````````````>>>>>>>>>>>>GGGGGGGGgq|||||||g||||||||fs|sg|||||||g|||&|b`````a|M>>>>>@||ume|s||||m|||||||&||||| g|||s|||||||||||||m||u||||vm|szvu0.&|l# &|.&}|||````>>>>| ||||%||||s&u.|.||||.&||||||||||||g||||||||||||||s|||s |||||q|||||||||||t|||yj||||||s|||||||||||g||s||s|||||||||||||||||vxGGG?GGGGGGGGGGGGGGG7>YX||||||q|s||||||||s||||s| ||||||y|||||||||||||||||||||||||||||#``````>>>>>>A||||||||||||q||||||||||||||||s||||||||||||||||||||||||||||||s||s|||||||||||||||||sg||||||||||||||||||||||||||||||||||||||||||||||||||N||||||||||Gx:|||||||||||||||||q|||||||||||||||||||||||||||||||||||||||||q||||||||||||||||||||||||s||||q|||||||||||||||||||||||q|||||||||||||||||||||||||||||||||||||||||||||||||||||||q|||||||||||||||||||||||||||||||s||||||||||||||||||||||||||||||||.||||||.&|.&m|||||||||||||||||||~||-||v|||ccd|b`````a|M>>>>>@||z||Nz|`````a`]>>>>>@>>!$`fw`fDff!YAD`af!"$D$af " $!!!!!"""""""!"""$"b"f"r#4$$$!$$$B$D$F$a$f&"&f4B@@@DA#ABADBBB"B$BBBDDDD$D@DBDDDdFDUUUf````faaaaadafddbdfffff fff!f$f`fafdfffrffifvawwwgwwif   aabb "" &&$ccceeedRRRRQ"" &&$""!!&&%'//////<43/////=>8?109:+ @46/////////////////////. ////////////WYVXWYWYVXWY]^WYWYWYUZ _S[T\ `////A/,/BCDEF- G"#&)(H///I;KK""""&&&&JJ////*//////L5//////////,NNNMPPPONNNNNMPPPPPO27////////////,ggggfhhhhhiiiii@mqtt9?Y Z[d%&'>nop()* "#01678VVVVVVVWWWWWWW\\\\]]]]DEEEGHHFvwxyzU!{|}R$$$     $+,-.///23454:::;<<=AAABCCIJKLMNOPQNNNNNNNNSSSSSSSSTVVVVVVVVVVVVVVVWWWWWWWWWWWWWWWXXXXXXXXXXXXXX\\\\O\\dY \\\\\\\\\\\\\\]]]]]]]]]]]]]]]]eefg]]ii]]jjR^^____``aabbcchhhhfkkllfrrrrrrrrssssssssttttttttuuuuuuuuuu~~~~~~~~~~~~~~ y9Oa8~+*](*=EG**.23651/-))+*)&'%T&%@?P0`AJVdp~ A ՠ(0123456789.,-AUD $.,-$BWP Pu-PuCAD DKK kr-krGBP £-£HKD HK$-HK$EUR €-€INR ₨-₨NZD PHP Php-PhpSGD USD ZAR R-RZWD Z$-Z$SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%a %d %b %Y %T %Z%d/%m/%y%T%d/%m/%Y%a %d %b %Y %r %Z%y-%m-%d%r%Y-%m-%dT%T %Z%Y-%m-%d%l:%M:%S %P %Z%A, %B %d, %Y %p%I:%M:%S %Z%A, %B %d, %Y%I:%M:%S %Z%p%I:%M:%S %Z%A %d %B %Y %I:%M:%S %p %Z%A %d %B %Y%I:%M:%S %Z%I:%M:%S %p %Z%A, %d %B, %Y %I:%M:%S %p %Z%A, %d %B, %Y%A %d,%B,%Y %I:%M:%S %p %Z%A %d,%B,%Y%m/%d/%Y^[yY]^[nN]^[yY].*^[nN].*^[yYoO].*^[1JjYy].*^[0Nn].*YesNo    !"#$%&'()*+,-./0    !123456'789:;<=>?  "#!  56'7@ABCD=>?Y$%&'#(  EFGHIJKLMNOP )"#!!  QRSTUVWXYZ[\*+,-#  ]^_`@AabD=cd./01"#!  efgh@ABCD=>?2345# !  ijklmAnop=qr !"6789"#!!"#"#  stuvwxyz{|}~#$%:;<=>?#@A!$%$&' (' (A=&'(BC8D"#!!")"*  IM)*+E%F'+, +, ,-.GHIJKLM/0NO.PQRSTU-./ 01/ 23123VWX&'-./0456"#! 4 556'7@AD=78YZ66777777779:;<=[\]^_`ab89:;<77777777˼>?cde=>=>77777777ϼ9@;<AJfghfiB           #$&(*,0269=?CEILP%*8DR`qv /=IWe{  iY2222!4@M[l   !"#$%&(*2<AFGHIJK $+3=FMVZ^bfjnrvz~f8V}/#/Je!JV,Sn  '2;?4 %0&@_XWNQ  ^]^  X @||%@`PP&0q3p3q3x( CoC+W5 (r7N\t,,K#NNk3b{4NY,O @ ) ( 6(@ !66#L6666666666#L666666(6::p3C (,-2346789:;<=>?@ABCDEFGHIx}~      !"#$%&'()*defghijklmnopqrstuvwxyz{|}~   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{  %&(*+,02345:;<>?@AHKL[\^_m{}    TUWXYZ[\]^_`abcdefghijklmnstuvw{  &'DEFGLMNOXY[\]^abcdghijklmnorstuvwx{|}~Y   !#*0139<>ABEGHIJMPQSTWXY[]^)01+,-.01346789:;=>?@ACDEFHIKLMNOPQSUVXY[\]^_`abc'./17IJQRSTXYZ]fghijz|<=>?@ABCDEFGHIJKLMNOPQRSVqrxyz    !"#$%BCHIJKPQRSTUVW  ')./278;@DKLOVZ\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPTUVWXYZ[]^_`abcefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@BCEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrtuvwxyz{|}~$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-Y?./012389<=>?@ABCHIJSTUVWXYZ[\]`adefgjklqrstuvwx{|}~     !"#$%&'()*+,-0126789:;<=>?DEFGHIJOPQRSTUVWXY\]`abcfghijkrstwxyz{|}~      !"#&'()*+,-0123456789:;>?@ABCDEFGHIJKLMNOPYpqrstuvw|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'(Y*)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'(Y))*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Y<  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     Y& !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Y3      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNKOKPKQKRSTKUKVWXKYKZ[\]^_K`KaKbKcKdKefgKhKiKjkKlKmnopqrKsKtKuKvwxyzy{y|y}y~yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyY0     +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++,,,,,,,,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg+hijklm-nopqrst+-uvwxyz{|}~+-+-+-+-+-+--            +  -   +-          ! " +# -$ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 +-7 8 9 : ; < = +-> ? @ A B C D E F G H I J K L M N O +P Q -R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  + - +- +-  +-  + - + -             +-     +-         ! " # +-$ % & ' ( +-) * + , - . / 0 1 2 3 4 5 6 7 8 9 +-: ; < = > ? @ A B C D E F +G H I I I I I I I I H H H H H H H H H J K L M N O P Q R ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,S ,T ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,U ,,,,,,,,,,,,,,,,,,,,Y%,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,V W X Y Z W [ W \ W ] W ^ _ ` W a W b c d W e W f g h i j k W l W m W n W o W p W q r s W t W u W v w W x W y z { | } ~ W  W W W ,,,,H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H I J K L M N O P Q R H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H      H  H  H  H  H  H    H Y%   H H H H H H  H    H  H  H  H                                     !  "  #  $  %  &  '  (  )  *  +  ,  -  .                                                                                                                                            / / / / / / / / /  +++++V 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 2 3 2 4 2 5 2 6 2 7 2 8 2 9 2 : 2 ; 2 < = > = ? = @ = A = B = C = D = E = F = G = H = I = J = K = L = M = N = O = P = Q = R = S = T = U = V = W 2 X Y Z [ \ 2 ] ^ _ ` a 2 b c d e f 2 g h i j k 2 l m n o p 2 q r s t u 2 v w x y z 2 { | } ~  2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2  2      2 2   2 2    2      2      2      2 ! " # $ 2 % & ' ( ) 2 * + , - . 2 / 0 1 2 3 2 2 2 2 4 2 2 2 2 2 2 2 2 2 2 2 2 &(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnp  $1F8:&(*,.02468:<>@BDFHJLNPRTVXZ\^chpuz|~  $(%(%+%1F8:&(*,1357<>@BDFHJLNSUWY^`bdfhjlnprtvxz|  $1F8:&(*Y0,.02:<>@BDFHJLNPRT\^`bdfhjlnprtvxz|  $1F8:&(0246>FHJLNPRTV^`bdltvxz|~  $1F8:&(*,4<>@BDFHJLNPRT\dfhjlnprtvxz|~&%*)  $#$'(1F8:&(*,.02:<>@BDLNPRTVXZbdfhjltvxz|~  0/$-.1F8:&>*B.02468:<>@$$$$$$$$$           $$$   $$$$$$$$$$$$         Y3$$$   $$1F8:&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhpuz  $1F8:&.6>@BJRT\dfnprz76;:?>CBGF KJ ON$4589<=@ADEHILM1F8:&68:<>@BDFHJLNP`bdfhjlnprtvxz|~76UT  $45RS1F8:  "$&(\[^] &(*2:XWtstsXWtsts  "*,4EDED '&(}|wvqpkjed_^YXRQKJED?>9832-,'&!  ~~|xvrpljfd`^ZXSQLJFD@>:842.,(&"  Y&~|yvspmjgda^[XTQMJGDA>;852/,)&#  ~|zvtpnjhdb^\XUQNJHDB><8620,*&$  ~|{vupojidc^]XVQOJIDC>=8721,+&%  ~SX_epyZSXSX2(SX|M   y/5BGJTWZ `    )"+=CF NRU SX!"#$SX SX%%%%%%%%%%%%_X/<BRWZ"&4'(=) *N+,R-.U/SX01234U567 8 95:6;-<=SX>?`@ABCDnEFGHIJKLMNOPQBRSSXyY< |TUVWMXYZ[\]`^_ ` ak ` bcdnefghghijkl1m34Un6o 8 9ypqr-<=SX.y|stMuv   wwwxyzSX#{$|%}&~'()* !"`= SX8-./0+,SXL`123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|SX}~ `n n B    SX z|{   }~*                      # "!$#&%('*),+.1-/079o43|526Y)8:<=BC !;">#?$@%A&T'U() *J+K,L-M.F/G0H1I2(N3O4P5Q6D7E8R9S:";#<$=%>V?W@XAYBZC[D\E]F^G_H`IaJbKcL!MSX&'()*+`NOPQRS TUVWX)YSX,-./4Z5[`6\7]8^9_n:`;a<b=c>d?efghi@jAkBlCm DnEoFpGq HrIsJtKuLvMwNxOy0123SX>?`@ABCDnEFGHIJKLMNOPQBRSSXPQ4z5{R|S}`6~7TUSX.Jephfgrxjq$tw+uv4iydmklo ns"z:}={?|CN~USXV/5BJTWZ ` ~    )"+=F NRU SX4:DK !"#$^%&b'(m)y*+,-./0123456789:;. < =@ > ?@AZY*BC^DEdFGlHIuJKLMNOPQ R!S"T#U$%V&W'X(Y)Z*[+\,]-^./_0`1a2b3c.4d5e<6f7gQ89h:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 3D^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKLM"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c.4d5e<6f7gZ:;<=>?@ABCDEFGHIJKLMxNO{P|Q}R89ST~UVWXYZ$%V !Q\dAD 34:DK !"#$^%&hm6y*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJK$%LMY?NOPQ R!S"T#U&W'X(Y)Z*[+\./,-60`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVYZWX6Q\dAD 34:DK !"#$b'(hmy*+,-012389 :;. < =@@AK  ^DEdFGlHI$%LMNOPQ R!S"T#U&W'X(Y)Z,]-^./*+0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~WXUVYZQ\dAD 3D^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKNO"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c<6f7gQY:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q} R8945ST~UVWXYZ !$%[\]^Q\dAD 34:DK !"#$^%&hmy*+,-./89 NO{P|Q}R3   @ > ?KZBC^DElHIuJK$%LMNOPQ R!S"#&W'X()*[+\./,-0`1a2b3c$89.4d5eQ67:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzST~UVYZWXQ\dAD4:DK !"#$^%&b'(hy*+,-./012389 :;NO{. < =@ > ?@AZBC^DEdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^Y./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxP|Q}RST~UVWXYZQ\dAD 3QD^%&b'(hy*+_`,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKNO"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q} R8945ST~UVWXYZ !$%[\]^AD defghijklmnovwyz~4:DK6!"#$^%&b'(hy*+`6_./01623 :;6. < =@ > ?@AZBC^DEdFGlLMNO R!SY "T#U6(Y)Z*[+\,]-^./$89.4d5e<6f7gQ362:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{RQ6PST~UVWXYZ 1606'&%6$Q\dDasbcpqrstux{|} 34:DK !"#$hm,-./012389 :;. < =@ > ?@AKZBC^DEdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\./,-0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVYZWXQ\dAD 34:DK !"#$^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBCdFGlHIuJKY$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 34:DK !"#$^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 34DK !"#$^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKLMPQ R!S"T#U&W'X(YY)Z*[+\./ ,-S T U V Y ZWX0`1a2b3c.4d5e<6f7gQ:;i<j=k>l?mZ@ABCDEFGLMJKHI !"$!%#8!9$xNO{P|Q}Q\dAD 3R4:DK !"#$^%&b'(hm%&'y*+,-./012389 :;. < =@ > ?@AK()*ZBCdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 3@@@@@@@@@@ @@!@@"@@#@@$@@%@@&@@'@@(@@)@@*@@+@@@@,@@-@@@@.@@@@@@@@/@@0@@1@@2@@3@@@@4@@5@@6@@7@@8@@9@@@@:@@;@yC@yC @yC!@yC"@yC#@yC$@yC%@yC&@yC'@yC(@yC@yC@yC@yC@yC@yC@yC@yC@@ @@!@@"@@#@@$@@%@@&@@'@@(@@)@yC)@@)@yC)@yC*@yC+@yCCyCCyC,@yC,@YyC,@yC,@yC,@yC,@yC,@yC,@yC,@yC-@yCCyCCyC.@yCCyCCyCCyCCyCCyCCyCYF\_FCyCCyCCyCCyC/@yC/@yC/@yC/@yC/@yC/@yC0@yC1@yC1@yC1@yC1@yC1@yC2@yC2@@2@yC2@yC2@yC2@yC2@yCbF\_F3@yCCyC4@yC4@yC4@yC4@yC5@yC5@yC6@yC6@yC6@yC7@yC7@yC7@yC7@yC7@yC7@yC7@yC7@yC8@yC9@yCCyC:@yC:@yC:@yC:@yC;@yC;@yC<@yC)@ @)@ @)@ @*@ @+@ @C @C @,@ @,@ @,@ @,@ @,@ @,@ @,@ @,@ @,@ @-@ @C @C @.@ @C @C @C @C @C @C @YF\eFC @C @C @/@ @/@ @/@ @/@ @/@ @/@ @0@ @1@ @1@ @1@ @1@ @2@ @2@ @2@ @2@ @2@ @2@ @bF\eF3@ @C @4@ @4@ @4@ @4@ @5@ @5@ @6@ @6@ @6@ @7@ @7@ @7@ @7@ @7@ @7@ @7@ @7@ @8@ @9@ @C @:@ @:@ @:@ @:@ @;@ @;@ @<@ @=@@yC>@@yC@@@yCA@@yCB@@yCC@@yCD@@yCE@@yCF@@yCG@@yCH@@yCI@@yCJ@@yCK@@yCL@@yCM@@yCN@@yCO@@yCP@@yCQ@@yCR@@yCS@@yCT@@yCU@@yCV@@yCW@@yCZ@@yC[@@yC\@@yC]@@yC^@@yC`@@yCb@~CyCb@@yC====>>>>@@@@AAAABBBBCCCCDDDDEEEEFFFFGGHHIIJJKKLLMMNNNNOOOOPPPPQQQQRRRRSSSSYTTTTUUUUVVVVWWWWZZZZ[[[[\\\\]]]]^^``hknhkqhkthkwb~b~bbc@@@d@@@e@@@f@@@g@@@h@@@i@@@j@@@k@@@l@@@m@@@n@@@o@@@p@@@q@@@r@@@s@@@t@@@u@@@v@@@w@@@x@@@y@@@z@@@{@@@|@@@}@@@~@ @~@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @~@ @~@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @C@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @)@yC)@yC)@yC)@yC)@yC)@yC)@yCzF\_F+@yC+@yC+@yC+@yC+@yCCyCCyCCyCCyCCyC.@yC.@yCCyCCyCCyCCyC1@yC}F\_F2@yC2@YyC2@yC5@yC5@yC5@yCF\_F6@yC7@yC7@yC7@yC9@yC;@yC;@yC)@ @)@ @)@ @)@ @)@ @)@ @)@ @zF\eF+@ @+@ @+@ @+@ @+@ @C @C @C @C @C @.@ @.@ @C @C @C @C @1@ @}F\eF2@ @2@ @2@ @5@ @5@ @5@ @6@ @7@ @7@ @7@ @9@ @;@ @;@ @@@yC@@yC @@yC @@yC!@@yC!@@yC"@@yC"@@yC#@@yC#@@yC$@@yC$@@yC%@@yC%@@yC&@@yC&@@yC'@@yC'@@yC(@@yC(@@yCC@yCC @yCCzCyCC|CyCC@yC?@@yCX@@yCY@@yCC@yC_@@yC`@{CyCa@@yCFF_Fa@}CyC  zz||??XXXXYYYY__`{`{aaa}a}a}a}kkC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @@@FF@FF@FF@D@yCD@yCD@yCD@yCD@yCD@yCD@yCD@ @D@yCD@ @D@yCD@ @D@yCD@yCD@ @D@ @C@yCD@yCC@ @D@ @D@yCD@yCD@ @D@ @D@yCD@ @D@yCD@ @DCyCDC @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@DD@ @D@D@@@D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@yCDCyCD@yCD@yCD@ @D@ @DC @D@ @D@ @8@@ @98@@yC9:@@yC:@@ @D@yCD@yCD@ @D@ @D@yCD@DD@yCD@ @D@DD@ @D@yCD@DD@ @D@DD@yCD@YDD@ @D@DD@yCD@ @D@yCD@ @D@yCD@yCDCyCD@yCD@ @D@ @DC @D@ @D@yCD@yCD@ @D@ @D@yCE@yCE@ @E@yCE@yCE@ @E@ @E@yCE@yCEF_FD@yCD@ @ E@yCECyC E@ @EC @E@yCE@yCE@ @ECyCECyCEC @EC @E@yCE@ @ECyCEC @E@yCE@DE@ @E@D!E@yC!E@D!E@ @!E@DE@yCE@ @E@yCE@ @ E@yC E@ @"E@yC"E@ @+E@yC+E@D+E@ @+E@D,E@yC,E@D,E@ @,E@D@yC@ @E@yCE@yCE@ @E@ @E@yCE@yCE@ @E@ @E@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@EE@EE@EE@EFFFFFFFFFFFFE@EE@EE@~EE@}EFFFFFFFFFFFFE@ @E@DFFeFFFFFFFFFFE@yCE@DFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@yCE@DFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@yCE@DFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_F@@@F@yCCFyCCzCyCC|CyCC{CyCC FyCC F FC F FX@@yCC FyCCzCyCF@yCF FyCF}CyCF@@F@@C@@C@@CF@CF@C@@CzC@CzC@C|C@C|C@C{C@C{C@C F@C F@X@@@X@@@X@@@X@@@X@@@X@@@X@@@X@@@C@@C@@C@@C@@C F@C F@CzC@CzC@F@@F@@F@@F@@F F@F F@F}C@F}C@F}C@F}C@FFFFFFFFFFFFFFFFFFFFFFFFGGY G&FC @&FCyC'FC @'FCyC(FC @(FCyC)FC @)FCyC*FC @*FCyC+FC @+FCyC,F@yC,F@D,F@ @,F@D-F@yC-F@D-F@ @-F@D.F@yC.F@D.F@ @.F@D/F@yC/F@D/F@ @/F@D0F@yC0F@D0F@ @0F@D1F@yC1F@D1F@ @1F@D2F@yC2F@D2F@ @2F@D3F@yC3F@D3F@ @3F@DPF@yCPF@DQF@yCQF@DPF@ @PF@DQF@ @QF@DGF_FGG_FGF_FCCyCCCyCCCyCCCyCCCyCCCyCGFeFGGeFGFeFCC @CC @CC @CC @CC @CC @CCyCCCyCGF_FGF_FCCyCCCyCCC @CC @CC @GFeFGFeFCC @CC @VF@yCVF@ @??