15Q(;"[e$ 8NR2090q,Lz-YFSS!V10#fmkyaffs2image Version: Linux-2.6.35-Google Nand Controller V301, make time: Thu Jun 8 02:33:53 2017 .^.flash%A9Y9Y9Y0nfsrootA9Y8Y8Y&init9Y8Y8Ysbin/init3ko_hi3521A9Y9Y9Y)pinmux_hi3521_16D1.sh9Y'X8Y<#pin select muxctrl_reg0 himm 0x200f0000 0x00000000 #VIU0_CLK / GPIO12_0 / / muxctrl_reg0 himm 0x200f0004 0x00000002 #VIU0_VS / GPIO12_2 / VIU0_CLKA / muxctrl_reg1 himm 0x200f0008 0x00000000 #VIU0_HS / GPIO12_3 / UART2_RXD / muxctrl_reg2 himm 0x200f000c 0x00000000 #VIU0_DAT15/ GPIO0_0 / / muxctrl_reg3 himm 0x200f0010 0x00000000 #VIU0_DAT14/ GPIO0_1 / / muxctrl_reg4 himm 0x200f0014 0x00000000 #VIU0_DAT13/ GPIO0_2 / / muxctrl_reg5 himm 0x200f0018 0x00000000 #VIU0_DAT12/ GPIO0_3 / / muxctrl_reg6 himm 0x200f001c 0x00000000 #VIU0_DAT11/ GPIO0_4 / / muxctrl_reg7 himm 0x200f0020 0x00000000 #VIU0_DAT10/ GPIO0_5 / / muxctrl_reg8 himm 0x200f0024 0x00000000 #VIU0_DAT9 / GPIO0_6 / / muxctrl_reg9 himm 0x200f0028 0x00000000 #VIU0_DAT8 / GPIO0_7 / / muxctrl_reg10 himm 0x200f002c 0x00000000 #VIU0_DAT7 / GPIO1_0 / / muxctrl_reg11 himm 0x200f0030 0x00000000 #VIU0_DAT6 / GPIO1_1 / / muxctrl_reg12 himm 0x200f0034 0x00000000 #VIU0_DAT5 / GPIO1_2 / / muxctrl_reg13 himm 0x200f0038 0x00000000 #VIU0_DAT4 / GPIO1_3 / / muxctrl_reg14 himm 0x200f003c 0x00000000 #VIU0_DAT3 / GPIO1_4 / / muxctrl_reg15 himm 0x200f0040 0x00000000 #VIU0_DAT2 / GPIO1_5 / / muxctrl_reg16 himm 0x200f0044 0x00000000 #VIU0_DAT1 / GPIO1_6 / / muxctrl_reg17 himm 0x200f0048 0x00000000 #VIU0_DAT0 / GPIO1_7 / / muxctrl_reg18 #VIU1 muxctrl_reg19 himm 0x200f004c 0x00000000 #VIU1_CLK / GPIO12_1 / / muxctrl_reg19 himm 0x200f0050 0x00000002 #VIU1_VS / GPIO12_4 / VIU1_CLKA / muxctrl_reg20 himm 0x200f0054 0x00000000 #VIU1_HS / GPIO12_5 / UART2_TXD / muxctrl_reg21 himm 0x200f0058 0x00000000 #VIU1_DAT15/ GPIO2_0 / / muxctrl_reg22 himm 0x200f005c 0x00000000 #VIU1_DAT14/ GPIO2_1 / / muxctrl_reg23 himm 0x200f0060 0x00000000 #VIU1_DAT13/ GPIO2_2 / / muxctrl_reg24 himm 0x200f0064 0x00000000 #VIU1_DAT12/ GPIO2_3 / 3: / muxctrl_reg25 himm 0x200f0068 0x00000000 #VIU1_DAT11/ GPIO2_4 / / muxctrl_reg26 himm 0x200f006c 0x00000000 #VIU1_DAT10/ GPIO2_5 / / muxctrl_reg27 himm 0x200f0070 0x00000000 #VIU1_DAT9 / GPIO2_6 / / muxctrl_reg28 himm 