@@@BFBB@BFB@BFB@BFB@BFB @B FB @B FB @B FB @B FB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB"@B"FB#@B#FB(@B(FB7@B7FBFB'@B'FB(@B(FB:@B:FBFB@BFB"@B"FB'@B'FB-@B-FBFB@BFB'@B'FB(@B(FB,@B,FB9@B9FB:@B:FBFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB"@B"FB#@B#FB&@B&FB'@B'FB(@B(FB/@B/FB3@B3FB4@B4FB9@B9F)CF)C"@)C"F)C'@)C'FcHfiHlHfoHrHfuHxH|HH|H5CF5C@5CF5C@5CF5C@5CF5C'@5C'F5C*@5C*F5C2@5C2FDCFDC@DCFDC@DCFDC@DCFDC'@DC'FDC(@DC(FDC*@DC*FDC,@DC,FGFG@GFG@GFG@GFG@GFG@GYFG@GFG@GFG@GFG"@G"FG#@G#FG&@G&FG(@G(FG0@G0FHHHHsCFsC@sCFxCFxC@xCFxC@xCFxC"@xC"FxC(@xC(FxC:@xC:FCFC@CFC@CFC'@C'FC(@C(FC8@C8FC9@C9FC:@C:FCFC@CFC'@C'FC(@C(FCFC@CFC'@C'FC(@C(FC9@C9FC:@C:FCAFCFCC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC"@C"FC$@C$FC%@C%FC(@C(FC0@C0FC1@C1FC3@C3FC4@C4FC;@C;FC<@C<FC=@C=FC>@C>FC?@C?FC@@C@FCFC@CFC'@C'FCFCFC@CFC@CFC@CFC@CFC'@C'FC(@C(FC8@C8FC:@C:FDFHfHD@DFD@DFD@DFD'@D'FD(@D(FD)@D)FD?FHfHHfHDFD@DFD'@D'FD(@D(FD*@D*FD,@D,FD9@D9FD:@D:F$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D @$D F$D"@$D"F$D#@$D#F$D$@$D$F$D&@$D&F$D(@$D(F$D0@$D0F$D5@$D5F$D6@$D6F$D9@$D9F$D;@$D;F$D<@$D<F$D=@$D=F$D>@$D>F$D?@$D?F$D@@$D@F]DF]D@]DF]D'@]D'FNG@NGFNG@NGFNG@NGFNG"@NG"FNG#@NG#FNG'@NG'FNG(@NG(FSG@SGFSG(@SG(FSG*@SG*FSG:@SG:FB@{DC@{DYB@{DC@DB@DB@DB@DC@DB@DC@DB@DC@DB@DC@DB@DC@DD@DB@DC@DD@DE@DB@DB@DB@DB@DB@DC@DB@DC@DB@DB@DB@DDB@DC@DD@DB@DC@DD@DE@DB@DB@DB@DC@DB@DC@F@DFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFEFFEFFEFFEFFEFF EFF EFFEFFEFFFFEF@EFFEF@EFFEFFEFFEFF EFF"EFF$EFF&EFF@?@HE?@GE?@QE?@UE?@\E?@dE?@iE?@nE?@sE?@xE?@{E?@~E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@@F?@F?@F?@F?@F?@F?@F?@F?@F?@F?@HHHHHHHHHHHHHHHHE?@E?@E?@F?@F?@ F?@F?@F?@F?@F?@ F?@$F?@(F?@,F?@0F?@4F?@8F?@@@@@>@@@@@@@@@@@@<@@@@<@@@@7@@@@7@@@@A@@@@A@@@@@@@@@@@@#@@@@#@@@@$@@@@$@@@@%@@@@%@@@@@@@@@@@@@@@@@@@@@@@HHHHHHHHHHHHHHHHHHHHA@@AA@@AA@@AA @@AA @@AA @@AA @@AA @@AA @@AA@@AA@@AAD@@AAD@@AA@@@AA@@@AA@@AA@@AA@@AA?@@AA?@@AA @@AA @@AA@@AA@@AA@@AA@@AA<@@AA<@@AAD@@AAD@@AA@@@AA@@@A&A@@&A&A@@&A)A@@)A)A@@)A)A@@)A)A @@)A)A @@)A)A@@)A)A@@)A)A @@)A)A @@)A)A@@)A)A@@)A)A @@)A)A @@)A)A @@)A)A @@)A)A@@)A)A@@)A)A+@@)A)A+@@)A)A@@)A)A@@)A)A @@)A)A @@)A)A>@@)A)A>@@)A)A@@)A)A@@)A)A<@@)A)A<@@)A)AA@@)A)AA@@)A)A@@)A)A@@)AHHUHHHHGHNA@@NANA @@NANA @@NASA@@SASA@@SASA@@SASA @@SASA @@SASA@@SASA@@SASA<@@SASA<@@SASA@@@SASA@@@SASA=@@SASA=@@SASA@SAcA@@cAcA@@cAcA@@cAcA @@cAcA @@cAcA@@cAcA@@cAcA<@@cAcA<@@cAcAD@@cAcAD@@cAcA@@@cAcA@@@cAcA2@@cAcA2@@cAcA%@@cAcA%@@cAcA=@@cAcA=@@cAxA@@xAxA@@xAxA@@xAxA@@xAxA@@xAxA<@@xAxA<@@xAA@@AA@@AA@@AA @@AA @@AA @@AA @@AA@@AA@@AA<@@AA<@@AA@@@AA@@@AA%@@AA%@@AA=@Y@AA=@@AAC@@AHIUHHHIGHA@@AA@AA@@AA@@AA @@AA @@AA@@AA@@AA @@AA @@AA@@AA@@AA @@AA @@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA4@@AA4@@AA @@AA @@AA@@AA@@AA@@AA@@AA@@AA@@AA @@AA @@AA@@AA@@AA/@@AA/@@AA<@@AA<@@AAD@@AAD@@AA;@@AA;@@AAA@@AAA@@AA8@@AA8@@AA@@AA@@AA#@@AA#@@AA$@@AA$@@AA@@AA@@AA&@@AA&@@AA'@@AA'@@AA)@@AA)@@AA(@@AA(@@AA9@@AA9@@AIIUHIIIGIA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA<@@AA<@@AA@@@AA@@@AA2@@AA2@@AA=@@AA=@@AA @@AA@@A IHI IA@@AA@@AA@@AA@@AA @@AA @@AA@@AA@@AA<@@AA<@@AA1@@AA1@@AA@@@AA@@@A B @@ B B @@ B B @@ BA@AIHII IHI@B@@BB @@BB @@BB@@BB@@BB<@@BB<@@BBD@@BBD@@BB@@@BB@@@BB%@@BB%@@BB=@@BB=@@BIIUHIIIGI(B@@(B(B@@(B(B@@(B(B @@(B(B @@(B(B@@(B(B@@(B(B @@(B(B @@(B(B@@(B(B@@(B(B @@(B(B @@(B(B @@(B(B @@(B(B@@(B(B@@(B(B@@(B(B@@(B(B*@@(B(B*@@(B(B+@@(B(B+@@(B(B,@@(B(B,@@(B(B-@@(B(B-@@(B(B@@(B(B@@(B(B@@(B(B@@(B(B @@(B(B @@(B(B@@(B(B@@(B(B>@@(B(B>@@(B(B<@@(B(B<@@(B(BA@@(B(BA@@(B(B@@(B(B@@(B(B.@@(B(B.@@(B(B:@@(B(B:@@(B(B%@@(B(B%@@(B(B@@(B(B@@(B(B&@@(B(B&@@(B(B'@@(B(B'@@(B(B)@@(B(B)@@(B(B(@@(B(B(@@(B(B9@@(B(B9@@(BgB@@gBgB @@gBgB @@gBgB<@@gBgB<@@gBnB@@nBnB@@nBnB@@nBnB @@nBnB @@nBnB @@nBnB @@nBnB@@nBnB@@nBnB@@nBnB@@nBnB<@@nBnB<@@nB}B@@}B}B@@}B}B@@}B}B@@}B}B@@}BB@@BB@@BB@@BB @@BB @@BB @@BB @@BB@@BB@@BB@@BB@@BB @@BB @@BB@@BB@@BB<@@BB<@@BB@@BB@@BB@@BB @@BB @@BB@@BB@@BB<@@BB<@@BBD@@BBD@@BB=@@BB=@@BB @@B@B@BB@BB@BB@BBY@BB@BB@BB@BB@BB@B@@@B@@@B@@@-C@@@@@E@;E@F@;E;E@E@;E;E@F@;E?E@E@?EAE@E@AECE@E@CEEE@F@EEEE@E@EEEE@F@EEIE@E@IEKE@F@KEKE@E@KEKE@F@KEOE@E@OEQE@F@QEQE@G@QEQE@E@QEQE@F@QEQE@G@QEQE@H@QEXE@E@XEZE@E@ZE\E@E@\E^E@E@^E`E@E@`EbE@F@bEbE@E@bEbE@F@bEfE@E@fEhE@E@hEjE@E@jEjE@jEmE@E@mEoE@F@oEoE@G@oEoE@E@oEoE@F@oEoE@G@oEoE@H@oEvE@E@vExE@E@xEzE@E@zE|E@F@|E|E@E@|E|E@F@|EI@@EI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EI@@EI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@E@@F@FF@FF@FF@FF@F$F@$F)F@)F.F@.F3F@3F8F@8F;F@;F>F@>FAF@AFDF@DFIF@IFNF@NFSF@SFXF@XF]F@]FbF@bFgF@gFlF@lFqF@qFvF@vF{F@{FF@FF@FF@FF@FF@FF@F@@ I I#I I I&I)I I,I,I/I,I,I2I5I,I8I8I;I8I8I>IAI8IDIGIJIDIDIMIPIDIF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FG@GG@G G@ G G@ GG@GG@GG@GG@GG@G G@ G&G@&G,G@,G2G@2G4G@4G6G@6G8G@8G:G@:G@@@@@@@@@@@@@@@6@@@@8@@@@:@@@@<@@@@>@@@@@@@@@B@@@@D@@@@F@@@@H@@@@@@@J@@@@L@@@@N@@@@P@@@@R@@@@T@@@@V@@@@X@@@@Z@@@@\@@@@^@@@@`@@@@b@@@@d@@@@f@@@@h@@Y@@j@@@@l@@@@n@@@@p@@@@r@@@@t@@@@v@@@@x@@@@z@@@@|@@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@D@@@D@@@D@@@ D@@@ D@@@D@@@D@@@D@@@D@@@D@@@D@@@!D@@@$D@@@'D@@@*D@@@-D@@@0D@@@3D@@@6D@@@9D@@@E@@@AE@@@DE@@@GE@@@JE@@@ME@@@PE@@@SE@@@VE@@@YE@@@\E@@@_E@@@bE@@@eE@@@hE@@@kE@@@nE@@@qE@@@tE@@@wE@@@zE@@@}E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@F@@@F@@@F@@@ F@@@ F@@@F@@@F@@@F@@@F@@@F@@@F@@@A@@@@@@CCyCyC2@,@ @ @a)@,@1@C5@5@a@C@@[ z|h@h@CCh@l@l@l@EE @D @D @yCyC @yCY DyCDEEEE @E @E @E @EyCEyCEyCEyCEEEEEEEEEEEEE[@F@@@@[@C@zC@|C[@CJ@FC[@CCCC@@@@CCCCCCCCCC)C)C0C0C)CG1C1C)CC2C2C)C)CG3C3C3C)C)CC4C4C4CGsCqq@@FFDDDDDDFDDDEHEHEEIEEEJEJEEKEEEMEMEENEEEQEREESEEBBC5CCB&&DDC00V@@@@@@@@@@@@@@@)A@@@cA@@@@)A@@@AAA@@cAAAA)ANALALAAAAAA@AAABAAAA@BBBBA&B&B{FFFF{F FFF{F FFF{F FFF{F FFF{FFFF{FF{FFFF{FFFF~@A~@A~@A~@A~@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA AA AA AA AA&AA&AA&AA&AA&AA,AA,AA,AA,AA,AA2AA2AA2AA2AA2AA8AA8AA8AA8AA8AA>AA>AA>AA>AA>AADAADAADAADAADAAJAAJAAJAAJAAJAAQAAQAAQAAQAAQAAXAAXAAXAAXAAXAA^AA^AA^AA^AA^AAdAAdAAdAAdAAdAAjAAjAAjAAjAAjAApAApAApAApAApAAvAAvAYAvAAvAAvAA|AA|AA|AA|AA|AAAAAAAAAAAA    dint}x|Rrw o$%&'(7{4chmsMUY#=P: /) 3W]fFLZH1\5`6aO[ -! Q@^KXbB.?T2_ej~SpuzC9ygkqv8l+",*;0<>AEDGNJVI -UV !"#$%RS}Y xz{|   EHGabcd *(-./0123-./709y123456744AWXYZ[\]gedfhijvtsuwxy96    5( !&  ?@3BCD5  "!"#$%!#%' ! "$&(MN e)-"#$%&'(#%'2)+,./0'+*.047)*+,)+*,1 235789:;3  456789:;668:2&1;89:;<=>?;<=>?TU@<=>?@ABC<=><=>?@ABC@ABCDEFGABCIDEFGHIJKDEGHIJKLFklnmopHIJKLMNOJKLDEQRSLMMNOPQRSTMNOPQRSTOPPQRSTUVTYZ[\]^_UVWXYZ[\UVWqXrYZWXWXYZ[\]^[\]^_`ab]^_`abcd^_`abcde_`abc`efghijk` abcdcdefghijefghijklfghijklmklmnopqrlmnqrstwmnopqrstunopqrstunopqropyzuvJKstuvwxvwvwxyz{|x{|}~z{|~}z{|YjklmFGHIy}~NOPQV XYZ[tuvsLwxfghi ,/\]^_      Q*bmz#lnx}pu9/<=' \+ 3w]` BC K.$%&?F0IJ4freoy^ghY>|GPS1_j78()MOVLRX;EUct:DTasN2W!"{,-ik~6 5Zv@H[qAYdP[`  CEDEWX"R   YZ78 !CDEFGH[|"#IJKLMf !"#$%IKNRSVQSTUV\]^_` !+,~0123456789GHJLMOQU\_dinsxTUVWXYZ[KNLOM\]T       qruv   Y          !"    fglm ! "$&(*,.024!#%')+-/135&'()*+./ JKBCLM@AHI<=>?#$%&$%&'()*+,-./012&''()*+,-./()*+,-./01234567,->?67*+23012343456789:;45FGFGfghUVYZWX68:<>@BDFHJLNPRT79;=?ACEGIKMOQSU89:;<=>?@AB:;<=>?@AB<=>HIPQhiZ[noABLMNOJKRSFGjkdeDEBCHIJKLMab_`noFGHIJKLMNOFJWxzw{r^thRuQOvwPZVXZ\^`bdfhjlnprtWXY]^`abcefghjklWY[]_acegikmoqsuXYdepqjklm\*6EUty^_`abcdefghijklm_$&2.8P0`%'3/9Q1iabcaa014567:;89deghijklmnmopqrtuvwyz|}opqrstuvwxyz{|}~opqrstuvwxyz{|}~qrstuvrstuxyv)5Dsxvxz|~wy{}wxyz{|z{{~NOPQR  "#Y[s`aiY ABCD{=>?@Vey~bjl|SZ~bcdefV^bW_cXY\] }cdfgghijklmnopUTXkm}~?@;<|}NDE<=PQRSTUVW$:@]NSn}o]P%;A^OTpq_n(),-$%"#&' !-. 9:     Y&LT^hu~$BJ QV12pR`3vx{(6) . /ZCG "'bdn% A!z978,-=c?IaSj4l5D]tF_>kYPUm0grys[}He|@Owoq\:#N*+E<MXi;KWf?JEFGHIyz7"0+32 5/m}~789:;<<=FLRcp}#$%&"(l)nopqrstuY  OPQRSTUKL   $).38%DEGIJLMOPQTUWXY\]_`aop,*4:&-+5;'OYZ       #$     lqv{  !"?@IJ12GH   HIRS0189 #$AB;< ! ! "$&(*,.024 !"#%&'(*+,!#%')+-/135!"VWLMXYJKTUijkl"#$&!'()*+,-./0#%'()*+,-./$&01245689:<=>@C'.61-/01245679:<=?@B12345678937;?AB68:<>@BDFHJLNPRT79;=?ACEGIKMOQSU867<=>?BC@A;>ADINSX]bg>@ABCDCDLMPQ]^befopghiCEFGHJKLMOPQRTUVDEPQtuFHKNRSVZ[^benM*4X Y,MNPQNRSTUVWXYZ[-UV[\_`klqruvstz{VXZ\W;?ACEIKOQXZ\^`bWYZ[\^_`acdefhijWY[][Ym{-+59[\Zn|.,6:]^kl/034]^_`abcdefghijkcdefghijcdfghijklmdefhjmovxz|Sq>HNUgilknrwy{~Vtesjmnkmnoprstuwxyz|}~qrstrspqvwxyz{uvwxu=@BDGJMPTY[]_advwxyz{|}~yz{|}~|}~opqrstuvwxab_`  WX \   ZW`*OTdy=>EFYNOFG\]^_`abc(gn}  )ho~./23     V_)NScxabcdefghijklmnopqrstuvwxyz@ABCDEFGHIJKLMN OPQRSTU  "$&(*,.02468:<>VWXYZ[ !#%')+-/13579;=?\]^_`{|}~~ &,Y2 ' (&$) 68:<>@BDFH *+,KMOQSUWY[]_acegikmoqsuwy{}-JLNPRTVXZ\^`bdfhjlnprtvxz|%8>DJPQWX^djpv|/123450.!79;=?ACEGI"# -% !, (  &*1$+# /"')02. uS^g$<&>:b6M_%2? p~_D TK^#>=NiQcs#sbUxeEy&K`3&'e(kVhz*  0Q n h?NH9'lT!igtI;dj}RWYv-=a J ?W !(BIgf0x4I\F|LH]z}%<",8[a%6EZM6+qZY{;iNnr-W,QlvdJCXwv|re1"SzP1)Fk\R$5`b7AmpV8D,19f4CSD5+lq[P_{Byww Hx3G[j:<fckc @F24G Rj(  * PE+|m~5BXp2h!/La*UAo.YCO3/:}VOt^8d{Xo$#tLU/A]`MY)yKZ->m 0;Gn7ors="7.@\uq'.@)Tu~9]JOc 00g.^hZ 000 ----J*I*K*L*M*x111{|33 3}`UV[_FGEHu+hiv+fw+x+p  /x  J d3e3f3g3h3i3j3k3!w=Oajgih_ ` a b c o) d e f %%% %%%f%g%|h%i%j%k%l%lkj  iB,&>O-&.&/&0&1&2&@3&?=X'Y'Z'['\']'^'_'b`'a'n p1q1r1s1t1u1v1w1x1y1,^,_,`,a,b,c,111Y 111111111!!!SYQ !!VT !!P!U4*!++ L++++++++    """""" " e "" """""<;8:9q"r" 7 s" t"u"( v"- w"x"     Z 76Z\ 2D IEF2 U - 22dF+G+B7 H+; NI+LJAf K%L%M%sVO%P%Q%R%KS% T%""   """""&"E l """+++ ++ ++++; +++N+1! 111 H 11111  ****\ *g~*3 33333333^  . &&'&9 <7(&)&;*&+&: "3$$8<$$3$$$$$$:$4&8 5&BC%D%E% F%G%H%I% J%  V) W)X)Y)Z) 8 [)\)])`1a1b1 >?c1d1e1f1g1h1i1 -y&d z&fe{&gh|&Z }&~&} ij] Uk3 3!3"3l #3$$ R$$$$VS$$$$Z $$$ $ !$"$#$ $$%$ XYZ[\]^_`abcdef&0'0(0F Y)0*0+0x ,0-0.0/0 00../.50.1.} b 2.  = M\ L  K O N    & & &&&&&3&&D &&&!'!(!*!)!+!,! ( * * ****** *000(0,+0000.-/ 000000+.#/#M0#PI 1#2#3#ON Q2SR4#4&&&& &&&6&7&8&9&:&A;&<&=&D C>&7 8 _p9 ]V ( : ; < = > ? B$D(XE(YF(G(H(ZI([H \J(K(N*O*P*Q*R*S*T*U*V*OM^Lc222222z22VUU/V/W/0  4 X/Y/Z/[/\/]/Y())) *)+),)J-)Z# $ % & ' ( [) *  + , a$`b$$ c$e$$df$ge(f(eg(h(i(j(k(l(8m(!# !!!!a !!!!!F) K! ) *+7 (- {,%% % % % % %%0 q%% %/////////8///////"")"""&%""m "" ";   l'm'n'o' &5&&&&&&&&' $$$$$$$$$ $ $222a`222222222e--f-'----%%%%< %%%%%% %2 %%%Z )Y<qk,e-sf-g-h-i-j-k-l-m-n-!!!!! !!!! "#""""" """""** * * *RX * **t *\*' X]_,,,,,,,,, ,,,,,,,&#ED'#(#$F:)#,*#GHJIK+#M,#-# /30313 2333435363738393:3;3<3<*9q? ******? @A c B| @$A$B$ C$m  D$F E$NOLMVP***T&OW[bg *w Q**Y*N S[ ^%_%0 `%a%b%c%d%e%+  fa bcdefgg5hh$i$' -+j$k$l$&m$n$%q l o$#j1k1l1m1n1o1mW X O Y niZ [ \ ] ^ L o ' p ####z1{1|1}1 t1p 11 i111111114 P %% % %%%|o''} ''q'U  -- -------k-V --2JK HG22SR22222PV(W(X(`Y(Z([(a\(&&&&&&&&&&e & Z f$$ T$$$$Y)$$$WX$$\$Z H.K.....e..JIL&&&&9 h &&&& &&&7)=8) 9)h1111111111 '''''''' '!'"'#'#T $'. . .  . . .... ?  _B!!]}4 !!!!!!ry!!!!!!y"  z" {"|"K }"$  m       N R0 g0 0g: Y0  # $% &'[ ;  1f# n 2222233333xy33z$$$%%%4%B %%% R.S.T.U.TV.X.Y.X Z.0 [.          6 ,2-2.2   /202122232|0}0~0000 0001l1ijkm11 1 1 1 1 11n 0 0000 00 0 0 yz {|{ }~  3.4.W 5.6.7.8.9. :.;. * -%.%/%} T/  ) w    ^!DX`!_!a!b!c!*d!e!f!g!7 ; ** *Y*ef2**  $ $ $$$S$$$c$d$Ti k  e$f$g$  +++%i& 4+(+ ', +'''''''  + !!!! !!!!!!!001 %p%%%%^m %%%%"""O" I "&&&R6 &!&"&#&$&5%&"#g$%&'0(K)*+,-./012#-RW$-x YX%-&-'-O Z(-)-*-+-,---f\$h w(kfx( Wy(}z(j|(}(~(&#"$i2j2k2l2m2*)(n2o2p2q2r2s2t2( 9$;$$$5$7$C(.). *.+.,.-.,+0,,,,-,,./,1,- . / \0 #1 "2 3 `a^4 5 6 0IH$$$$$NQ$$$Qx$$MO01112131415161718191:1;1<1=1>1B1?1@13"/#/$/%/&/p /e//'/(/)/*/+/,/-/3..654.87 .:.9;.<....40%1% 2%3%4%5%6%7% 8%9%:%4000050670 00000R 00425262728292:2;2<2=2P>2?2@2A2B2C25*6*7*nv~}8*- 9*:*;*<*|=*8 ./ u f/  ,/ /9228722222@ 5<:2<222R'^2>:#VW;# <#C  =#># ?#Y@#Z=g0h0i0k0l0j0m0n0o0>...=?..j@B....C>*?*@*A*B* C*D*E*F*G*H*@,A,B, Y?6C,D,E,F,G,D"E"H"F"G"I"J"K"I F&G&H&I&HJ&K&J" L&M&FKN&O&P&Q&J---......6 ..K)) A )) M o ) K3L3M3N3O3P3Q3R3S3T3U3V3W3X3M0N0O0P0Q0W0R0d S0T0U0V0P""+ """"J """1R_##W###### .#-#T22Q2W2X2]\22^TYZ2V\ b `   _   ! @ W" Xvq(((wr(( p((s((z((X%Y%aZ%W] Y [%\% ]%X0Y0Z0[0\0]0^0_0`0a0 b0c0d0e0f0\.].^._. `. a.b.c.^/_/`/ a/b/qc/d/e/_I#]`^J#K#$ aL# M#bN#O#P#dcQ#`+a+b:Yb+c+d+Xe+SRf+PO& g+ Uh+i+j+d,} e,f,g,h,i,j,k,l,m,n,o,p,f/g/h/i/j/ k/(l/m/n/o/ p/q/j!mo!!n!u k!!s!!qr!np!! jp2in222or2222q222j*k*l*) m*n*o*p*Pq*l  ~     p0q0r0s0t0u0v0w0x0y0z0O {0r!s!t!u! v!(w!x!)y!/z!{!F |!,*}!" ~! !r/Ls/t/u/v/w/x/y/z/{/|/g}/~///x)~ L O 8 7`y#,$,%,&, ',),*,+,{(l( ( n((o((((m1(u(t(~111111F_ D11G kdef. [ } Y%l  """""""""  2222=; 22222# 222'2?22222./k 1/72/3/4/ 0/< 5/6/'' I H '''''',,,,,,,,,,,, #%$%%%a &%6 ~'%(%)%*%+%,%""""" """""" ^ ""c +r +w+t z)++n++ [ wK1L1N1O1  9 P1Q1M1R1S1####  ##` # / Z102436+8++++++Z+e+z ++++++v +++G++++ + +&5{}|&&&~ &&f&G &* *V i *@! **? j!!Yk!l!m!" %n!aR &E C'{ Go! p!q! 1 kl16 m111111 1#-.### #g # # #, ##0+----------b-_ -++B++]+i > + // y////////////  I!J!K!L!M!N!O!t j Cu   qy rP-sQ-R-tS-T->| u3U-V-W-\  ]l^_`abcz## #### # ## #1./5T(o Y0!%ss t u lrv yvw x 1111111 11(((((d ((((V" %%%% M z ,%%0H A C0IBe 0 < 00 00- -- --------7 --,,,,,,"&!,(,,,*),,,,,,,0000v0 D09F0GE0P00 G) )D)E) C@  )))L)2fg2b22N2h 2l2mk22###/ # w###" $ r-*.*m/*( 0*1*2*p= x3*z{wy4*1-023qrstuvwxyz ! -U-- -VET!-"- QS j 75![ 96 | ;:<=>   ))))))I)))K)H)) Mu ))Z'- ' u'~''.'0'/ ']1R $$$$$$$$$%%%%%%% ! %%F;$<$+ =$>$?