0x200f0074 0x00000000 #VIU1_DAT8 / GPIO2_7 / / muxctrl_reg29 himm 0x200f0078 0x00000000 #VIU1_DAT7 / GPIO3_0 / / muxctrl_reg30 himm 0x200f007c 0x00000000 #VIU1_DAT6 / GPIO3_1 / / muxctrl_reg31 himm 0x200f0080 0x00000000 #VIU1_DAT5 / GPIO3_2 / / muxctrl_reg32 himm 0x200f0084 0x00000000 #VIU1_DAT4 / GPIO3_3 / / muxctrl_reg33 himm 0x200f0088 0x00000000 #VIU1_DAT3 / GPIO3_4 / / muxctrl_reg34 himm 0x200f008c 0x00000000 #VIU1_DAT2 / GPIO3_5 / / muxctrl_reg35 himm 0x200f0090 0x00000000 #VIU1_DAT1 / GPIO3_6 / / muxctrl_reg36 himm 0x200f0094 0x00000000 #VIU1_DAT0 / GPIO3_7 / / muxctrl_reg37 #VOU1120_CLK internal sync himm 0x200f0098 0x00000001 #GPIO12_6 / VOU1120_CLK / LCD_CLK / muxctrl_reg38 #[tommy] conflict with hw wdt #himm 0x200f009c 0x00000001 #GPIO4_0 / VOU1120_DAT15/ UART3_TXD / muxctrl_reg39 #himm 0x200f00a0 0x00000001 #GPIO4_1 / VOU1120_DAT14/ LCD_DATA_G1 / muxctrl_reg40 #himm 0x200f00a4 0x00000001 #GPIO4_2 / VOU1120_DAT13/ LCD_DATA_G2 / muxctrl_reg41 #[tommy] this is our buzzer, should be closed himm 0x200f00a8 0x00000000 #GPIO4_3 / VOU1120_DAT12/ LCD_DATA_G3 / muxctrl_reg42 himm 0x200f00ac 0x00000001 #GPIO4_4 / VOU1120_DAT11/ LCD_DATA_G4 / muxctrl_reg43 himm 0x200f00b0 0x00000001 #GPIO4_5 / VOU1120_DAT10/ LCD_DATA_G5 / muxctrl_reg44 himm 0x200f00b4 0x00000001 #GPIO4_6 / VOU1120_DAT9 / LCD_DATA_G6 / muxctrl_reg45 himm 0x200f00b8 0x00000001 #GPIO4_7 / VOU1120_DAT8 / LCD_DATA_G7 / muxctrl_reg46 himm 0x200f00bc 0x00000001 #GPIO5_0 / VOU1120_DAT7 / LCD_DATA_B0 / muxctrl_reg47 himm 0x200f00c0 0x00000001 #GPIO5_1 / VOU1120_DAT6 / LCD_DATA_B1 / muxctrl_reg48 himm 0x200f00c4 0x00000001 #GPIO5_2 / VOU1120_DAT5 / LCD_DATA_B2 / mux0:ctrl_reg49 himm 0x200f00c8 0x00000001 #GPIO5_3 / VOU1120_DAT4 / LCD_DATA_B3 / muxctrl_reg50 himm 0x200f00cc 0x00000001 #GPIO5_4 / VOU1120_DAT3 / LCD_DATA_B4 / muxctrl_reg51 himm 0x200f00d0 0x00000001 #GPIO5_5 / VOU1120_DAT2 / LCD_DATA_B5 / muxctrl_reg52 himm 0x200f00d4 0x00000001 #GPIO5_6 / VOU1120_DAT1 / LCD_DATA_B6 / muxctrl_reg53 himm 0x200f00d8 0x00000001 #GPIO5_7 / VOU1120_DAT0 / LCD_DATA_B7 / muxctrl_reg54 #VGA himm 0x200f00dc 0x00000002 #GPIO13_0 / VOU1120_HS / VGA_HS / muxctrl_reg55 himm 0x200f00e0 0x00000002 #GPIO13_1 / VOU1120_VS / VGA_VS / muxctrl_reg56 #BT656 