$y a U%D V%W%"" '""(f #   #,/*###E  D  N EF  kG   HI 011cI 1de1U1fgh-l7*-4 -8-?<2 --=:[* **> *  *  z , ,,  ,,,T , ,,,,z j ,,,, , , ,22222 2 Y32 2 2 2 2 22"d """%" ""|""@" tuN vw:x&&8 &02&& & &1(7:(98 ((( ( ( ( ( (@(= , !000 0 0 0 0{ 0 0= 5 00t0 0. r W7G1/V   32-9@ FB A-D- - -; - Xs 1 ' '''' '' '''' '++ :4! "| +# + +$  + ++ +h  %%%%%%%%%%%%% ! ! ! ! !!!!!!! j) k) l) m)n)o)p)q)r)s) 3~ 3 3 33333g3<333( S!T!U! V!W!X! Y!Z! F [!\!]! 0 00000000 $$B$$$$@"?$E$$$$      r     X -EG -- CHJ > ---I ;# ****** ***** '8 49652)d)))2)))r)% &TGHIJ KLMUNVOWPX e.QRS " """8 """" z"22222222222222222 2 )) ))))))))))''' ' ''''+~"Jl""""*I c*jdkY&**g *!* "*#*{i00000000000-CKL| ----- ---M NO- P- %Y% X%%%%% YZ[a\]bS>^  e_d`'GIHQP SUTVWY,,,,,',,,,,, N%%%% %% %!%"%)* ) ))))))% r ))}///> / ///// /!/,,,- , (, ,,,,, ,!,",  A $)  **$\****+= ++++X++S2T2U2! V26 W2X2Y2Z2[2\2]2^2_2d@  !]" + 1yVw{1|}~111Q1 1!1"1X$Y$Z$[$\$]$ ^$) _$`$a$b$`2a2b2*c2d2 !%e2f2 g2h2%$)-,/.:9<;JLKNRM]\_^l "0 x" "!"""#" $"^"#`aY, e -3z456789 '  ' [!"''#%'$&'''''! !!!"!0#!$!%!3+0 +/!+123"+5r#+67$+%+8&+ h!i! q X ,,,,,,,,$%, ,#, 08u 0"!000#00&0%$0'0 )!)") #)$)%)U&)')!"#$%&'()*+,-./0123456789:;<=>?@!"#$%&'()*+,-./0123456789:;<=>?@!2"2#2$2Y&Y %2&2'2(2)2*2.+2"$$|$}$  $ ~ $ $d "x v#y&|'}*(~+ 213045#$%&'()*+, -2 $*fle%*&* '*(*)*ht**p+*squoU,*%@ &] ' ( )A*+s, -BkD ./C %"&" '"(")"*" F+","-"."/"0"1"%'&'''(')'*'+','-'.'#t/''&'))())) )? )+))) )*)),) s '(((! )(H *(E+(F,(-(.(/(0(K1(2(JI'+(+)+*+++,+-+;9.+/+:0+1+2+^ 3+4+x<( (((C((( (!("(#(DG$(%(&()0'1'2'3'4'5'6'7'8')++++ ++++++*-+,., !!H!!!!!!!{J!!k !I!G!M,|.}..+~......10...2,, -,., /,0,1,{ 2,3,-!j .!@A/!7 ~ B0!1!m O.-]/-0-1-^_2-3-4-5-cd6-7-b8-1  %%% Y2!'R 3!4!5!6!7!B 8! 9!2" 3" 4"5"6"7"8"9"y3(4(M5(6(LN7(8(9(:(P;(4{|}~  4,5,6,P 7,8,9,:,;,UF<,=,>,?,5= h/ SRK VQ\ T56 8##3###9#2=<#;#>#@^#5#{ 5 6#7#T V U8#9#5+6+7+8+ 9+:+;+<+;> =+>+?+ @+A+YB+=C+D+E+768A?@>BCDFE7/8/9/:/;//?/@/A/B/C/D/9':' ;'<'='>'Y3?'@'A'B'C'D'E'F'G'9-`:-[a;-<-=-eU>-?-@-A-B-C-h\:; <=>?@ABCD E :!!\ ?!:";"<"=">"?"@"A"B"C";y T < LM=>?OQP@AR BSCD` EF;%  <%0 =%>%?%@% A%rB%< .)/) 0)1) 2)3)" d4)5)6)<.=.>.?.@.A. B.C.D. E.W. >=@?BA?##C##### #!#A"###B$#%#?&F 4@&A&B&C&D&: E&3@2A22222222B2C2@ A fB C D dE F M geG c@0A0B0C0D0E0\F0G0H0I0 J0k K0L0ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWAP QRSTUWXVYZA:)[ ;)<)=)>) ?)@)A)B)C)D)E)F)ACD$P$L$$$K$JG$$$A#B#QC#W [ D#.E#F#G#\ /H#A1C1D1^ E1F1G1H1I1J1K>B!!!Cs !!D !!! H ! EC (<>?(;((((((AB(P ((D2E2F2G2H2I2J2K2L2M2N2 O2P2Q2R2E/G/H/F/I/J/ K/L/M/N/O/P/Q/R/S/T/F{, &z FyG& HI -  JKLF. G.H.I.J.K.L.M.N.O.P.Q.G0DM1El234567H8I9:JK4o G)H)% I) WJ) ! K)H'I'J'K'L'M'N'O'P'Q'R'S'T'U'V'VW'H,I,J,Y0K,L,M,N,O,P,Q,pJ&000I0H00LJK0MN9OP0 J+?K+@L+i: M+N+. O+P+xDCQ+R+IEHS+T+L G F$G$H$I$J$K$ L$EM$N$O$ HP$Q$[=R$L( ]M( N( hO(P( ^7Q(R(S(T(U(_L)M)N)O)P)Q)R)S)T)U)M jj MNOPY QR ST U/VW.XYZ[N ))):~ );,)<>?)))=O!ce !]hg0 I!^!!O<( =(>(?(@(QA( B(RSWUVC(TP!D D Q!R! ES Q P RT  S      U   <R&I EH5S& LT&# R,S,T,U,V,W,1 X,Y,Z,[,\,W ],S"T"U" V"W"X" Y"r Z" S$ T$U$\V$W$T =3>3?3@3A3B3C3D3E3F3G3 H3I3J3Tk+l+m+Wn+w o+p+hVq+j+[+r+s+t+x T1U1^1V1W1 X1Y1Z1[1\1w]1H _1U&OV&W&GX&MY& PZ&[&U+V+a G`KW+X+MY+Z+QZ[\+]+^+_+W\X]JKbd$X[Z fc`ebdknmoqpX-vY-x wyzZ-{[-\-]-^-|_-}~YRSQPfg%ecYT [Z] VU^ %K W X `Y#NjZ#'[#\#i(]#Q ^#_# `#a#pb#c#Zn \[os]n&_N^o&`\&]&QR^&_&i `&a&Tb&Uc&^-)))/01)283 ^)_) `)& a)b) c)d)e) f)g)h)i)` n.F  Y%< t  ..  abcdefghijklmnopqrstuvwxyz{|}~a /////4 //T /Y /a*  b*c* d*e*f*g*h*i*c](^(_( `(a(b( c(d( scdefghij klmno pd&e&n f& Wg&h&Y"Vi&Xj&Sk&l&m&d.e.f.g.h.i.-"j.k.#!l.m.n.o.p.efY 0h R#gS#T#U#V#kW#X#efghijklmn opqrsghijklmnopqrstuvwxyz{|}~gD-E-F-jilG-kH-mI-J-nK-oL-M-N-O-pg h i j k l m n o p q ptqr h  N Q   { 1h000P0< 0!0Nj"0#0$0%0hijji`klkmlnopmqrs thWO P Q R jS T U V j`++l+^ ++ g}++l$nm$ oqn$p$r$l&&&&m n &&&N &&&o& &W &G mni)*Cnd#e#f#g#h# i#j#k#l#)m#n#o#p#omnr#q#. n(o(p(q(r(s( \t( gu(iv(o] 1pq1r:1t1u1111vz1x11p$q$!r$(. 4s$t$/2,u$7 / v$"w$*-p& q&r&s&abt&u&v&cw&x&p'q' r's' t'u' v' Zw' Nx'O y'z'{'qrstuvwxyv sq,r,s,t, %u,v,w,x,"y,z,q.r.  %)&$s.'t.u.v.(w./*x.y.z.{. r*s*t* u*v*w*x*s#######sru{tz Y?s#tQOrt#u#sv#w#y#qx#z#{#|#}#~#vuzt++++++ 3 ]++u# t)u)av)w)x)y)z){)|)})unv'  W wxyz{ |}qu2v2401-3w2/Ex2wy22.,+z2{2|2}26~22v% w%x%y%Ez%{%|%z }% ~%x 5 00 000c000xv!a !l !b !!""x+ +o ym+v+++qx$` >1y$z$B{$|$}$.6~$=U$ $$x-y-z-{- |-}- ~- Q --3 G--y ' uz wx{ | } ~ z{ y+z+{+\|+dke}+c~+F++a++]+++_z--A-@x. nI--------zO  : {!3$4$5$K mh 6$7$8$9$:$T{,|, },~,?  ,,,|H I bJ K L M N kl|{ +a~+ |'}'~''L '#' ' '  ''~jX 6du (vt iMS}w4`-a-b-c-d-##{wxy ###X |##*### ####%%L1% }|~ !+!!!,--!.!0 !12!3!$#c %% ! %  %)%%%%)&% 6&& &&` &(((6((( ((K (((-------Y* -H5 -----?e :(3 ((( (((("" """"" " " " " "o""w  % = M -> c  )) )))v) ) ) ) ) ) yM~..... ....8& .!4!! !. G B 5!!m!6!!7! ! !!:)))) )))))  )) I J 22[2222 c2_22d222  m&_& & &&&&p&& &&q&+u++Zp++++As+ ####GoPi ##rE D #D}~##### #####******[**~ **** * * A #  n  +0%    N  ^ qf ? r+  s$3%3&3'3(3)3*3+3,3-3.3L      /r / //// ///// %%% %_%%%%%O U((((y (x4((|(((({(/////////< &/////// !v!!t!u !! Lz~v !w! |!#K #># ## ###S / // / / /2 1 /- b*^** **\ *'*aJ****`....DA.EF...G.M ,,, d, u, ,--- -Bb Y)--- -- -%-'''9 '6'''W' l ''(9(}(J (~((((W*X*Y*Z*[*\* ]*  ^*_*`*** 11111111?111111''''' ' ' ' ' ' '''&&& &&b &&&'''((((((9(()))] .a .r. .!.".#.$.%.o&.'.%7%%%%%  %%*v ***K*Q *qcUh< (( v ((((((((###; ###### #_n  ##Q#  hl## #+ 98 ><!; !!= ! A@!!?'' ''p '''' '%%%X %%%S%%%M  u  +Cz;++++++p ++++,((b((d((((Y(6(( q  C  wQ  ]  - C----- -=Y3Z3[3\3]3^3_3`3a3b3c3..6N..MV..PR O...QUS.T00Z0[\0;W^`_]ab00 01 / : P it s}'''''''''''''''''' 08d ;9v:00000 =?>@ , ,,,,,,,,B ,,)b)> $)#"!))%)))&)1111Y<111111111+i  ++++y +g ++++o ++y*z*{*|*}*~*** *** G%%%2 s %%%%%9 %%8 9@ nH....W.. %...X.... Z.Y] l3m3n3o3 f ~    A N ##k 5 )  # #7((((((: (( (((L  , ---]-///   _/// //[/*F***** *8**x *,,,,,,,, ,,/// ///////////@   N!XRW!.T!!Z013020## u ##` Z# #L  o Y $2 b'ec'd'e'f'g'J h'i'j'k' v %%%%%"%[{ RR$$$$$ $$\[^$S$ bd***Z*** ***c*h ***..\.P[`._^ a......b.c.. '$   '$'cJ '''''' ####J#}####$ """"""""" ~ . .t.}.z # w x|. m .{ L"M"N"O" Y?P"Q"R"// /M//////r//////// /,3,2,,,,,k,,4,,,5,y,D6,A |<=2V? !3"#>$((((( ((> (  (( S0RFTQ0X0p0V0005) _4)))8w w )* )))7)`9 6))sr&t&&&u&v&~  L  ***** y *R ** y _  3   !\fda!!!`E!b/!H! !!i[!_---X--------'''''''' ' ''++" ++ ++= ++*&  g (&&&&&&&&&0&&&..i...;:jk v{ ..l. u . m%n%o%!p%q%r% s%t%u% o IP e/vu"""""" """""$h2g $ o$$H$?$ij3$$k11111 11 1111p r @  Ub)z  ********S w * {|}~  g"h" i"j"U k"l""$,$$C! $$$ $D$ # ## ###  |# #t # ## m"n"Y*o"p"  J  1111111111@1..Q+ .....^.. .mwx&&& &z&by&&&&&& I&&&&g&&&&&DI  ./(012345678 ). -'*,))O 9?)):)BF))A)))J))a   cj "!@t 9:;<=>?@ABC  B  9 <  $$$s$$tu$$$v$xwy z$$/{$$ //////3 /////////(( ($ (((;((%(.o..n.S p .q.s..S uv.j .#1$1 %1&1'1(1)1*1+1,1-1.1/1%%%%%%%% %%%&-- & -- --- --U '''''''''' ()*+,'102030405060708090:0;0<0=0>0N?0"""  "!"""_ "" DEFGJKHIL MNO1111111111y22&&&&&&&5&&&&&& .A* _ A ///////////// ///00000Sc p..D. ./ Y).U G ...E.K&$'$($)$*$+$,$-$.$/$~0$1$2$22t222u2v2t22s w2 ,,,,,,,,, ,; ,,[\ ]^_`abcd => ! 0Y L X + ----C -m---  " "LC """p f " q   o-p-q- r-s-t-u-v- w-F["\"]"^"  _"`"a"b" c"| d" e"f"'2 3'4'5'm '(f _ (q (7()))))))) )))s  {|~ }y~))))))))))o))t B!@! A!C! D!E!F!G!H!%'%&&#$&(&E &.+*-1 /?  V}******h***] *  *x kXu_aglSVY8Mj)|JDqCUF~`#={&6WK^L bB4e,?PA[r3Ot\@2ndc$]H!/wI9N-v1sE5y7mRZzh<;+}f>%G(T Qo.i  '"0 :*Y<pT % = R  l  H3 n^i$  c  & 6 J ] t $ F o& Z; {  [  d ttZ O   ;(bY: u ]    gx<WX <Q *C  MO  @ 5e a+ V. B `4 w e  z Z  $ a s 5 T  J" r , C W h %:Nht)H-Al p M -   y! w   T h 8 [3  #  a8i Y&  Wi X  *  G Q X e qK~+N4 2 #Kn R   f 6 l g rw"r < = M HX44 # B }5OxM  > R I $ S x  lGr8  D y( < Og     aaH   v? 9 _ RP 6 uY  BOH j . 1A,  B[ + d}^ L "[ .@P  DTQS WCm\ZE Jcm2 s nFZ ^)j^$pR  /  eqq4  V `f9x '6 ~ ` \ t@0 !H C ID\ Z < C ]   '&  @ j 3 _] 1Un U E   Y   )D e  ` %?9;LN ][`]` A" r zPcd pe -5 % { N |Y3Q  W j0Y  FS VY1 x rb : (5Mu k A 1 375   Di5 1  :   2!u++ '4 u8w3<[ N=c d? < kI    %  . E T >U @ Dxj H  GN 2 IDi  Ba l 2_X , 8  Z \Gd89 D \q -   bRRZ T K c _^ q $ v]  _ M  .hb _ '    on|A R   =@ s s  4 T2+ sP  L9BkE fGR u p p$R >, Jj0yD= ) 1 6K 6 | n}tC|$8 ! r J 0p  }A ( WC 5Y} ' gEvW j  / J_ >| KT + O l l I "`k +  ~1 `K^ J -v 2 u >t s^l A  o CE 8 , ?  $  9 :g K 2O -  &6= e v[ Ko=7a>y i : lG v;y}~: p R6n> ec )E  O  |. SQ Y0 {  V  xg | >J?  B V[~ ) m N &= # d ( a 7 Tf "1 \  ~ t7-K v ZL. Ay~* . *   z e1 U +* m1u  /}{ > jpNB=WJ  w: k3v A  ; n S .z^ m  *) :N  L  g j [ Xr y h x "! (=DqU2 ib+, C |R `3  q  $_PV6~ 7  mz  B  U #p;& ' {X xzIXLU  d8D'<  m s  I,m%] 7 / " | Ub   6 Y  w  * w  Q `! `  G > t  7 8 L > J ?&:!,9  M |9 N %'S i  ? 2 ^ Z(O-: c/ + |l'S@:X' <C 5`n711 D #: V l A 4 vUW SEzFIa _PZ#7Ha} * ; T h } ~  ) ? P k US 5 $U L + 4{ Y     c G EYuH e ACd ^ [ ! JBZ xo,\X#n tz  Y%?n cLM^v /g o~{ *8M f wqS ^ i wQQw 6bA  ] !Ybn$( ( F E h z fF FJi gL}? Hf 0 G a @  B h {Dm z ui I  6 O c y $m0P ] ;/rFX#  t p o   y  w> *0 P O dE F w  ' ,  x \b%eRM X . y  } g b Q <! z/\ i -/- V AC {r B pSV%>  @  ~ q W96 S0 P P  4 I _ s   0 B S m  MX#} 9 o ~ hCT    , A Z r  & > S 0 "y@O; n)m 8N f  F I |5 = 9o   2%    c  g F?]Xo  - u G  q<G/ o8 tY1h\ I ; qf* /. 4 g? f '&=: `* .Jj  3 H \ q  yY% M%# 9w 3?P M u{ 7 4 ]E c %u &R2d5  L  s bL /        ki " K G" hJ _  4d (9   # 2 G [ p   3 H ^ r O { <   K,W b ,/? v38j)e s 3 W & B [ v  1Ql( =  | e  ^ + 5Z  Q  x yT*( L[rz GQ  {N Y !{ "   - @ V k   _ k q  } k &dh E  ;  s@h  I[f &; K  / @ Q   7  Lg k s. aU) V W) c"k W(  z!K  6C 0' !% ' j ,_ V Y F x) K< < T  F; I &F  @ s# f M om D  $37  t 7   0 0 9p;HN4    kV O ]l. \H -Ub Q5]va Y( P N!  Y 0\ o #  f)+ j *  U=% d\    ~ E2   0 T - 37" P V9<689=42;B4? =  5 : 1 7 A0;C1208B88A655=497514986B29@A 1 = B!2"0"4"8"@#>'9(9(<(=)4)5);*0+1+:+;,1,6-8-;.0.@/4/8050=0@111B2=2A3>40484>52838>9>9?:5:6:>;0;1;5;=<2<8<@?0?5?AA0A2A4A7A<B2B5BBD4D:E3E6E<EAF5F<F=FBG4G@H@HAI0I1I;J2JBK2L8L>M1N5N8O1O7P3P@PBR2R=S8U0U>UBV4V:X4Y3Z4Z9ZAZB[:\3\=\@]3]7]<]=]A^7^=_0_A`=a1a4b?c6c7c@d=f4ggj2j7j8j9j@k1k5l3l4l>o6p5pAr6s<s=t1t=u8u9u;v0v3w2wAx<y7y=y>z?{0||3|8|9|:|;}1}7}A~2~<~=Y 37A32358059:?37>5058:6?247>B<924<B0>B26@6=A44?2359;=1A47<A2:=;8=?B5?A16>AB44?5;06@>39>?55359?A57<?;@059:A:8;A=4>A1515>:;719B5<14456B4B7A09B>46797<B569>9=@A@04>159034=?B6=8;61<529>A6B9:3012795@69<3>1<;6:;5B:@18;@537:=?;<8;;=:/270139:74B17=1B:kB@A57;4<=Y &@8B20084A8>C=  1`: 6 : > ? A C 1? 3 ; 0 8 =8 ? 1 8 9= = >527:@:8<;ACA2^;45+>?5{9;A01 ;47=4?14<<= B?9A2=25;@A7>?A 0 4 9r3 < A1!0!5!:C!=@!>>!B"7":">0"A#?$66$7'>$:%0%2&A'0':'@(0@)@*54?*:*?+<+?,0,<;-7-:;-A-B.8.92.?/1/904080914191<1@292:62;32`>353B4;5455161:70B477787B:828;59::2:4:7;:<5<68>;>B?4A6A:97A?A@B>C0C4D9AD=E1!?E2EBF3F8G0G6=GAH5H:H>I4I5I>AI@J0J3J7J9J?K3I=K4K7K;`2K=L07L4F6M6M9p<M>N4>N9O3 BO4O@P4\4PAQ5Q?R9RAS7S9S=T189T4T;V2V6V8V>1V?V@W195W3W8X5X6X8Y1Y6Z2Z3Z>[3[5]4^3^4^9_2w0_<`7`8`;`Aa2a6a9b3bBcBc>=d3d9d<d?e0e5f@g6\0g:=g>g@h2i2h46i>j0Y <n>j>l5l;m8n1n6o5q8q?r4As2s4d7s8e=s?t8t9u2v:x6x>xAxB;y;z1z=6zB{6|>}3};~43=B344@0344;6?;6AB36>40,89@A;@<<?3>5B588>R4?1A385924!8;99B79567B40>B<483;e6?AR6259:1=M:>B068B%?7:>3T>1?;?@A0<?0x0127?;>@1:=?0B14468<?QA03&2=5556f89?@569=57I29B=5;>54=A8=4?8@:<@@A8?224:;9;0==2441aB2P742:4?A60?@41436<61247860318~7928@<A7?A1A;;=k:?@>?B39:<>35_;?@43=8-1?153:2AB49;2026@>??5299Y ):677:=2579;>3@45:58@A$9B23469;?>09;=B46=8>8;=905;B20689B0g058>>u>964A:=347=>=269B:489=:=;=8A567B@4?=0>?BA8:@>A184680>S?4A:;@2=>?A8>B62039<72?067;C04815:>084B1u<C+8891>5739?X3@  679.598@ 2 5*= 3 ;;; A; 2 5 ?3 A0 C : >30 C C 4A @4AB3)B:5:;dBAA5Y<98;@49B>02j16&>7;N3>I9B848;@Z5B8W4;>2207{A>BAB;AB546=:;=>U268A@`<AFAQ06>&?8?45?0;;@:5AB,4 !" 2YA ;)=!;t>!@!A3"5#7#8#A$1>12$4x9.=$;%>%B!4&15&4&6&B';?(2=(:8(@(A(B2)9):c2)<<*;+5,A-9-@.1.458.7.:/<=@/>/@?/A/B0<%80>0?"?0AY*?15182021#622252812>?33424=4A5059455>8606365A67QB76>772737<480784B8687=>s@8=8?99B19;K69AW9:1>:9::Q=9:?:BG1;2;6;@;B<<4 ><9Y>=1SA=4=8=9=:<*7>2>44?1?7?=A??@0V3@1@3@4,?0@6@8@=p4A5B;B=B?y0C8=C9B9C;C??6D3D5D8D?D@DB7E92E:IBh0E>>E?F@G5G:G;49G=?H4H6H8I6J1BJ5AJ6BJ;9K0K8KBK:=K>K@KAL7M2AM4M7M@>MAN6N:1N==N>NBO2O9O<O=P8P=@Q9Q@t;R7R@^<36S1S3T<S4S5SBT3T6T8T9T?TAU3?;1U5U80U9U=U?V0W0V1V9VB3W5i?W:W<W@F4WB=6X0X7X?7XAYY8Y=Y@5YBS6Z[\[2[6[7[=\2\5\8\:\?1A>\B]2*2]9?^62^A;_5@`1a:a<a=@a?,=b0b9Bb@c1S>1c3F0c4Bc?d4$=d6!7d> Cg8dAe2e;o3e>eA9f12f2XB3f7f<g2g3g7g;g=hijh5h75h8V=5h9#0h@i1i3>i7i8j3k4k8k>@lmnl64lB>=m0O5m3B%3m:@m<mAn3~6n<1n@6Ao1X@o2c8o8*3o;o<o=:oBT=O0p0p2p7p?k;p@N@q0q7BUAq;0q@7r0r5s;r:@Bs1?s5t52tAuA:0tBU4uBv4v8v;v>u1w6{3Aw8w:Y?wB==x2x=A8y4'1y6yBz;z>>zA{={@|=}5>5}627}8}=~~1~5~9~?@6~B689:> @?b>8>&=A07?6059@;0BB768H9=:ABA00B592;2<733865>AB<39499>1=3 9541?6@3y@?<677=A{@89@:0=:@118>??B!15B6:3;57901<>56Ab62 78T0:@BA>9:?1@8?5 :?(85]5=>0678@4;548;069;A!998;=?u47124A7;?09>u:34268q:9:>A86:4;07;431:y:>@6z2176:[9At<2809=>8 6@7S;1CB>6575<082A18<34>?4K<03:6;?B556>B163??02j;3S@60703597nA=:2@7l06x7;;?B=B67:=g1B9m11s63Bg<34K1<>A19>^?]@6A:05?B~A0BAB719;8_>98@A6Y2<B7B497d07A78=@Y@B 404@B_:5?;0@<=3?@01A6B:588?017E@0P661\6:?A;An:=00@3>?B3<2?3{?8 4B48P?:?1>>?153673;8:;:>AB4;5<=B<<=AB04>=A><?A0?^86831B7>21<?97<8=?36>R0:;J=X>A0468@0345778@>9?68;>.Bn;=?;;=;?r=67:y2612:><>k7?<A69d85@@=B1758<231J:@A,@A7:8<038=0B09343A065z56=>34778>q6AB19<1Z=7p=@/;5@j<7@x13W2>?@B@19;=@A31<6/668G3<4x5=>?055j5<2;=m6{>?0A>C<025A:=9>0:@3e1[9>0@23'477;@H=ACA6;B18<<2>2{5:=B%AC 5678>> 246:<jB>99CC@ 1@l7250B 3 444Yz4 85 ;7 < < @5       0@ 1 7A=l1        <42 = B9 2y3 3 333 5>9E4 9; <0h1  0171 2; 52 6l@ 72 :< ? A2168TB<<<<=><+7?47r8057<=77WA?^1@$86 07^@C03133337:=1Y0@#2586277;;<;=3@0C[BA70v=5@11U18:::>:B51233334894:=87?651D;23?<065897;=<5132<@27:=;704295s>@=02233337A@9=4=6x48<9;A@B>780 B5<8B:<6 627b2X:8=? +!, 5 6@ : ? @5!"#$!6"GF-"#$%"#$%"1"2@5"9";"B#$%&#A@.#11#3$3(3)3#4#98L<#=;#B/0$CB/$>$? 6$B<%&'(%ED0%4%5%69 =%90%:%;1%<%=>&;HI&'()&'()&0&5&7@:9&:0&@>9'()*'PQ7'2'5#:CA'6'<'=6;8'?>'B(=LM(4(5(7;(;(>0.6)*+,)TU9)1)2 2)64)81H2)>)?923*XY:*+,-*+,-*69*8?4*<*@Q7*A*B6A@+,-.+0+3,3.3/3+6+=9,5oAb4,9,:6,;G>1,>,B @r9-./0-0 0-27-4@-5+9-6-=->A-?3./01./01.2@`5/012/2/56/6/:= 701M?0313233306Y 0;01123416171:1=?B1>>6i41?9234523452<3<5<9<2?E82@=;345630=373839X<3;3=3@1414353:3;344:4:4@567851+B56k@Q;5:5B=6JK167896789686:26;L1:6=6@;A789:74]?@769;7;=7=A7@47A8NO38185>?8@148A78B>9:;<9396t6u69=?3A9@2@>9BA=1:;<=:;=>:8q<:<>;>6;?3?3<:r7=>?@=5>VW4>?@A>0:>14U7>?7>@0?@AB?@AB?2?8d;?:@:B:C:@7"6@9@<@@ 8B2ABCDA1A3B334A9=<73C@D02D1D2DA,7EFGHE05BFGHIF2^2k22F75F:I:O:Q:F?GHIJGHIJG23G7<?@G8GJ@KLMNKLMNK5K9e?7K?5?BL207L5M5L6L9?>L=L@BT5?LALB 4MNOPM3M87M<[4=8M=(1a8NOPQN0N1N7N;O;U;W;N<<NAOPQROPQRO?|5OA>0OB@P09?P15P2P5rAP9P:P<|<}<