himm 0x200f00e4 0x00000001 #GPIO12_7 / VOU656_CLK / reserved / SDIO_CCLK_OUT / muxctrl_reg57 himm 0x200f00e8 0x00000001 #GPIO6_0 / VOU656_DAT7 / LCD_DATA_R0 / SDIO_CARD_POWER_EN / muxctrl_reg58 himm 0x200f00ec 0x00000001 #GPIO6_1 / VOU656_DAT6 / LCD_DATA_R1 / SDIO_CARD_DETECT / muxctrl_reg59 himm 0x200f00f0 0x00000001 #GPIO6_2 / VOU656_DAT5 / LCD_DATA_R2 / SDIO_CWPR / muxctrl_reg60 himm 0x200f00f4 0x00000001 #GPIO6_3 / VOU656_DAT4 / LCD_DATA_R3 / SDIO_CCMD / muxctrl_reg61 himm 0x200f00f8 0x00000001 #GPIO6_4 / VOU656_DAT3 / LCD_DATA_R4 / SDIO_CDATA3 / muxctrl_reg62 himm 0x200f00fc 0x00000001 #GPIO6_5 / VOU656_DAT2 / LCD_DATA_R5 / SDIO_CDATA2 / muxctrl_reg63 himm 0x200f0100 0x00000001 #GPIO6_6 / VOU656_DAT1 / LCD_DATA_R6 / SDIO_CDATA1 / muxctrl_reg64 himm 0x200f0104 0x00000001 #GPIO6_7 / VOU656_DAT0 / LCD_DATA_R7 / SDIO_CDATA0 / muxctrl_reg65 #SIO0 himm 0x200f0108 0x00000001 #GPIO7_0 / SIO0_RCLK / muxctrl_reg66 himm 0x200f010c 0x00000001 #GPIO7_1 / SIO0_RFS / muxctrl_reg67 himm 0x200f0110 0x00000001 #GPIO7_2 / SIO0_DIN / muxctrl_reg68 #SIO1 himm 0x200f0114 0x00000001 #GPIO7_3 / SIO1_RCLK / muxctrl_reg69 himm 0x200f0118 0x00000001 #GPIO7_4 / SIO1_RFS / muxctrl_reg70 himm 0x200f011C 0x00000001 #GPIO7_5 / SIO1_DIN / muxctrl_reg71 #SIO2 himm 0x200f0120 0x00000001 #GPIO7_6 / SIO2_XCLK / muxctrl_reg72 himm 0x200f0124 0x00000001 #GPI%: O7_7 / SIO2_XFS / muxctrl_reg73 himm 0x200f0128 0x00000001 #GPIO8_0 / SIO2_RCLK / muxctrl_reg74 himm 0x200f012c 0x00000001 #GPIO8_1 / SIO2_RFS / muxctrl_reg75 himm 0x200f0130 0x00000001 #GPIO8_2 / SIO2_DIN / muxctrl_reg76 #SPI himm 0x200f0134 0x00000001 #GPIO8_3 / SPI_SCLK / muxctrl_reg77 himm 0x200f0138 0x00000001 #GPIO8_4 / SPI_SDO / muxctrl_reg78 himm 0x200f013c 0x00000001 #GPIO8_5 / SPI_SDI / muxctrl_reg79 himm 0x200f0140 0x00000001 #GPIO8_6 / SPI_CSN0 / muxctrl_reg80 #himm 0x200f0144 0x00000000 #SPI_CSN3 / NF_BOOT_PIN4 / CLK_TEST_OUT0/1/2/3 #I2C #himm 0x200f0148 0x00000001 #GPIO13_2 / I2C_SDA / muxctrl_reg82 #himm 0x200f014c 0x00000001 #GPIO13_3 / I2C_SCL / muxctrl_reg83 #HDMI pinmux -uboot #himm 0x200f01cc 0x00000001 #GPIO11_4 / HDMI_HOTPLUG/ muxctrl_reg115 #himm 0x200f01d0 0x00000001 #GPIO11_5 / HDMI_CEC / muxctrl_reg116 #himm 0x200f01d4 0x00000001 #GPIO11_6 / HDMI_SDA / muxctrl_reg117 #himm 0x200f01d8 0x00000001 #GPIO11_7 / HDMI_SCL / muxctrl_reg118 : load35219Y'X8Y?