QRSTQ1Q2Q4:Q6Q<1;Q>;RSR1@R3R:S:U:Y:R>0RB1STUVSTUVS03S2t?6TUVWUVWXU6V;+AV<?VA-<WXYZW7W?2BXYZ[X126X9?X;1X=Y5jA;Y7]:Y93Y;\;c;h;Y?Z[?\Z0Z1Z6Z:^:f:h:Z?h=;Z@[1:;[; ;[?97[@A[Aq4*4\]^_\11+202\<>\>\A;]^_`]^_`]0]1];]B@@1^0^5pBB>^>]>^B<_`ab_14 B_4m7_67_7A_9=B_@O>`ab`04<9`3>`4`6`9`?`@Y`Babcdabc5a0[>a3;a7@a;491a@>9aA'74ff5u0f6@f;fA<ghijg5h>Ah?>hA8W6ijklii:l:t:x:i;b5A8i<i=i@'37iAj:klmnklmkk0k3$5k6Aa5k9k=kAR<0l8 8l9w;l<l=l?0?mnopm9}0;m;Am>9n05n4n5A;n9n=0Bn?6opqropqro01;o4Bo7+@o975z@o>q=o@JAp15p6/p815p93Z;qrstqrstq1>q>7?4qB8r1r<Ar@<;rB55stuvstuvs:>sAsBv?R?(6vAwxyzwxyzw1w4z<w5w<w=7w>=2w@x3x8s9x;x?yz{|y5;y<;yA;z3?z6z:z8<{|{|}~{2{7{8@0{:~:::{;Bp:{Bz0|10|2?|666)7|A|B}~}~}2C}47}>}?BfB}B6 9~0D>~3~;~>31x<>@6126e99=&;28@;6B;=;4;@@A88B14>38@=68;L:?1;AB2<613A47=8R;3>V52=<<<<@f014::::;8=8A2f=4831?o:=7? 7A5=\]^000C11(?8]8;;;;=;<>9?@2<7AB=127?A6B6003B58<<<<>}@A$2@1405:6=Y@::::<=C>A[8;9y?9<;?n2;1?H;@1445]6=@5103Z74264?@64<0:41\92>8;=9~@?66@3609::::<97*>=<[0q9?4qA:55=8O67==?_?054;8[<>3<5M0U@:729<<<<=96237;5@A0B@14;4B80::::0371;vB;@q5@def0@A@>z7;AAA_BB2i034:<@<1 @@5 >:5<6?B498<<<<@q2yz{59<83@:de03j?4r>2>59;7B55E577>9@1B<}55s39)AD6;;R82:>/?@@A.A3F>44::::=A?10r?7'Af9<;?<5@40k?123=B2#;385>@468w3?<=B>@?=,21>r2%72AA3=m59:|4;7?8:??@A7?+4=AB496::::0351AT:2l2757:AT20A133=19{4>>A)0iB1L3=?v@x@@146:1P;3?B69;A:B015L?89<<<<0@7313;>08}999;X2??6:@N?79>7274:@8130;Y35&882?B::B=@9<=T@39;46222240IA;;B?B02d:3B:?0|@t4"36/=7:<;9 ?F1=06413526900<>V70;618989<><3::::>??m?7;8>#@C>9>:j4y1A383;1<<<<=>B22224O88>9806B4;97<@=>A8BB8::::?@E=A3B7w919|?6<>2222=>1@A=?B08n7;=20?4539=A:$0;;<69=4Z<0173537:415<<"=m=A<822227@6035B466?@78_3A4;>@1{163:7;80@1k<37nB481>>?9N2>B#5?6y90=941222236569<>? 3W=>7h3979; </7?75Z8:&<14736g4<0@A1B=@c0142@7B9::E;F;?4A3288;Be<47:5;263?A222230@4S<545:==@Ai9;Y?n8;A2B056'88v1;8=A7cA8@?:9=2=B0:866:B6>p;&35<=AB?r;1$<4bA@4>A69999>24?7:>=A1722238A:M;93<;c==b:?:AA1;j6<A@ >BB?B5689MB;B4B68;<=lA@.;0}:1&9=2633=B%@5022f>4<B2:mBBB<>=39798$@8<=3=4?A8B126453:/m413467038=9::: 2OPPD,P8P>PDNPQQDzRT6UEUUUGeedccbbaa``_^^ ] ] \ \ [ [ Z Z Y YXXWWVVUUTTSSRRQQPPONMMLL  KK  !J!J" J"J#I#I$ I$I%H%H&G&G' G'G(F(F) F)F*E*E+D+D,C,C--.B.B/A/A0@0@1?1?2 ?2?3>4=4 =5 <5 <6 ;6 ;7 :7 :8 Y 98 99 898:7;;<<==>>??@@AABBC CDDEEF~F~G}G}H|H|I{I{JzJzKyKyLxLxMwMwNvNvOuOuPtPtQ6Q6R 6R6S5S5TsTsU sUsVrVrW4W4X 4X4YqYqZ3Z3[2[2\ 2\2]1]1^ 1^1_0_0` 0`0a /a/bpbpc pcpd.d.e-e-f,f,gogoh+h+i*i*j)j)knknl(l(m'm'n 'n'o&o&pq%q%rmrmst$t$u lulv kvkw #w#x"x"y!y!z z {{||} }~~ jjii hhgg gg   ff     af_ZAam_ETar_AEar_BHar_DZar_EGar_INar_IQar_JOar_KWar_LBar_LYar_MAar_OMar_QAar_SAar_SDar_SYar_TNar_YEaz_AZbe_BYbg_BGbn_BDbn_INbr_FRbs_BAca_EScaeEScs_CZcy_GBda_DKde_ATdeeATde_BEdeeBEdeY_CHde_DEdeeDEde_LUdeeLUel_GRen_AUen_BWen_CAen_DKen_GBen_HKen_IEeneIEen_INen_NZen_PHen_SGen_USen_ZAen_ZWeo_EOes_ARes_BOes_CLes_COes_CRes_DOes_ECes_ESeseESes_GTes_HNes_MXes_NIes_PAes_PEes_PRes_PYes_SVes_USes_UYes_VEet_EEeu_ESeueESfa_IRfi_FIfieFIfo_FOfr_BEfreBEfr_CAfr_CHfr_FRfreFRfr_LUfreLUga_IEgaeIEgd_GBgl_ESgleESgv_GBhe_ILhi_INhr_HRhu_HUhy_AMid_IDis_ISit_CHit_ITiteITiw_ILja_JPka_GEkl_GLko_KRkw_GBlt_LTlv_LVmi_NZmk_MKmr_INms_MYmt_MTnl_BEnleBEnl_NLnleNLnn_NOno_NOoc_FRpl_PLpt_BRpt_PTptePTro_ROru_RUru_UAse_NOsk_SKsl_SIsq_ALsr_YUsrcYUsv_FIsveFIsv_SEta_INte_INtg_TJth_THti_ERti_ETtl_PHtr_TRtt_RUuk_UAur_PKuz_UZvi_VNwa_BEwaeBEyi_USzh_CNzh_HKzh_SGzh_TWeeuro ccyrillic&.9LC_CTYPELC_NUMERICLC_MONETARYLC_TIMELC_COLLATELC_MESSAGES"(/6BMYeq}ARMSCII-8ASCIICP1251CP1255GEORGIAN-PSISO-8859-1ISO-8859-10ISO-8859-13ISO-8859-14ISO-8859-15ISO-8859-16ISO-8859-2ISO-8859-3ISO-8859-4ISO-8859-5ISO-8859-6ISO-8859-7ISO-8859-8ISO-8859-9KOI8-RKOI8-TKOI8-UTIS-620     ` Y !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??? ??? 0 0:0:0 ???? hlLjztq|*'InpxXoudifFeEgGaACSncs[ annfinity(nil)SuccessOperation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorNo such device or addressArgument list too longExec format errorBad file descriptorNo child processesResource temporarily unavailableCannot allocate memoryPermission deniedBad addressBlock device requiredDevice or resource busyFile existsInvalid cross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceTexYt file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeNumerical argument out of domainNumerical result out of rangeResource deadlock avoidedFile name too longNo locks availableFunction not implementedDirectory not emptyToo many levels of symbolic linksNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedInvalid exchangeInvalid request descriptorExchange fullNo anodeInvalid request codeInvalid slotBad font file formatDevice not a streamNo data availableTimer expiredOut of streams resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorMultihop attemptedRFS specific errorBad messageValue too large for defined data typeName not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in too many shared librariesCannot exec a shared library directlyInvalid or incomplete multibyte or wide characterInterrupted system call should be restartedStreams pipe errorToo many usersSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocolAddress already in useCannot assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableTransport endpoint is already connectedTransport endpoint is not connectedCannot send after transport endpoint shutdownToo many references: cannot spliceConneYction timed outConnection refusedHost is downNo route to hostOperation already in progressOperation now in progressStale NFS file handleStructure needs cleaningNot a XENIX named type fileNo XENIX semaphores availableIs a named type fileRemote I/O errorDisk quota exceededNo medium foundWrong medium typeHangupInterruptQuitIllegal instructionTrace/breakpoint trapAbortedBus errorFloating point exceptionKilledUser defined signal 1Segmentation faultUser defined signal 2Broken pipeAlarm clockTerminatedStack faultChild exitedContinuedStopped (signal)StoppedStopped (tty input)Stopped (tty output)Urgent I/O conditionCPU time limit exceededFile size limit exceededVirtual timer expiredProfiling timer expiredWindow changedI/O possiblePower failureBad system call5@@. @@  !1Aa  0@` #+3;CScs???/etc/busybox.confh11AY&SYA*_rp`ďA@}]Nn}w=qJ6ȕ٧gG[4ݨFsmR}vvZwm/kfm.Wm(V4o.^ 'o =sϫY[WkQypPz ެz{/{zSmX&@-Qܛ3.zvڶugL%Lˑt²dSIא%011lti]MM2jyud iUipI<"k$%*]%L&uwã~}Gx'FT?jaTBO٪N?w7lD*wOW辅_r-I"Oޫw~cï]Yf6 R! ƶi*Ӧ6*렆z$[3Y'Y`k\UvI=r#0QoGޱ9,o5Д_&ݜ}j4.wE"3"!U Q1.H YGnw>gfg8P csGWst< ۊ c\}S'Xn4"BzB"[]35 $-S^VTp0Ue AipJ0#aZA(/LC_ J5$vk?{p|ْ-Ff]2 I:;҃ y{|"N1EXQÔ;EcFoӧXЈ@0H3OF%txv>11㰒0o%CnO&SAb  iɆ2jzdžsی "T ؃"F"4yՓNGW}hDg4- ,5:,`ۓGK N=0 /_{hJ!HE:3JLIw68e5axE; *)z+G rDX=[ߕqjc&"] ϥ\FfL1ڂEy*hݙo喧mpl+$1cӺrac&6&6aﭟۇr ]CNs 9Ȱ.zѼ7 ͹ҵI,U?m%}c:g_2c]V E7tСcQQA^ U-d*3DC&;M-s $!u!b)ӳWiu2"94R@;zPPa8d`4`^end*o,|%㱳9?І{O%nYUW ahP-/mI,.Tی:Q5JHB%Kuʆv9l?I5N ~+@lokxnS me^ʒ3tՍL&A ݴOQMaB\k-<lCrh~XE@ |:sWW׋} c5t̳ 73;\G+$gs[Lte)cciaJ@XtAR;N5CVVy!} ?S[[b`K~C"M~6,^As=h \ũjvt)i#qhwxx_RH) (eZ$T~Ǎ+(Յ$CL@ bA-({ ۻߙ,BMkL\ g;L(1@LQl~ײܺAbryb:fe;~6'Y ɓQy 7钇fʣ vIe$1V۫94DEF.-H_E&u,J4[?rOU~DG|-Хs>F#CcHe\t̉z#r6TΛ OW$flb5O)}@Җ,he=NS]Q34I0#y%IONEb}DAr(%S84S!._B7xd95J:/r?U x ڇ$8"^)u: ×8.i}Zr) \%lRM[OuqT AoơU9NWb \zB:IVOշh+: hFM byA{s`!{MKlBDLԪ{9&:P#%?ӵ`m?uy|xmt}'!W}#!rUb?/է;kjm;{)?a}[]U{n\~L2bErת̕%P= / BԮƉ_-/O2{JQRx.b(Ӡ?N.g `JKW|ObP`g9sةȰZ>ٳq6g*(7e:P}Vp晡"ShHf@: uUiQͱE[ XܙDقѓG0YX]v*/%@5}Zo*c752_CylWYq⛷GGTR_/M{9X!*]3Mvdɒ##TR< D-] U$ăL4=\~ C:zS.yڔJBE¥^rؑHDL;_q"LRHB 瞐y_"}9eE('ԄH(]k4dεxil/ g*Z :mX%@ AR,fsǛq uг0d'!8{5ڟŇCI|Xlhǔ",E$ez|pSǑ7\<ƘYbU-5JPóq3q[`Ulb!1l:\{{jlbl~!KgaO0Y2!k2ЖJZuPIɸA>=oat+ ge^0<2$2_MzkqE ` ,^k E'#Z @OGC:Gl&Jw|/ފ͋:})YsjnLJOz|nvJ3q\VF"r!q POl^:^J M$c_F sbg!6;AzOo&Yln1e(3Xl;2x->n/;P8R8~kt=mmH|CF9<ۂoSJF; #v+16?!L쿚oP3C}j2c?["6 bQvꮄt=D1\Z=3d,U :9`r,IL_D tJL{H4T29_(*%>]k^6ĩCrZ*(ISnIQpka5+1oM1SCf>g0V0; cY@bHϑ؎x+A+gj|`%jDQp=/:#OEa`biШQ sN7))Rټd _}n@gq z\1*"7l a %6L 5 {Ic˫SY-,ԄgPi[/W1U çB9yNP5{-A-Nr acJ5Pf7ȜҦx*FBh2#ançF#Ϸ[7&]N~ګZd ΈKDE` RZ;XBy: NB B1Y#5rmk2_Q*k vWlKcl:>?Lz; L~\r{w,x娗NY*UL < TQu%Jo.c,ܒ1ΐf\J$I8nD;骵TzS'kiۅg>coG?e`3FP7aUY`(tEˌ[\ٜ8Sч[Y(_`; [9^ZWu,g ί<35Պ#86D6i\)[V ؎E-63W kcsk<iKف(^yp6-_\Pn;Bas毰_q!z0(l*D|p?7bg1Hxzuɖ/uB${k2?d(cӭ;޶ gc^́:eOZ~^5Cj'?{7p˶Do=2qhQ:sv )ǭ̌yj^697Ug<]u??-dx@pXCHguxDZp|Gz8P@+-T!q1Ce; h?@-L&\T/&U=qT=el<,b!T]=m w R ]Ixu9a׶=[nmmrǘQqىUa=a%yWǹ7asCl OTIy.;˯0.w:_zy~¹=]H.BD\\n}QXjvX';N;)` ;]ByC"$@J{وP; #҈Ud!՟b{*B)orPѶ2ఛyUH yGQ6$ t/iD?lH`Ș(L QWsi+! [CXi s{PۙEO}Hf釯|N:6JM][{+2 dR'0aC-H4<3.wn{!R ?"FI!򛟧n$ϐ8F0΍6 GkA_:)N>% TD`0=ڬ8Eg VB Y%44W"Vj<7vy=~,n6?FE>v\Tae.j;ˑS08OJ%R0Уd[{q,}20i ze1X;3k>DK0H\SW'tNh^w'PJ]\3P_"6Cq%6Z iWȕ $f|2#ao G$d!}uIe^$~_U ,o1x_]hOG9.O*+G?W!P!Aױ^,O+Ok&ZD KH1c%idV|TڬF =jXX(f(.mbT ԣH(G1Dr~&C0 @ZZ=ޕ u#~e tqu:Z %~զ$.{RdK!uM! 0)c %o7c9{lӖ{ir[,2eUASKI6iODlͭdaE88dbԤ-].TDPvj"JZ/C myaK4tL6zkZ5(TAfx}?x n#Сe(- m ut|Ȑ9Imj   >eP$yHs:{E&ha!(NEqoeM[@(GMI  7kDd$YKeJ(ь.M6 `[m6s3 CEAV*6~vLKv$sLu_vo!DQ"wV&ЧU9vkq9:`Na.Det6@ƙr@%1=AQANXm ޭQ6$ 4Rw`hS.|! HRlSmjkmHRP4 L*?Hz(_;GwַD$:ە#oh>Hfp]exXnn4m~ٱTvG0N5(f~ YiOs146sfMg놧c !TЃ=(30aܯ֞ P 9<3Bٷ}9P2?b~n['MH8x l =Zz4d r01 xgȦFS(ȃqd'5 Fܣ_w+Χ$ZEY y@PqK->^'ޡZUyQPe?4~+1Kd ~]V1%wY>3ujN?%n=M_mEėdH@HL(sa੆G`H8uхo]Rr5q33 # f47pR9#'- @5 bdPtʃ^ ;]}6>=GotO49UZ5:YM 5fNZ5BK B<ZN7ty؊?TTEI}/HVA Vgċ<śNh_]st}k3Y( 孛7]w_b=@COLItM#$iF^Nh9C6|{Js{ÕPA \<>:274ui[oPnbG,&3Epۍ=1g|x>e&!Ѡ]c>Pg J2wN{BHA8EI `16ڿw:yyk_ 6r]pE:)إ5 ?Hp4 NNRHD((=}y膅 K- Ȧ[?N'_}jN=_وwd7:RX=-*{Sl81Td8bdA'_I0X` ͪ ),?B 0dE"DF"u>P~~^V|ӵr~n )t`G|v4E8/uJF#q'{JҨMM2y4sGy7A MrxfPqĞ~:t^=J:;HhwMc=4y`wXIS"B *Db$Qhx4|a۽|̋)t ʙ8Ri%deC 2|2EB쀤Bq ӚCv7I":J|'zE)|hI=vd=P0g[CJj(ϱ c{ab_E66:x6URq {]nE *u0(,/猂SP%=#5([?'"Y4x0v6< RcNb9:_$Giy1k3$i@q@06ǷƮ rl4c[nׂd7qUG\xr!wp;)q,l C̹ Y\"ti8I7COnN1HmkɱJ>̴)Zk^ȇ:+Nb) ˨5՞eߋT:|-\)bJQJ6EMБ@UM(E1Q$*߇:BEt-fyN2 ,VHۇwgl ;lRqo},.x,mS w.7 7@TDXF Nt8~¡f, ,ac_'gĂre/QvJ (w$> ͚< F%dd6Y! D#䠸l dO'NR"fsn dgyCǿ.,X%D\SBYj?8P4o:ƣal-jnQ ^vJr0}jrNX;ׅ&_ ZᮦvR'~-qn*Iu '72AڬAs445uF@"67 arapڣΉIn74yq!ܨ26l"B ?:EZ c~R#¸t鹣[m}9boJUz:zc3htj\ ~ODvYO;a% H=g|`ngV*>^>-o842m9ZLB0`A#QQV )ؒs=aHlaU|^ ];b$(i؄Y^J =懸|Ghl/m#b+ g_i![kE ?@Α ajn!Dc#I $@Ʒ(RV(YҠHw0i-ֱ!Cn<ؽl@DQD@ED@aAB'~x6޽*on?D,5+ 6?sJ->rƥ{^ YcY>kQ='~z&Q?\SєȚ%%: j>_I$A>Y-Rͭq -e(E &DqcTa>,)L]ӳ>*sXN>]g+C`:zeTjvFr\hZ~EZ^rPc!FYJEEaKH/%dmQUFjxt]Ϣlw >E|찿⠔@-ofHz؃+v CIzda8]aB]ͨ b` nLheC Dqb}{]G0%"lD)Mc l`t5 ~]4#Ⴖw[V],;م)оuIʐm(ZF^Ǥwj_Aa|>%ZBHl߷nbCb&vFXeA>&8e>ô01!CCH`!څD$EwLu+g֨ώUPa)~_^/ ք;L0~CA}J ($$E㋸И5[VU?)hH2Ca~ %ӏ/~``ziI[plk>~e p(n9ٯXCATHu. "&}PUJF kVgx} [fbK9t`4bLY4gɀy ^e+ =U?Tı+$NJ!ʨL{=io%!4%8q{T%SB9*6Hȑo<Ѭ=gǗ{1- jUIĥ+ n}H$owEMmjKEZ`N(Dح_u!V'n ;+|&B1[>FR7>;C#O@ZiJ?&FcHćjLdٽ$B2zQ|]ɵ8 TPtlU4l[=) Rx%evug\+o]mOK83Ň:".ՖY"Hzr-ffCYՏ qX3AbÑ++S{'&%BR,=nT/wJ|ih`#UpU G#ۮbGPK>'DDQP\ Ǚ@ÿ́N ~ʯ|.c$%'Ґy 9"5}yHQ.Z*~E2Ԥ_\9p hRfX/Mi<`l,^+_GS|i'"pƀ:ʓ|uܫ@w9D3(vhd XTc@I*nsx2R:}Bg' k/ɤlKF"e숁, 4Pob΢& h#P| 0z= @[vE2 _L&&հ}u>՘Ϫ{>ndA`0,P%Nؔl/5'Bq hedC^yij uܛ"]*dʘ89\ 5` b[yx 3CrQ!Ll1pǠW1.O0I0:ol9wņfĪ\%uBIbzW`5OðU^`|Z/x4"{nu'x|B; |lŴo7~a(NqS7,dgNi=faFO-'6҅mYiPc$oJ-ശ2[lQ LRՔ- %@F1 10- TK~!M811 b[gQ+B"0aɬAKA9 ̉3 j,Ж) X֦L% $6$PYP`Dvw&~A,FTDE cVEtnxvI cBUlծ+XC#fYf`\k*4BFNSMV|Uoǿ;&`9+ 8 W2BFT}P1'ɇQE2bPa,xL=;[hi؂k>]ma>ʜ#52"kD! -[  z*2 h=ZcZND IdL^ѱ' ܚ.V "3& hc{*!CFZHD@zr ]=LSBzrkt dg+s' MJN."j1kV(z;);fӣA@undu¶,9PR$cmi"V^10 ##N= 4QP?!?ʔ|w2SH'r`YIQ;IJY0`_gٿM,($Xsz, gWe)zr;8][SeaY<7k hS4a?,KG Ɨ3DPTaXU>Pm5A oks:4?p{p X^2r6ߒ0!FI`l5pNܰ8y`7Xo`hR8 x#N44Wa. ;8aeҮq7J{c4  iV8\@a#iZF% F !C" 噳"L/-p5HT bA9r%ȱթ 2E@(L`\G)8 VR:cT3Jy@uxf~,(pNid(XܨJ61g'M,EL`qبW84#[Z˻heRA<({v  mysdJkq댆 ^D;BG=]It-)m* H(!kG ®_\2afBAeZ^ AhpB ΅cѽkB6 c5m7A1BHUv*g ldW*T!`Д[*_dԃraއX>cB_g`U>jv\6{jP1(OvU& B}! M(m:KNCBx9G|B+oD] ǁ텳w ^<@@+Art鴂GhrWeW6192|Јq%@ѯ-458f1|3M66[Z`(`CP &c-Ǣ<\ &2X)-Mt_1{7iM%u2\ә%ֆ;9ޥd::iF;(ڶ$- =g|H;{GT( :ҢA(̾n e5 ;\T\Ԫ mn 6πX:6KU-RuSqT L_{]Sv< jg5^[ # BF+`)7ń3"+HDcy[D .EҕT?4?$ړ2^jɱ@4;:gl}d ` %+T*F)hVc02`Ib6 8װW(9WsIq%5U'}qP3XY(6\ڂNN^K -h[JϚؒ03 )?GQ7+05c#7=[9C+>]D'OA2$trCJ/A@ Ļ>}*>B8!ZeXpoC w36X7OV:rOcFOD߆NI⋌1vc-{҆3 Bf[ >V=X*ʔUDBZl A1"ػ>q/QPXV#KV]$sӝ{aFG`H Ad9CbX)рùB^Rl*śuZ{qQ0zXK3 0V,1/~jYv&ni `p clh2Z.7^~zyO+C p{y}4H($W46Z"ZԱtmh *ІxB ozhy+əMBt $JՙPHL28=c]qdWŮt 4 ٠L4Sl+rzxt*vzx&⒤KAQ-#)}/R$!f =w_1xE61B,PL`j52Ti6% i5y9E $=Y@\`,IaDLȝ9μswLGa }$l [R@ kA K5rT-UUt0z*FwMi.l]= ǦQcYefÌ(yTPtNFCʫa(|]˲}9xli N_X¡clŖDDZ`HSA01lh:' I"%NEn- KƁ$I(Sj f}=ܺIDX`FDT,! I=槚CfXX]%B1%Il6');.E` D =4j}}xŨpÜ #ĝ@C ͇DAQTUPQQV:Tc˂" @6y%MP(m]$6KEɿy=vڗh&[ J5[b_6%ӊD ;%u*l]&%8o:?M #*82 F! He7u* B%DKm4i;@ٱt ̋dɎ\Fe1mةb?fUus:ǖSlu+DHy IMq,Ҵy)D%D*UުpƜ_ ]LU5ZL 6`ZۥY=l+wmDds?F,n0 4HAX6l㤱1 ACHQ`fXLJУj52ʡS3 e3hZL.̰ƳL6Aqł,DfA4O^# fbM 4<7 ;5hCrjPl*6 @H@Pދ-I Л_6tomYZ& rd;HI ߄7* qiչoʶQM'I:)ҙPz=Б c.AS#wn_r{ 9 ݂3R31 i \sĹijX"Re23VA,40RXRUh,I2Z0Mi"1`4 &C&I, , ebh[C|x= {tFİ8錱m3;]<.A@Da*05 }P4kؽ:r L়LwavbBݷ].[D2nY6@+a范sh"gD‡OeQHa4((?!}m+ IO $O*KYVO XĈAe" `11A`"֝FF in4'˖% o)21Q_U+6?QB0<pN@+"Nb0:D x@;:;=J;+ߔWwghac?T/Jbu3<=c Xje|HAIQoycF+Zc9NCUN"'z]b#qW=WG87љYm @H"H"ãIfx4cR1PROù*$#wÙ"y {^ ۹:'7c9+l蠥J+' @Рb06U- a(eb0X"EMӇ9Z5=4EH*$W* 1#Ш !R@ ͭTDV2 F1Ne,mB R$UJ ]?yǩOJu"WU _ T*7 OU<śy2f1sN\9"UlC3@` (*)f[JbY.1.ܱ0%E# r ayAmOſT! jaZY)@ټ^1]T{dO.wfw1a|DÒnQwDȝ|fo1#a2pO3PHͪ2"ť,a2;0RJX8H=l GwU` S8֧=P:Yb$PFH)I0y/>"* T=g$`vC2lȵAjPc oNPr"(ȄiS.B[DNQ9u$~ȏS|J $#"c!ŞWD.u(F ImAd5dXDPPG7)lBR ` Dl*PefCqhHu(j^I'N5ClĨT"Y٘QY]Zs w}(1T}.R}E0|ᇠlhiַoCqMtH`\; fm 8}ԨPrmK5$0,)lqnqqem,Eaɀm6FǞ8R).xy4qUrF-()dzlȒ5}Hx^ 2v il;x+lŐ8xuT2+Ey,dsR[ʁt(U-@ԇ+H B7`wZQ@|YIR6 ڀ./!b-A0sW(m0{(P0JLVi KM:I_sTnIj`LgxxG`y!Nrm^^<0 R (4\?Zo7 їrKa!OA$ycL)uTFx0~D F[qHb|/k`zZ\2Qk(֙źK ^GtP,F(U9h6=ou:I(9ظrA pp8HvSPv cAJfpS GU7@q{{YQzZܠc#l:7_\]۬ISd(+ñpN :A@h!0"]8naY' wnZaYXzZ ubeg3VxxM:0/;NE`(K;hJ(s6E|߫m)*)tG6Vw&dxkĕ[z:8SIDŽ|d/&YYtWEGNPrDnnH.!,0( <Ę8B4sbt5`;DXG Dat V@gMZ0b>9y},lqG#Ƚ@BD%4TZIT:0 !ҭ{J3ٚpFXCqC8BhWGp-@ɽ:@,\,/[)HI M"h@ ΆpB6BvP3;*C( J"fxtj%7h"k"]:4C*:fЈ J r͞Wa_x ~4-Xc" c6aӪuA0A  D.[+=6aKa-F (EO `E EyAiQ,V_GAg 3`ؒ*Z X3g^ۛ5uWk/qkw %&b#&QF.£eFJ"a.SQC)QQ ]aˌy2$j"_-@Whrsd E C 8]; ?O  )qc桤P@P,B[}xr "Y~(.~,/O8fjB&q@U"ٜ9NXv) mVaԉX~e<+Y:Q_>hK]Eꍱ tn"/@)LJU}WM :`mx6OϦKhb]G'brLHo Em^(cHL)%z`pV)B/j^Ov5a &ȴԞFܽ Gi9 HR{.Pyv8{1Db {PFpw@ć eil߿ \Pa*U74.bMV/~Mty[ H`scL~IAutyY&:LLMhƦb`I2!CKA1ݱih LBkъI7&1$EB1lCcR@`ʘ-C{}{t*@yԅ YP2n{c`#PfӉMҸI?M6y\ bאf5Ck/TTյ(d!}0,tt6:} v ?'FQhAfQ>mх<ɡ׏?$D16uN 4{# =o/9y2GsHU(C4 ~@mUѢ`3O 9 u+:NM[RZA@(ZtZ BX_4MQCPT>OXESX:5vtA$t(O~gç@~8^$-C_8y1}:}%)„"/usr/binreadingSUIDuserkeyword outside sectionsection header.Parse error in %s, line %d: %s multi-call binary. No help available. Usage: --helpyou have no permission to run this applet!setresgidsetresuidUsing fallback suid method must be suid to work properlybusyboxCopyright (C) 1998-2009 Erik Andersen, Rob Landley, Denys Vlasenko and others. Licensed under GPLv2. See source distribution for full notice. Usage: busybox [function] [arguments]... or: function [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use and BusyBox will act like whatever it was invoked as. Currently defined functions: , --install: applet not found Ssx-Ssx-Ttx-/usr/sbin/dev/urandomLINESCOLUMNSSELinux support is disabledcan't stat '%s'sendtolistencan't open '%s'can't change root directory to %ssetuidsetgid%s: I/O errorlseek(%llu)lseekclose failedshort writecan't duplicate file descriptorcan't create pipecan't move '%s' to '%s'can't remove file '%s'not a symlink%s: cannot read link: %sshort readcan't read '%s'no gzip/bzip2 magicread error from '%s'poll%u.%u.%u-%u:%u%c%u-%u-%u %u:%u%c%2u%2u%2u%2uY)%2u%c%4u%2u%2u%2u%2u%c%s:%s:%lu:%lu:%s:%s:%s %s:%s:%s:%s:%lu:/etc/group/etc/shadow/etc/passwd   gidgsystemS-1:?2:g+g:S%s '%s' in useno %cids leftx:%u:!::homehgecosgshellsingroupGdisabled-passwordDempty-passwordDsystemSno-create-homeHuiduLinux User,,,=1:SD:u+h:g:s:G:DSHu:/home/%snogroup/bin/falsex:%u:%u:%s:%s:%s!:%u:0:99999:7:::addgroup '%s' '%s'addgroup -g %u '%s'can't execute passwd, you must set password manuallym--e:e--mmissing new password$1$an error occurred updating password for %sPassword for '%s' changedencryptedemd5mstdinspassword-fdPsaltSmethodm?2:P+sP:S:m:a:sha512Password: /var/run/utmp/bin/login/etc/issue-2:t+bad speed: %stoo many alternate speeds/dev/%sstdin is not open for read/write%s: TCGETS%s: read%s: input overrun%s: TCSETS%s: can't exec %sI:LH:f:hil:mt:wn Login timed out after %d seconds f:h:p-f is for root onlyUNKNOWN/dev/ on '%s' from '%s'/etc/securetty# Login incorrectinvalid password for '%s'%s/etc/nologin System closed for routine maintenance LOGIN_PRE_SUID_SCRIPTLOGIN_TTYLOGIN_USERLOGIN_UIDLOGIN_GIDLOGIN_SHELLroot login%sa:lud%s can't change password for %sno record of %s in %s, using %scan't change locked password for %sChanging password for %s Old password: incorrect password for %sIncorrect passwordNew password: Retype password: Passwords don't matchpassword for %s is unchanged!%scan't update password file %sPassword for %s changed by %spassword for %s is already %slockedmplc:s:none%c %s %s:%sincorrect passwordusing restricted shellnot a ttyGive root password for system maintenance (or type Control-D for normal startup):Normal startuplogin incorrectSystem Maintenance ModeSUSHELLsushellno password entry for root=0/dev/ttyVT_GETMODEVirtual console%s locked by %s. Password incorrectus-asciitext/plainc:e:o:C:N:a:m:j:%u-%u-%uMime-Version: 1.0 Content-Type: multipart/mixed; boundary="%s" --%s Content-Type: %s; charset=%s Content-Y*Disposition: inline; filename="%s" Content-Transfer-Encoding: base64 --%s-- %%llu.%u.%sContent-Type: ;" multipart/mixedboundary=header: %sno support of content type '%s'charset=Content-Transfer-Encoding:7bitfilename=CONTENT_TYPECHARSETENCODING8bitno support of encoding '%s' x--X:X--x:m::x:Xdeis:r:c:m:h:o:O:%s failed: %s-1:dd:t+:R+:L+:H+bdmVcasTkt:R:Z:L:H:M:F:APOP %sUSER %sPASS %sSTATRETR %uTOP %%u %utmp/%llu.%u.%sdelivery helperDELE %uQUITRCPT TO:<%s>Bad recipient: <%s>f:w+:H--S:S--H:a::tf:o:iw:H:S:a::SMTPHOST127.0.0.1NOOPINIT failedEHLO %sHELO %sAUTH LOGINMAIL FROM:<%s>To: Bcc: To: %sDATAUser: no username or passwordtimed outhelper killed by signal %uhelper exited (%u)qo:f:p:t: mode: %d -o offset: %ld -f frequency: %ld maxerror: %ld esterror: %ld status: %d ( | ) -p timeconstant: %ld precision: %ld tolerance: %ld -t tick: %ld time.tv_sec: %ld time.tv_usec: %ld return value: %d (%s) f:l:d:r:nKIOCSOUNDHANGUPABORTCLR_ABORTTIMEOUTECHOSAYRECORDvVsSE%s min/max priority : %d/%d %s not supported? currentnew-1:r--fo:f--ro:r--fo+mprfocan't %cet pid %d's policypid %d's %s scheduling policy: %s can't get pid %d's attributespid %d's %s scheduling priority: %d sunmontuewedthufrisatIuser %s: parse error at %suser:%s entry:%sMAILTO= command:%sIuser %s: too many linescron.updatecan't chdir(%s)ignoring %sIcan't get uid for %sHOMEIcan't chdir(%s)/var/spool/cronchild running %scan't exec, user %s cmd %s %s %sExec failed: %s -c %s can't vfork%s/cron.%s.%d/var/spool/cron/crontabsf-b:b-f:S-L:L-S:d-l:l+:d+l:L:fbSc:d:crond (busybox 1.16.1) started, log level %d/var/run/crond.pid wakeup dt=%ldItime disparity of %ld minutes detectedfile %s: line %s job: %d %suser %s: process already running: %sTo: %s Subject: cron: %s can't create mail file %s for user %s, discarding outputUSER %s pid %3d cmd %ssendmail-tijanfebmaraY+prmayjunjulaugsepoctnovdecchdir(%s) by %s failed/tmpVISUALEDITORvi?1:dru:c:lerduser %s cannot read %s%s.%u%s.newcan't create %s/%scan't append to %s/%sstack underflowstack overflowsyntax error at '%s'error, base %u is not supported%g %x %o  bhwl /dev/memmmapbad width0x%0*llX ?1:t--T:T--ttTs/dev/cdromnot a sg device or old sg driverBAR_WIDTHBAR_HEIGHTBAR_LEFTBAR_TOPBAR_RBAR_GBAR_B/dev/fb0cs:d:i:f:syntax error: %s#=FBIOGET_VSCREENINFOFBIOGET_FSCREENINFOonly 16 bpp is supported[?25lbad PPM file '%s'P6 %u %u %u Erasing %u Kibyte @ %x - %2u%% complete.jq%s: not a char deviceMEMGETINFOMEMGETOOBSELautoplacement selected and no empty space in oob %s: %s Skipping bad block at 0x%08xbad block check not availableMEMGETBADBLOCK errorMEMERASEMEMWRITEOOB Cleanmarker written at %x.%lx is beyond device size %lx %ld are too many sectors, device only has %ld MEMLOCKMEMUNLOCKErasing blockVerifying kbWriting kb %s: %llu/%llu (%u%%) =2%s is not a MTD flash device%s bigger than %serase error at 0x%llx on %swrite error at 0x%llx on %s, write returned %dverification mismatch at 0x%llxUnspecifiedATA-1 X3T9.2 781D prior to rev.4ATA-1 published, ANSI X3.221-1994ATA-1 X3T9.2 781D rev.4ATA-2 published, ANSI X3.279-1996ATA-2 X3T10 948D prior to rev.2kATA-3 X3T10 2008D rev.1ATA-2 X3T10 948D rev.2kATA-3 X3T10 2008D rev.0ATA-2 X3T10 948D rev.3ATA-3 published, ANSI X3.298-199xATA-3 X3T10 2008D rev.6ATA-3 X3T13 2008D rev.7 and 7aATA/ATAPI-4 X3T13 1153D rev.6ATA/ATAPI-4 T13 1153D rev.13ATA/ATAPI-4 X3T13 1153D rev.7ATA/ATAPI-4 T13 1153D rev.18ATA/ATAPI-4 T13 1153D rev.15ATA/ATAPI-4 published, ANSI INCITS 317-1998ATA/ATAPI-5 T13 1321D rev.3ATA/ATAPI-4 T13 1153D rev.14ATA/ATAPI-5 T13 1321D rev.1ATA/ATAPI-5 published, ANSI INCITS 340-2000ATA/ATAPI-4 T13 1153D rev.17ATA/ATAPI-6 T13 1410D rev.0ATA/ATAPI-6 T13 1410D rev.3aATA/ATAPI-7 T13 1532D rev.1ATA/ATAPI-6 T13 1410D rev.2ATA/ATAPI-6 T13 1410D rev.1ATA/ATAPI-7 published, ANSI INCITS 397-2005Y,ATA/ATAPI-7 T13 1532D rev.0reservedreservedATA/ATAPI-7 T13 1532D rev.4aATA/ATAPI-6 published, ANSI INCITS 361-2002reserved*sdma0 *sdma1 *sdma2 *sdma? *mdma0 *mdma1 *mdma2 *mdma? *udma3 *udma4 *udma5 *udma6 *udma7 *udma0 *udma1 *udma2 pio3 pio4 pio? unknown1SectDualPortDualPortCacheHardSectSoftSectNotMFMHdSw>15uSecSpinMotCtlFixedRemoveableDTR<=5MbsDTR>5MbsDTR>10MbsRotSpdTol>.5%dStbOffTrkOffFmtGapReqnonMagneticsupportedenabledlockedfrozenexpired: security countsupported: enhanced eraseDirect-access deviceSequential-access devicePrinterProcessorWrite-once deviceCD-ROMScannerOptical memoryMedium changerCommunications deviceACS-IT8 deviceACS-IT8 deviceArray controllerEnclosure servicesReduced block command deviceOptical card reader/writerreservedhard sectoredsoft sectorednot MFM encoded head switch time > 15usspindle motor control optionfixed driveremovable drivedisk xfer rate <= 5Mbsdisk xfer rate > 5Mbs, <= 10Mbsdisk xfer rate > 5Mbsrotational speed tol.data strobe offset optiontrack offset optionformat speed tolerance gap reqdATAPI  !"#$%&'@ABCDEFG %-20s*%cdma%u setting %s to %ld (off) (on) setting %s to %ld %s = %2ld (tristate) (unknown: %d) CompactFlash ATA device, with unknownATAPI %s, with unknown device typenon-%sremovable media powers-up in standby; SET FEATURES subcmd spins-up. WARNING: ID response incomplete. Following data may be incorrect. Model Number:Serial Number:Firmware Revision:Media Serial Num:Media Manufacturer:Standards: Used: %s Supported: Likely used: %u & some of %u Used: ATAPI for CD-ROMs, SFF-8020i, r2.5 Supported: CD-ROM ATAPI-%u Likely used CD-ROM ATAPI-1Configuration:3ms<=10ms with INTRQ50us DRQ response: %s Packet size: 12 bytes16 bytes CHS addressing not supported Logical max current cylinders %u %u heads %u %u sectors/track %u %u -- bytes/track: %u bytes/sector: %u CHS current addressable sectors:%11u LY-BA user addressable sectors:%11u LBA48 user addressable sectors:%11llu device size with M = 1024*1024: %11llu MBytes device size with M = 1000*1000: %11llu MBytes (%llu GB) Capabilities: Cmd queuing, Cmd overlap, LBA, (may be)notIORDY%s(can%s be disabled) no IORDYsingle port, single-sectordual port, multi-sector with read caching ability Buffer type: %04x: %s%s Buffer size: %.1fkB bytes avail on r/w long: %u Queue depth: %u Can%s perform double-word IO vendorstandard Standby timer values: spec'd by %swith, %s device specific minimum R/W multiple sector transfer: Max = %u Current = AdvancedPM level: %u (0x%x) unknown setting (0x%04x) Recommended acoustic management value: %u, current value: %u ATA sw reset required Overlap support: %uus to release bus. %uus to clear BSY after SERVICE cmd. DMA: sdma%u (?) Interleaved DMA support Cycle time: min=%uns recommended=%uns PIO: pio%d no flow control=%uns IORDY flow control=%unsCommands/features: Enabled Supported: * %s supported Security: Master password revision code = %u highmaximum Security level %s %umin for %sSECURITY ERASE UNIT. ENHANCED determined by the jumper determined by CSELbelowaboveHW reset results: CBLID- %s Vih Device num = %i%s enabled and required by some commandsCFA power mode 1: %s%s Maximum current = %uma Checksum: %scorrect bad char: '%c' 0x%02x Model=%.40s, FwRev=%.8s, SerialNo=%.20s Config={ } RawCHS=%u/%u/%u, TrkSize=%u, SectSize=%u, ECCbytes=%u BuffType=(%u) %s, BuffSize=%ukB, MaxMultSect=%u, MultSect=?%u? (maybe): CurCHS=%u/%u/%u, CurSects=%lu, LBA=%s, LBAsects=%uon/off IORDY=%s, tPIO={min:%u,w/IORDY:%u}, tDMA={min:%u,rec:%u} PIO modes: pio0 pio1 pio2 DMA modes: UDMA modes: AdvancedPM=%s: disabled (255): unknown setting: mode=0x%02X (%u) WriteCache=%s Drive conforms to: %s: ATA/ATAPI-%u * current active mode BLKFLSBUFHDIO_DRIVE_CMDmlockTiming buffer-cache reads: Timing buffered disk reads:BLKGETSIZE%5uY. MB in %u.%02u seconds = %u kB/s %s: fs readaheadBLKRASET attempting to unregister hwif#%lu HDIO_UNREGISTER_HWIF attempting to scan hwif (0x%lx, 0x%lx, %lu) HDIO_SCAN_HWIF attempting to auto-tune PIO modeset PIO mode to %d set MDMA mode to %d set UDMA mode to %d HDIO_SET_PIO_MODE32-bit IO_support flagHDIO_SET_32BITmultcountHDIO_SET_MULTCOUNTBLKROSETunmaskirqHDIO_SET_UNMASKINTRusing_dmaHDIO_SET_DMADMA queue_depthHDIO_SET_QDMAnowerrHDIO_SET_NOWERRkeep_settingsHDIO_SET_KEEPSETTINGSdrive doorlockdrive keep featuresdrive defect-mgmtdrive prefetchxfermodedefault PIO modedefault PIO mode, disable IORDYPIO flow control mode%usingleword DMA mode%umultiword DMA mode%uUltraDMA mode%udrive read-lookahead setting APM level to %s 0x%02lX (%ld) drive write-caching issuing standby command issuing sleep command disabling Seagate auto powersaving modestandby%u minutes %u seconds%u.%c hoursvendor-specificreservedHDIO_GET_MULTCOUNTioctl %#x failedHDIO_GET_32BIT IO_support =%3ld (default 16-bit)32-bit)32-bit w/sync)Request-Queue-Bypass)???)HDIO_GET_UNMASKINTRHDIO_GET_DMA (DMA-Assisted-PIO)HDIO_GET_QDMAHDIO_GET_KEEPSETTINGSkeepsettingsHDIO_GET_NOWERRBLKROGETBLKRAGETHDIO_GETGEO geometry = %u/%u/%u, sectors = %ld, start = %ld active/idle drive state is: %s HDIO_DRIVE_RESETHDIO_TRISTATE_HWIF no identification info availableHDIO_GET_IDENTITYbus stateHDIO_SET_BUSSTATEHDIO_GET_BUSSTATEBLKRRPARTNOP cmdREAD BUFFER cmdWRITE BUFFER cmdHost Protected Area feature setDEVICE RESET cmdSERVICE interruptRelease interruptLook-aheadWrite cachePACKET command feature setPower Management feature setRemovable Media feature setSecurity Mode feature setSMART feature setFLUSH CACHE EXT cmdMandatory FLUSH CACHE cmd Device Configuration Overlay feature set 48-bit Address feature set SET MAX security extensionAddress Offset Reserved Area BootSET FEATURES subcommand required to spinup after power upPower-Up In Standby feature setRemovable Media Status NotY/ification feature setAdv. Power Management feature setCFA feature setREAD/WRITE DMA QUEUEDDOWNLOAD MICROCODE cmdGeneral Purpose Logging feature setMedia Card Pass Through Command feature set Media serial number SMART self-test SMART error logging gfu::n::p:r::m::c::k::a::B:tTiId::S:D:P:X:K:A:L:W:CyYzZU:Q:wx::b:R:pio0pio1pio2pio3pio4pio5pio6pio7sdma0sdma1sdma2sdma3sdma4sdma5sdma6sdma7mdma0mdma1mdma2mdma3mdma4mdma5mdma6mdma7udma0udma1udma2udma3udma4udma5udma6udma7no kernel supportadd watch (%s) failedFIONREADacew0rmyndDMuoxn+:c+:p++n:c:p:bad class %dioprio_%cet%s: prio %d - %s(%u+%02u:%02u)logged in still- down - crash- no logout gone%-8.8s %-12.12s %-*.*s %-16.16s %-7.7s %s /var/log/wtmpWf:rebootrunlevelsystem boot wtmp begins %s @ABCDEFGHI@KLMNOPQRSTUVWXYZ[\]^_[%u;0H[%u;%uH%s%s (file %i of %i) lines %i-%i/%i (END) - next: %s%i%%read error%7u %07u %s%.*s%.*s%s%s %s%s%s %s(END)%s (file %i of %i)No previous fileNo next fileNo matches found Examine: Cannot read this fileEMmN~ISmissing filenameMark: Invalid mark letterGo to mark: Mark not setLog file: Error opening log fileDoneNo bracket in top lineNo matching bracket foundNo bracket in bottom line ::%crootdir=%s table=%40s %c %o %40s %40s %u %u %u %u %uinvalid line %d: '%s'line %d: can't chown %sline %d: can't chmod %sline %d: regular file '%s' does not existline %d: unsupported file type %c%s%uline %d: can't create node %scatman.so %s/%s.lzmagtbl | nroff -Tlatin1 -mandoc 2>&1 | %s+aw1:2:3:4:5:6:7:8:9MANPATH/usr/manMANPAGERmore/etc/man.config/etc/man.confMANSECT%s/%s%.*s/%s.%.*s.lzmano manual entry for '%s'can't tcsetattr for %s=1:s+:d+:t+Xs:d:t:/var/lock/LCK..%scan't create %s%4d qdxn%u:%u %s: not a block device%s/..not %s is %sa mountpoint bsfbsfmbsrbssdatacompressioneomerasefsffsfmfsrfsslY0<oadlockmkpartnopofflinerewofflineras1ras2ras3resetretensionrewindseeksetblksetdensitydrvbuffersetparttellwsetunloadunlockeofweof/dev/tapeunrecognized opcode %sAt block %d RAID_AUTORUN%c %c can't write to filebad block ones complunexpected block no, 0x%08x, expecting 0x%08xchecksum error, expected 0x%02x, got 0x%02xcrc error, expected 0x%04x, got 0x%04xtoo many errors; giving upafon:{%s}: %7llo currentnew+pcan't %cet pid %d's affinitypid %d's %s affinity mask: %s real %E user %u sys %T Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %xcan't run %s+vpCommand terminated by signal %u Command exited with non-zero status %u %\%uh %um %02us%um %u.%02us%u%%?%%%u.%02ureal %e user %U sys %S+s:t:unknown signal '%s'exec '%s'%32.32s Ft:T:WDIOC_SETOPTIONSWDIOC_SETTIMEOUTV.kodepends=alias=__ksymtab_gplstringsaAb:eF:nr%d.%d.%d/ko_hi3531modules.aliasalias %s %.*s modules.symbolsalias symbol:%s %.*s can't insert '%s': %s/proc/modules%-24sSize Used byModule%s%*s %8s %2s %s symbol:optionsincludeblacklistmodule %s not found in modules.depfailed to unload module %s: %sfailed to load module %s (%s): %sq-v:v-qvqacdlnrt:VC:brmmod/etc/modprobe.conf/etc/modprobe.dinvalid module formatno such moduleunknown symbol in module, or unknown parametermodule has wrong symbol versionkernel doY1)es not support requested operation"%s" wfascan't unload '%s': %spubprivtemptraildontpubautodevnetmaskPERMPUPTRAIL/proc/net/arp%s 0x%x 0x%x %s %s %s ether%s (%s) at * %s [%s] netmask %s No match found in %d entries inet%s: %s not supportedaddress familyA:p:H:t:i:adnDsv%s: unknown %shardware type%s: kernel only supports 'inet'%s: %s without ARP supportneed host nameneed hardware addresscant get HW-Address for '%s'protocol type mismatchinvalid hardware addressfeature ATF_DONTPUB is not supportedfeature ATF_MAGIC is not supported255.255.255.255SIOCSARPNo ARP entry for %s SIOCDARP(priv)SIOCDARP(pub)Sent %u probe(s) (%u broadcast(s)) Received %u repl%s (%u request(s), %u broadcast(s)) eth0interface %s %%s=1:Df:AU:c+DUAqfbc:w:I:s:SIOCGIFFLAGSis not ARPableinvalid source address %ssetsockopt(SO_DONTROUTE)no IP address configuredis not ARPable (no ll address)ARPING to %s from %s via %s recvfromBroadUni%scast re%s from %s [%s]for %s for %u.%03ums UNSOLICITED?addbrdelbraddifdelifstpsetageingsetfdsethellosetmaxagesetpathcostsetportpriosetbridgeprioshowmacsshowSIOCGIFBRbridge name bridge id STP enabled interfacescan't get bridge name for index %dSIOCDEVPRIVATE%s %.2x no yescan't get interface name for index %d %s bridge %siface %stimespec  0.0.0.0/etc/dnsd.confvi:c:t:p:derror at line %u, skippingname:%s, ip:%s.%u.%u.%u.%uAccepting UDP packets on %spacket size %d, ignoredGot UDP packetpacket has 0 queries, ignoredresponse packet, ignoredbi:p:%2x:%2x:%2x:%2x:%2x:%2xcan't read Wake-On-LAN passSIOCGIFHWADDR on %s failedSO_BROADCASTSIOCGIFINDEX425 Use PORT/PASV first ftpd213-File status: Directory listing421 Timeout FILE: uniq.XXXXXX Ok to send datat+:T+:vv:SSvSwt:T:Operation successful Error %s[%u]215 UNIX Type: L8 -Features: EPSV PASV REST STREAM MDTM SIZE Ok213 %llu 213 %04u%02u%02u%02u%02u%02u 211-Server status: TYPE: BINARY 211 Ok 227 PASV ok (%Y2*s,%u,%u) 229 EPSV ok (|||%u|) Opening BINARY connection for %s (%llu bytes)503 Use RNFR first 500 Unknown command unexpected server response%s%s: %scmd %s %s%s %s ftpanonymous-2:vv:cccvu:p:P:Connecting to %s (%s) r+PASSTYPE IPASVREST %lluRETRSTORcontinuecverbosevusernameupasswordpportPdomaindfqdnffileFsethostnamedfisF:vHTTP/1.0 200 OK httpd.conf/etchttp:///%s%.*sconfig error '%s' in '%s'closedStatus: application/octet-streamtext/htmlresponse:%uHTTP/1.0 %d %s Content-type: %s Date: %s Connection: close WWW-Authenticate: Basic realm="%s" Location: %s/%s%s Content-Range: bytes %llu-%llu/%llu Accept-Ranges: bytes Last-Modified: %s %s %llu Content-length:%d %s

%d %s

%s PATH_INFOREQUEST_METHOD%s=%s?%sREQUEST_URISCRIPT_FILENAMESCRIPT_NAMEQUERY_STRINGSERVER_SOFTWARE=busybox httpd/1.16.1SERVER_PROTOCOL=HTTP/1.0GATEWAY_INTERFACE=CGI/1.1REMOTE_ADDRREMOTE_PORTHTTP_USER_AGENTHTTP_ACCEPTHTTP_ACCEPT_LANGUAGECONTENT_LENGTH=%dHTTP_COOKIEREMOTE_USERAUTH_TYPE=BasicHTTP_REFERERHTTP_HOSTchdir %sconnectedPOSTurl:%sCookie:Referer:User-Agent:Host:Accept:Accept-Language:Authorization:Range:bytes=%s %s%s%s%s HTTP/%c.%c cgi-bin//cgi-bin/index.cgiWeb Server Authenticationvv:ifc:d:h:e:r:m:u:p:ifv&#%d;setgroupsOKPartial ContentRequest TimeoutNo request appeared within 60 secondsNot ImplementedThe requested method is not recognizedUnauthorizedNot FoundThe requested URL was not foundBad RequestUnsupported methodForbiddenInternal Server Error.txt.h.c.cc.cpptext/plain.htm.htmltext/html.jpg.jpegimage/jpeg.gifimage/gif.pngimage/png.csstext/css.wavaudio/wav.avivideo/x-msvideo.qt.movvideo/quicktime.mpe.mpegvideo/mpeg.mid.midiaudio/midi.mp3audio/mpegHEAD%a, %d %b %Y %H:%M:%S GMTGETindex.htmletherinfinibandbad: '%s'SIOGIFINDEXSIOC%sinvalid hw-addr %sSIOCGIFMAPSIOCSIFFLAGSmetricmtutxqueuelendstaddrnetmaskbroadcasthwpoY3?intopointkeepaliveoutfillmem_startio_addradddeltrailerspromiscmulticastallmultidynamicSIFMETRICSIFTXQLENSIFDSTADDRSIFNETMASKSIFBRDADDRSKEEPALIVESOUTFILLSIFMAPSIFADDRDIFADDR%s: can't down%s: can't upifenslave%s: SIOCETHTOOL error%s is already a slave%s: can't set address%s: can't clear address%s: can't set MTU%s: can't set hw addresscdfa%s is not a master%s is not up%s is not a slavemaster %s, slave %s: can't change activeskipping %s: can't get flagscan't release %s from %sskipping %s: can't get settingscan't enslave %s to %schange-activecdetachdforcefdownupSIOCGIFFLAGS failedSIOCDEVPRIVATE failedSIOCDEVPRIVATE+1 failedSIOCGMIIPHY failedSIOCGMIIREG failedETHTOOL_GLINK failedSIOCGIWAP failedSIOCETHTOOLusing %s detection modeSIOCGMIIPHYwireless extensionIFF_RUNNINGnetlink: recvnetlink packet too small or truncatedcan't get interface flagsupping interfacecan't set interface flagsfailed to detect link statusIFPLUGD_PREVIOUSIFPLUGD_CURRENTexecuting '%s %s %s'exit code: %d/etc/ifplugd/ifplugd.actiont+:u+:d++ansfFi:r:It:u:d:m:pqlx:Mkifplugd(%s)/var/run/ifplugd.%s.piddaemon already runningunknown API mode '%s'doesn't exist, waitinglink is %sdisinterface %sappearedifacehwaddressbnmaskip link set %iface% downip addr add ::1 dev %iface%ip link set %iface% upip addr add %address%/%netmask% dev %iface%[[ label %label%]]ip link set[[ mtu %mtu%]][[ addr %hwaddress%]] %iface% up[[ip route add ::/0 via %gateway%]]ip tunnel del %iface%ip tunnel add %iface% mode sit remote %endpoint%[[ local %local%]][[ ttl %ttl%]]ip addr add %address%/%netmask% dev %iface%ip addr flush dev %iface%ip addr add 127.0.0.1/8 dev %iface%ip link set[[ addr %hwaddress%]] %iface% upudhcpc -R -n -p /var/run/udhcpc.%iface%.pid -i %iface%[[ -H %hostname%]][[ -c %clientid%]][[ -s %script%]][[ %udhcpc_opts%]]bootpc[[ --bootfile %bootfile%]] --dev %iface%[[ --server %server%]][[ --hwaddr %hwaddr%]] --returniffail --serverbcastip addr add %address%/%bnmask%[[ broadcaY4%st %broadcast%]] dev %iface%[[ peer %pointopoint%]][[ label %label%]][[ip route add default via %gateway% dev %iface%]]poff[[ %provider%]]pon[[ %provider%]]start-stop-daemon --stop -x wvdial -p /var/run/wvdial.%iface% -s 2start-stop-daemon --start -x wvdial -p /var/run/wvdial.%iface% -b -m --[[ %provider%]]kill `cat /var/run/udhcpc.%iface%.pid` 2>/dev/null/var/run/ifstatepre-uppost-downIF_%s=%sIFACEADDRFAMrun-parts /etc/network/if-%s.d/etc/network/interfacesanvfmi:mappingtoo few parameters for line "%s"too many parameters "%s"unknown address type "%s"unknown method "%s"duplicate interface "%s"autointerface declared auto twice "%s"option with empty value "%s"duplicate option "%s"duplicate script in mapping "%s"misplaced option "%s"interface %s already configuredinterface %s not configuredRunning mapping script %s on %s don't seem to have all the variables for %s/%signoring unknown interface %smanualwvdialpppstaticbootpdhcploopbackv4tunnelstreamdgramrdmseqpacketrawcan't extend file limit, max = %dsetrlimitpmap_unset(%u,%u)/var/run/inetd.pid%s: exit status %u%s: exit signal %u%.24s getsockname%s %s: pmap_set(%u,%u,%u,%u)%s/%s: bindparse error on line %u, line is ignoredrpc/no rpc version: '%s'bad rpc versioninternalunknown internal service %s%s: unknown rpc service%s/%s: unknown service%s/%s: unknown host '%s'/etc/inetd.confR+:q+R:feq:non-root must specify config fileaccept (for %s)%s/%s: too many connections, pausing%s: no such %snon-root must run services as himselfKiMiGiTierror: no inet socket availableSIOCGIFCONFcompressedDevice not found%s: error fetching interface information: %sX bytes:%llu (%llu.%u %sB)%s%02X-[NONE SET]%-9.9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s /proc/net/if_inet6%s:%s:%s:%s:%s:%s:%s:%s inet6 addr: %s/%d Scope:GlobalSiteCompatHostUnknown%4s%4s%4s%4s%4s%4s%4s%4s %08x %02x %02x %02x %20s [NO FLAGS] MTU:%d MY50etric:%dRX packets:%llu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%llu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R TInterrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x %02X:%02X:%02X:%02X:%02X:%02X%n%llu%u%u%u%u%n%n%n%llu%u%u%u%u%u%llu%llu%u%u%u%u%n%n%llu%llu%u%u%u%u%u%llu%llu%u%u%u%u%u%u%llu%llu%u%u%u%u%u%u10base210baseTAUI100baseT100baseTX100baseFXDARPA InternetIPv6unspecUNSPECLocal LoopbackEthernetPoint-to-Point ProtocolIPv6-in-IPv4infinibandInfiniBandUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARPPROMISCALLMULTISLAVEMASTERMULTICASTaddressroutelinktunneltunlrulenetmaskmbroadcastbnetworknprefixphostnamehsilentsmbnphsbad IP address: %suse prefix or netmask, not bothbad netmask: %sNETMASK=%s BROADCAST=%s NETWORK=%s PREFIX=%i can't find hostname for %sHOSTNAME=%s %s : USERID : UNIX : %s fiwb:nobodyidentd: interface name '%s' too longbus=driver=mac=can't parse %sno selectors found for %s/etc/mactabsc:can't change ifname %s to %slp:w:i:f:e:acceptfdsocket:[[0000]:%s: bogus data on line %d%s %6ld %6ld %-23s %-23s %-12slaentuwxrWp Proto Recv-Q Send-Q %-23s %-23s State %s %6ld %6ld %-51s %-51s %-12s Proto Recv-Q Send-Q %-51s %-51s State can't scan /proc - are you root?showing only processes with your user IDActive Internet connections (servers and established)(only servers)(w/o servers)Local AddressForeign AddressPID/Program name /proc/net/tcp/proc/net/tcp6/proc/net/udp/proc/net/udp6/proc/net/raw/proc/net/raw6Active UNIX domain sockets Proto RefCnt Flags Type State I-Node Path/proc/net/unix%X%*p: %lX %lX %lX %X %X %lu %nFREELISTENINGCONNECTEDDISCONNECTING[ ACC W N %-5s %-6ld %-11s %-10s %-13s %6lu %08X%08X%08X%08X%*d: %64[0-9A-Fa-f]:%X %64[0-9A-Fa-f]:%X %X %lX:%lX %*X:%*X %*X %d %*d %ld %.20sESTABLISHEDSYN_SENTSYNY63_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSINGSTREAMDGRAMRDMSEQPACKET%-10s %s Address %u: %s%ccan't resolve '%s'Server:Name:send failedexecuting '%s %s'%s=%ustratum%s=%ldfreq_drift_ppmpoll_interval%s=%foffsetdd:p::wnnqNxwp:S:ld46aAbgLmalformed packet received from %s: size %usettimeofday%a %b %e %H:%M:%S %Z %Ysetting clock to %s (offset %fs)stepadjtimexupdate peer:%s, offset:%f, clock drift:%ld ppmrecv(%s) errormalformed packet received from %sreply from %s: not synced, next query in %usreply from %s: reach 0x%02x offset %f delay %f status 0x%02x strat %d refid 0x%08x rootdelay %fsent query to %stimed out waiting for %s, reach 0x%02x, next query in %uspoll %us, sockets:%u, poll interval:%usperiodic (DUP!)%d bytes from %s: seq=%u ttl=%d time=%u.%03u mssetsockopt(ICMP6_FILTER)Destination UnreachablePacket too bigTime ExceededParameter ProblemEcho ReplyEcho RequestListener QueryListener ReportListener Reductionunknown ICMP typewarning: got ICMP %d (%s)can't set multicast source interface --- %s ping statistics --- %lu packets transmitted, %lu packets received, %lu duplicates, %lu%% packet loss round-trip min/avg/max = %u.%03u/%u.%03u/%u.%03u ms =1:q--v:v--q:c+:w+:W+qvc:s:w:W:I:46PING %s (%s): %d data bytes Source QuenchRedirect (change route)Timestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply10245000cbp:P:t:T:Scanning %s ports %u to %u Port Proto State Service %5u tcp %s %s %d closed, %d open, %d timed out (or blocked) ports blockedadddeldelete/proc/net/ipv6_routeKernel IPv6 routing table %-44s%-40sFlags Metric Ref Use Iface DestinationNext Hop%32s%x%*s%x%32s%x%x%x%x%s fscanf%-43s %-39s %-5s %-6d %-2d %7d %-8s resolving %sSIOCADDRTSIOCDELRTgateway %s is a NETWORKnetmask %.8x and host route conflictbogus netmask %snetmask and route address conflict/proc/net/routeMetric Ref Use MSS Window irttKernel IP routing table DestinatY7&ion Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d %-15.15s %-15.15s %-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s -net-hostA:ne metric netmaskgw gatewaymss windowirttdev device reject!mod"dyn #reinstateGHRDMDAC#net#hostslipcslipslip6cslip6adaptiveset stateTIOCSETDcslipp:s:c:ehmLFprotocolbaud rateget stateTIOCGETDSIOCSIFENCAPstatus %u/%u%s%s=%s-3:i--i:ph:vv:b+:c++c:C:i:x:u:l:Eb:hpt:vlistening on %s, starting, uid %u, gid %ulistening on %s, startingcan't look up hostname for %sconcurrency %s %u/%ustart %u %s-%sstart %u %s-%s (%s-%s)UDPTCPTCPORIGDSTADDRPROTOLOCALADDRREMOTEADDRLOCALHOSTREMOTEHOSTTCPCONCURRENCYgot signal %u, exit?exitend %d %s %d Entering character mode%s'^]'. Entering line mode%s'^C'. Console escape. Commands are: l go to line mode c go to character mode z suspend telnet e exit telnet continuing... telnetConnection closed by foreign host Escape character is /etc/issue.netwF:w+:i--w:w--if:l:Kip:b:FSw:file not foundaccess violationdisk fullbad operationunknown transfer idfile already existsno such userbad optionbad blocksize '%s'can't open fileremote filename is too longoctetblksizetsizeserver error: (%u) %sserver only supports blocksize of 512rcu:malformed packet/.dot in file nameg:p:g--p:p--g:gpl:r:b:OUT-OF-RANGE-1:x-xFIlnrdvxt:i:m:p:q:s:w:z:f:46setsockopt RAW_CHECKSUMSO_SNDBUFsetsockopt tos %dcan't get probe addrtraceroute to %s (%s), %d hops max, %d byte packets %2dsetsockopt UNICAST_HOPS %dsetsockopt ttl %dsent %d octets, ret=%dpacket too short (%d bytes) from %s %d bytes from %s to %s: icmp type %d (%s) code %d %2d: x%8.8x %04x: %s (%s) %d bytes to %s %u.%03u ms ! !N !H !P !F-%d !S !A !C !V !U !I !T !<%d>Dest UnreachablePacket Too BigParam ProblemMembership QueryMembership ReportMembership ReductionRouter SolicitRouter AdvertNeighbor SolicitNeighbor AdvertRedirectICMPY8& 1ICMP 2ICMP 6ICMP 7EchoTimestampInfo RequestInfo Replytap%d/dev/net/tun=0:t--d:d--tf:t:d:u:g:bSet '%s' %spersistentnon and owned by uid %ld gid %ld/proc/net/vlan/configioctl error for %sVLAN_PLUS_VIDVLAN_PLUS_VID_NO_PADDEV_PLUS_VIDDEV_PLUS_VID_NO_PADaddremset_name_type set_flagset_egress_mapset_ingress_mapcontinuecspidersquietqoutput-documentOdirectory-prefixPproxyYuser-agentUpassive-ftpheaderpost-datano-check-certificatefdopenhttpftp://not an http or ftp url: %serror getting responsebad header line: %sWget-1:::csqO:P:Y:U:t:T:http_proxyftp_proxyindex.htmlhtGET %stp://%s/%s HTTP/1.1 POST /%s HTTP/1.1 GET /%s HTTP/1.1 Host: %s User-Agent: %s Proxy-Authorization: Basic %s Range: bytes=%llu- Content-Type: application/x-www-form-urlencoded Content-Length: %u %sno response from serverserver returned error: %scontent-length %s is garbagetransfer encoding '%s' is not supportedtoo many redirectionsanonymous:busybox@USER PASS ftp login: %sSIZE SIZE value is garbagebad response to %s: %sRETR ftp error: %scontent-lengthtransfer-encodingchunkedlocationscript %s %s failed, exitcode=%d=2:vv:vffqr:vinvalid link addressSIOCGIFHWADDRstart, interface %siface %s is downdeconfigprotocol familyinetinet6linkonelinefamily460peerremotebroadcastbrdanycastscopedevlabellocalpeeranycastscope"dev""dev" (%s) must match "label" (%s)broadcast can be set only for IPv4 addressesfailed to send flush requestnil ifnameDeleted %d: %s@NONE: @%s: ,M-DOWNmtu %u qdisc %s master %s SIOCGIFTXQLENqlen %d%c link/%s peer brd wrong nlmsg len %d%u: %s inet inet6 family %d peer %s/%d brd %s any %s scope %s secondary tentative deprecated dynamic flags %02x valid_lft forevervalid_lft %dsec preferred_lft forever preferred_lft %dsec %sflushcan't flush link addressesunknown command %sLOOPBACKBROADCASTPOINTOPOINTMULTICASTNOARPUPLOWER_UPaY93dddeletelistshowlstflushtoscopeuplabeldevonoffargument of "%s" must be "on" or "off"wrong address (%s) length: expected %d bytesSIOCSIFNAMESIOCSIFMTUSIOCSIFHWADDRsetshowlstlistupdownnamemtumulticastarpaddressdevsrcviamtulockprotocoltabledevoiftometric/proc/sys/net/ipv4/route/flushprotocoldevoifiifviatablecachefromtoallrootmatchexactmainNot a route: %08x %08x %08x default from %s/%u from %s from 0/%u via %s src %s metric %d %c cache /proc/net/psched%*08x%*08x%08x%08x expires %dsec iif %sneed at least destination addressnot a route?wrong len %dfailed to connect the route"ip route flush"can't flush routing cachecan't send dump requestfromiifoifdevnotifyconnectedtoaddappendchangechgdeletegetlistshowprependreplacetestflushadddeletelistshow%u: 0: from %s/%u0/%dto %s/%u to 0/%d tos %s fwmark %#x iif %s lookup %s realms %s/map-to %s masqueradepreferenceTOSfwmarktable IDfromtopreferenceorderprioritytosfwmarkrealmstablelookupdeviifnatmap-totypehelpSIOCGETTUNNEL%s tunnel modeyou managed to ask for more than onecan't guessikeyokeyTTLTTL must be <=255greipipkeys are not allowed with ipip and sitbroadcast tunnel requires a source addressSIOCCHGTUNNELSIOCADDTUNNELttl != 0 and noptmudisc are incompatibletunl0gre0sit0can't determine tunnel mode (ipip, gre or sit)SIOCDELTUNNELipv6any%s: %s/ip remote %s local %s SIOCGIFNAME dev %s ttl %d ttl inherit tos inherit%c%s nopmtudisc key %s ikey %s okey %s %c Drop packets out of sequence. %c Checksum in received packet is required.%c Sequence packets on output.%c Checksum output packets.wrong format of /proc/net/dev%lu%lu%lu%lu%lu%lu%lu%*d%lu%lu%lu%lu%lu%lu%lucan't get type of [%s]modeipipip/ipgregre/ipsitipv6/ipkeyikeyokeyseqiseqoseqcsumicsumocsumnopmtudiscpmtudiscremoteanylocaldevttlinherittosdsfieldnameaddchangedeleteshowlistlstdeficit %d, rta_len=%d!can'Y:0t talk to rtnetlinkOVERRUNEOF on netlinksender address length == %dtruncated messagemalformed message: len=%d!ERROR truncatedRTNETLINK answersunexpected reply!message truncatedremnant of size %d!dump terminated"%s" is invalid lladdrcan't find device '%s'if%d[%d]database %s is corrupted at line %ddefault/etc/iproute2/rt_tables/etc/iproute2/rt_dsfield/etc/iproute2/rt_realmsglobalnowheresite/etc/iproute2/rt_scopes/etc/iproute2/rt_protoskernelgatedmrtzebrabirdunicastblackholeunreachableprohibitthrownatxresolvelocalnatbroadcastbrdanycastmulticastprohibitunreachableblackholexresolveunicastthrow???either "%s" is duplicate, or "%s" is garbageduplicate "%s": "%s" is the second valuecommand line is not complete, try option "help"an %s %s is expected rather than "%s""%s" may be inet %s, but it is not allowed in this contextprefixclientidcclientid-noneCvendorclassVhostnameHfqdnFinterfaceinownpidfilepquitqreleaseRrequestrscriptstimeoutTversionvretriesttryagainAsyslogSrequest-optionOno-default-optionsoforegroundfbackgroundbarpingaclient-portPEntering listen mode: %sUnicasting a release of %s to %sEntering released state/usr/share/udhcpc/default.scriptc--C:C--c:O::T+:t+:A+:vvc:CV:H:h:F:i:np:qRr:s:T:t:SA:O:ofbaP:vunknown option '%s'%s (v1.16.1) startedudhcp 1.16.1Waiting on select...leasefailNo lease, forking to backgroundNo lease, failingEntering renew stateEntering rebinding stateLease lost, entering init statePerforming a DHCP renewReceived SIGTERMRead error: %s, reopening socketxid %x (our is %x), ignoring packetchaddr does not match, ignoring packetno message type option, ignoring packetno server ID in messageno lease time with ACK, using 1 hour leaseOffered address is in use (got ARP reply), decliningLease of %s obtained, lease time %uboundReceived DHCP NAKnakfSvP:/etc/udhcpd.confmax_leases=%u is too big, setting to %uError on selectReceived a SIGUSR1Received a SIGTERMMAC length != 6, Y;%ignoring packetFound static lease: %xReceived DISCOVERsend OFFER failedReceived REQUESTReceived DECLINEReceived RELEASEReceived INFORMUnsupported DHCP message (%02x) - ignoringbad server IPabsolutearemainingrfilef/var/lib/misc/udhcpd.leases=0:a--r:r--aarf:Mac Address IP Address Host Name Expires %s %-16s%s%*sexpired%u days %02u:%02u:%02u too many leases while loading %sRead %d leasescan't parse line %u in %s, , /-Attaching option %02x to listAttaching option %02x to existing member of list192.168.0.20192.168.0.254max_leases235auto_time7200decline_time3600conflict_timeoffer_time60min_leaselease_filepidfile/var/run/udhcpd.pidsiaddroptnotify_filesnameboot_filestatic_lease%s belongs to someone, reserving it for %u seconds%s: 0x%02x %soption 0x%02x did not fit into the packetAdding optioncan't add option 0x%02xbogus packet, malformed option fieldOption foundOption 0x%02x not found hlen %x xid %x ciaddr %x yiaddr %x siaddr %x giaddr %x chaddr %ssocket(%s)bind(%s)connectPacket read error, ignoringPacket with bad magic, ignoringReceived a packetMSFT 98Broken client (%s), forcing broadcast replies%s%u.%u.%u.%u%s=interface=%sip=mask=%dsiaddr=boot_file=%ssname=%sExecuting %s %sForwarding packet to relayBroadcasting packet to clientUnicasting packet to client ciaddrSending NAKSending ACK to %sno IP addresses to give - OFFER abandonedlease pool is full - OFFER abandonedSending OFFER of %scan't send signalOpening listen socket on *:%d %sis interface %s up and configured?IP %sAdapter index %dMAC %02x:%02x:%02x:%02x:%02x:%02xstatic lease: mac:%02x:%02x:%02x:%02x:%02x:%02x nip:%xcan't enable bcast on raw socketNo a%srp reply received for this addressPacket is too short, ignoringOversized packet, ignoringUnrelated/bogus packet, ignoringBad IP header checksum, ignoringPacket with bad UDP checksum received, ignoringGot valid DHCP packetSending renew...Sending discover...Sending decline...Sending select fY<?or %s...Sending release...Opening raw socket on ifindex %dGot raw socket fd %dAttached filter to raw socket fd %dCreated raw socketCommand %02x %s DATAFILEDuplicated subcommandNo or bad filenameBad lengthFile is too bigExpected %d but got %d bytes . Server said:error while %s%sP:U:sdfP:U:VhC:J:mPRINTERlocalhost%s %s%c%s connected to server%s setting queue/tmp/lprXXXXXXmkstempfA%03u%sH%.32s P%.32s C%.32s J%.99s L%.32s M%.32s ld%.31s sending control file%u c%s sending data file%llu d%s local file changed size?!job accepted%6s%13s%13s%13s%13s%13s totalsharedbuffers%6s%13ld%13ld%13ld%13ld%13ld Mem:%6s%13ld%13ld%13ld Swap:/proc/net/%s%*d: %64[0-9A-Fa-f]:%x %*x:%*x %*x %*x:%*x %*x:%*x %*x %*d %*d %llu%*s %*s %*s %x:%x %llumks64%u/%4sexelibbad signal name '%s'bad option '%s'bad pid '%s'you need to specify whom to kill%s: no process killedcan't kill pid %ucan't kill pid %dncmsfixptbdrpage kmgtpezyctxtintrSwapTotal:SwapFree:MemTotal:MemFree:Buffers:Cached:Slab:%02d:%02d:%02d.%0*dcpu 2.4.loadavgmeminfodiskstatssys/fs/file-nrs+:P+vlfxons:P:o::so:%PPID-:wwTw PID USER VSZ STAT COMMAND mgtpezy%5u %-8.8s %s %s pguunknown user %sbad value: %s%cetpriorityerror: '%s' must be of the form name=valueerror: malformed setting '%s'error: '%s' is an unknown keysetterror %sing key '%s'%s = error reading key '%s'+neAapw/etc/sysctl.conf/proc/sys# = 100% MemTotal: %lu %s Mem: %lu %lu %lu %lu %lu %luMemFree: %lu %s MemShared: %lu %s Buffers: %lu %s Cached: %lu %s Mem: %luK used, %luK free, %luK shrd, %luK buff, %luK cached%s CPU%s:%susr%ssys%snic%sidle%sio%sirq%ssirqLoad average: %s PID PPID USER STAT VSZ %MEM CPU %CPU COMMAND%6ldm%7ld %5u%6u %-8.8s %s%s%3u.%c %3d%3u.%c Writeback:AnonPages:Mapped:Mem %stotal %sanon %smap %sfree%.*s %sslab %sbuf %scache %sdirty %swriteSwap %stotal %sfree PID VSZ VSZRW RSS (SHR) DIRTY (SHR) STACK COMMAND %.*scan't read /proc/statd:n:bmno proceY=*ss info in /proc %02d:%02d:%02d up %d day%s, %2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld -1:n++dtn:Every %us: %-*s%Y-%m-%d %H:%M:%Sreaddir %swarning: %s/%s is a directoryopen %s/%sread %s/%sfchdir-1:a+:c+:d+:f+:l+:m+:o+:p+:r+:s+:t++a:c:d:f:l:m:o:p:r:s:t:u:U:e:/:n:vP012nice%s: warning: cannot %s%s: fatal: cannot %s%svfork for control/?setup stdout for control/?run control/?wait for child control/?stat control/?%s: warning: cannot open %ssupervise/pid.newlog/supervise/pidsupervise/stat.new, paused, got TERM, want down, want exitlog/supervise/statwrite supervise/status.newlog/supervise/status./finish./runvfork, sleepingstart start log/: name too longstat ./logstat log/down: log is not a directorylog/downreadlink ./superviselock supervise/lockreadlink ./log/supervisechange back to service directorylock log/supervise/locklog/supervise/controllog/supervise/ok%s: fatal: can't %s%s%s: warning: %s%s%scan't runsvstart runsv open directory stat read directory Ps:open current directorychange directory, pausingchange directory to fail: warning: warning: can't stat %s/downrun: finish: %s: (pid %d) down: %s: , normally down, normally up, want upfatal: can't %swarning: can't stat %s/check./checkwarning: can't %s child %s/checkwait forok: runsv not runningcan't open supervise/controlcan't write to supervise/controlcan't open supervise/okcan't open supervise/statuscan't read supervise/statuscan't read supervise/status: bad format; log: warning: can't change to log service directory: %sSVDIR/var/serviceSVWAITw+:vvw:vtcuforce-reloadforce-restartforce-shutdownforce-stopcan't change to service directorychange to original directorytimeout: kill: warning: %s: %sinfo: sig%s receivedhangupalarmtermpausing: out of memorypausing: can't %s %sopen directory, want rotatecan't unlink processor leftovercan't read directoryinfo: delete: %s/%scan't unlink oldest logfileinfo: close: %sfsync current logfileseY>)t mode of currentprocessor already runningvfork for processorinfo: processing: %s/%sfatal: can't %s processor %sopen state fornewstatepausing: can't %schange to initial working directorywait for processorchange directory, want processorprocessor failed, restartrename processedset mode of processedwarning: can't unlink: %s/%srename stateinfo: processed: %s/%schange directory, want rotateinfo: rename: %s/current %s %urename currentcreate new currentchange directory, want remove old logfileopen directory, want remove old logfilecan't read directory, want remove old logfilewarning: out of disk space, delete: %s/%swrite to currentchildcan't open log directorycan't change directorycan't lock directorywarning: %s/configinfo: read: %s/configcan't stat currentopen currentinfo: append: %s/currentinfo: new: %s/currentfatal: %sno functional log directorieswarning: %scan't read standard inputtt:vvr:R:l:b:tv%04u-%02u-%02u_%02u:%02u:%02u.%06u000vipipefailnewlineredirectionword;&&&|||(!caseforifinuntilwhile{RANDOMLC_ALLLC_CTYPEHISTFILE !"$&'()*-/:;<=>?[\]`|}~@=nrbtfavx\01234567*?[rwxHOME}-+?==:ugo%s     ()&|; (core dumped)Done(%d)You have stopped jobs. unlimited %lld %ldm%ld.%.3lds%c[%d] Running %*c%d %s%*c%s%sline %d: parameter not set or null%.*s: %s%s%.*s: is read only%.*s: bad variable nameOLDPWDcan't set tty process group (%m)%d: %m (expecting %s)exponent less than 0divide by zeroexpression recursion loop detectedbad fd number%lld"$(...)"$(...)${${#"}$(())>|<<...while && || if ; then ; else ; fiuntil ; do ; done in () { ... };; >>>&<&%s=%s %s: %s not found %s%s%.*s%s can't forkillegal option -%cno arg for -%c optionLPNo previous jobNo current job%s: no such job%s: ambiguousjob %s not created under job control -%u[%d] p:u:rt:n:sIFSexpression expected%.4o illegal mode: %sHSatfdscmlpnvwtoo many argumentsbad number%-20s errY?<or setting limit (%m)out of file descriptorstrap -- %s %s %s: bad trapCDPATHcan't cd to %susage: getopts optstring var [arg]OPTARGIllegal option -%c No arg for -%c option OPTINDcan't access tty; job control turned offillegal option %co %s%-16s%s set %co %s illegal option %c%credir errorpipe call failednonexistent directorycan't create %s: %sno such filecan't open %s: %smissing '))'unterminated quoted stringmissing '}'bad substitutionEOF in backquote substitutionillegal eof marker for << redirection Use "exit" to leave shell. %builtinfunc%s not defined in %s is a shell keywordalias is an alias for %s a tracked alias for is%s %s is a shell functionspecial is a %sshell builtin: not found pvVPS1=# HISTFILE.ash_history/etc/profile.profileENVbad for loop variable-obad function nameeerrexitfnoglobIignoreeofiinteractivemmonitornnoexecsstdinxxtracevverboseCnoclobberaallexportbnotifyunounsetend of file);;`dodoneelifelseesacfithen}3.3:2[2[[6alias2bg3break2cd0chdir2command3continue2echo3eval3exec3exit7export2false2fg2getopts0hash2jobs2kill0let4local2printf0pwd2read7readonly3return3set3shift3source2test3times3trap2true0type0ulimit2umask2unalias3unset2waitPS1=$ PS2=> PS4=+ OPTIND=1Illegal number: %s   read: '%s': not a valid identifierinvalid timeoutREPLYinvalid countinvalid file descriptorS%dcan't execute '%s'ambiguous redirect%s: readonly variablePWD=%sStopped[%d] %-22s %.40s %s: not in a function[%d] %d %s waitpidBuilt-in commands: ------------------%s: bad arguments%s: not in a function or sourced script%s: only meaningful in a loop!+vfunset: -v and -f are exclusive%s: '%s' invalid mode%04o RANDOM%.*s/%sa shell builtintype: %s: not found%s is %s '%.*s'trap -- trap: %s: invalid signal specificationtrap: invalid arguments!nexport %.*sset: %s: invalid option*?[\!srn:p:t:u:glob error %d on '%s'syntax error: unterminated %s$!?#*@_$Y@{name}syntax error\$`"\ ! ! commandnot a valid identifier in forsyntax error: unexpected %s{}<>;&|()#'\$"`unexpected EOF in here documentBUG: unexpected %c cd: %s%s: no current job%%%d%s: bad argument '%s'%s: %d: no such jobkill (SIGCONT)bug in redirect parsemalformed forerror in arithmetic:-=+?%#parameter null or not set$%s: cannot assign in this wayBUG in varexp3BUG in varexp2wait: '%s': not a pid or valid job specwait %s%s %c HUSH_VERSION+c:xinsRun commands in a fileResume a job in the backgroundExit from a loopChange directoryStart new loop iterationConstruct and run shell commandExecute command, don't return to shellExitSet environment variablesBring job into the foregroundList jobsSet local variablesmemleakInput into variableReturn from a functionSet/unset positional parametersShift positional parametersTrap signalsWrite a description of command typeSet file creation maskUnset variablesWait for processdivide by 0HUSH_VERSION=1.16.1<<=>>=<< >>,||&&!=*<=k>=K== |=B&="*=/=#%=C+=-=--3^=b++**/!0< >+=|& */.%N+ --^~,?:$)4(c:nklogd started: %sklogd: error %d in klogctl(2): %mklogd: exitingsemop[SMrup]can't find syslogd buffercan't access syslogd buffercan't get access to semaphores for syslogd buffersemop[SMrdn]p:st:unknown %s name: %sfacilityprioritySMwdnSMwup/dev/console%s.%s%s %.64s %s %s m:nO:l:Ss:b:R:LC::D/var/run/syslogd.pidshmgetshmatsemgetsyslogd started: BusyBox v1.16.1read from /dev/logsyslogd exitingalertcritdebugemergnoticepanicwarnwarningauthauthprivdaemonkernlprnewssecuritysysloguucplocal0local1local2local3local4local5local6local7/var/log/messages ./%srun-parts/etc/acpi/proc/acpi/event/var/log/acpid.logc:e:l:dg:m:s:S:vPWRF/00000080LID/00000080RFKILLSLPB/00000080s+:n+cs:n:klogctlgeometrytimingsinterlaceddoublevsynchsynccsyncextsync mode "%ux%u-%u" # D: %.3f MHz, H: %.3f kHz, V: %.3f Hz geometry %u %u %u %u %u YAtimings %u %u %u %u %u %u %u accel %s rgba %u/%u,%u/%u,%u/%u,%u/%u endmode /etc/fb.modes# endmode%d %d %d %d %d %d %dunknown video mode '%s'FBIOPUT_VSCREENINFOFDGETPRMSingleDouble%s-sided, %d tracks, %d sec/track. Total capacity %d kB Formatting... FDFMTBEGFDFMTTRK%3dFDFMTENDVerifying... problem reading cylinder %d, expected %d, read %dbad data in cyl %d Continuing... EmptyPartition %u is already defined, delete it before re-adding cylinder Disk %s: %lu MB, %llu bytes Disk %s: %lu.%lu GB, %llu bytes %u heads, %u sectors/track, %u cylinders, total %u sectors Units = %s of %u * %u = %u bytes The number of cylinders for this disk is set to %u. There is nothing wrong with that, but this is larger than 1024, and could in certain setups cause problems with: 1) software that runs at boot time (e.g., old versions of LILO) 2) booting and partitioning software from other OSs (e.g., DOS FDISK, OS/2 FDISK) %c%2x %-22.22sPartition %u has different physical/logical beginnings (non-Linux?): phys=(%u, %u, %u) logical=(%u, %u, %u) Partition %u has different physical/logical endings: Partition %u does not end on cylinder boundary %c: unknown command Unknown value(s) for: (settable in the extra functions menu) Disk %s: %u heads, %u sectors, %u cylinders Nr AF Hd Sec Cyl Hd Sec Cyl Start Size ID%2u %02x%4u%4u%5u%4u%4u%5u%11u%11u %02x Warning: bad start-of-data in partition %u Partition %u contains sector 0 Partition %u: head %u greater than maximum %u Partition %u: sector %u greater than maximum %u Partition %u: cylinder %u greater than maximum %u Partition %u: previous sectors %u disagrees with total %u Warning: partition %u overlaps partition %u Warning: partition %u is empty Logical partition %u not entirely in partition %u Total allocated sectors %u greater than the maximum %u %u unallocated sectors %*s Boot Start End Blocks Id System Devicepart%*.*s%s%-2u%s %c %11u %11u %11u%c %2x %s Partition table entries are not iYBn disk orderCommand Actiona toggle a bootable flagb edit bsd disklabelc toggle the dos compatibility flagd delete a partitionl list known partition typesn add a new partitiono create a new empty DOS partition tablep print the partition tableq quit without saving changess create a new empty Sun disklabelt change a partition's system idu change display/entry unitsv verify the partition tablew write table to disk and exitx extra functionality (experts only)The partition table has been altered! Calling ioctl() to re-read partition tableWARNING: rereading partition table failed, kernel still uses old table'%s' is opened for read only Note: sector size is %u (not 512) device has more than 2^32 sectors, can't use all of themDevice contains neither a valid DOS partition table, nor Sun, SGI or OSF disklabelIgnoring extra extended partition %u Bad offset in primary extended partitionWarning: deleting partitions after %u Warning: extra link pointer in partition table %u Warning: ignoring extra data in partition table %u Omitting empty partition (%u) Warning: invalid flag 0x%02x,0x%02x of partition table %u will be corrected by w(rite) DOS disklabel/dev/hd/proc/ide/%s/mediaDisk %s doesn't contain a valid partition table /proc/partitions %u %u %u %[^ ]%s (%u-%u): %s (%u-%u, default %u): Using default value %u Value is out of rangePartition numberWarning: partition %u has empty type Selected partition %u No partition is defined yet!First %sSector %u is already allocated No free sectors availableLast %s or +size or +sizeM or +sizeKAll primary partitions have been defined already!b+:C+:H+:S+b:C:H:lS:uCommand (m for help): WARNING: Partition %u is an extended partition DOS Compatibility flag is setDOS Compatibility flag is not setThe maximum number of partitions has been createdYou must delete some partition and add an extended partition firste extendedl logical (5 or over)Command action %s p primary partition (1-4) Invalid partition number for type '%c' PYCartition %u does not exist yet! Hex code (type L to list codes): Type 0 means free space to many systems (but not to Linux). Having partitions of type 0 is probably unwise.You cannot change a partition into an extended one or vice versaChanged system type of partition %u to %x (%s) Changing display/entry units to %s Expert command (m for help): Partition %u has no data area New beginning of dataNumber of cylindersDevice: %s 0x%03X: %02XOrdering is already correct Done.Number of headsNumber of sectorsWarning: setting sector offset for DOS compatiblityb move beginning of data in a partitionc change number of cylindersd print the raw data in the partition tablee list extended partitionsf fix partition orderh change number of headsr return to main menus change number of sectors/trackFAT12FAT16 <32MExtendedFAT16HPFS/NTFS OS/2 Boot Manager Win95 FAT32 Win95 FAT32 (LBA)Win95 FAT16 (LBA)Win95 Ext'd (LBA)Hidden FAT12Compaq diagnosticsHidden FAT16 <32MHidden FAT16Hidden HPFS/NTFSHidden Win95 FAT32Hidden W95 FAT32 (LBA)Hidden W95 FAT16 (LBA)