#!/bin/sh # Useage: ./load [ -r|-i|-a ][type] # -r : rmmod all modules # -i : insmod all modules # default : rmmod all moules and then insmod them # type: 16d1,8960h,2hd,4720p,1hd7d1 # SDK_TYPE=16d1 if [ $# -ge 2 ]; then SDK_TYPE=$2 fi if [ $SDK_TYPE = "16d1" ]; then echo "SDK_TYPE type is $SDK_TYPE" elif [ $SDK_TYPE = "8960h" ]; then echo "SDK_TYPE type is $SDK_TYPE" elif [ $SDK_TYPE = "2hd" ]; then echo "SDK_TYPE type is $SDK_TYPE" elif [ $SDK_TYPE = "4720p" ]; then echo "SDK_TYPE type is $SDK_TYPE" elif [ $SDK_TYPE = "1hd7d1" ]; then echo "SDK_TYPE type is $SDK_TYPE" else SDK_TYPE=16d1 echo "SDK_TYPE type is $SDK_TYPE" fi report_error() { echo "******* Error!! Shell exit for error *****" exit 1 } insert_audio() { insmod hidmac.ko insmod extdrv/tlv_320aic31.ko > /dev/null #insmod extdrv/acodec.ko insmod hi3521_sio.ko insmod hi3521_ai.ko insmod hi3521_ao.ko insmod hi3521_aenc.ko insmod hi3521_adec.ko } remove_audio() { rmmod hi3521_adec rmmod hi3521_aenc rmmod hi3521_ao rmmod hi3521_ai rmmod hi3521_sio #rmmod acodec rmmod tlv_320aic31 rmmod hidmac } insert_ko() { if [ $SDK_TYPE = "16d1" ]; then sh ./pinmux_hi3521_16D1.sh > /dev/null himm 0x20110168 0x03ff2 fi if [ $SDK_TYPE = "8960h" ]; then sh ./pinmux_hi3521_16D1.sh > /dev/null fi if [ $SDK_TYPE = "2hd" ]; then sh ./pinmux_hi3521_2X1080P.sh > /dev/null fi if [ $SDK_TYPE = "4720p" ]; then sh ./pinmux_hi3521_4X720P.sh > /dev/null fi if [ $SDK_TYPE = "1hd7d1" ]; then sh ./pinmux_hi3521_1XHD_7XD1.sh > /dev/null fi sh ./clkcfg_hi3521.sh > /dev/null #sh ./pinmux_16D1_LCD_hi3521.sh > /dev/null sh ./sysctl_hi3521.sh > /dev/null #The ddr priority must be set before inserting all modules, otherwise vou will be low bandwidth(or flicker) when the machine is starting up. #[tommy] close buzzer himm 0x200f00a8 0 insmod mmz.k0:o mmz=anonymous,0,0xABC00000,200M:jpeg,0,0xB8400000,5M anony=1 || report_error insmod hiuser.ko insmod hi3521_base.ko insmod hi3521_sys.ko insmod hi3521_tde.ko g_u32TdeTmpBufW=1920 g_u32TdeTmpBufH=1080 insmod hi3521_dsu.ko insmod hi3521_venc.ko insmod hi3521_group.ko insmod hi3521_chnl.ko # insmod hi3521_h264e.ko insmod hi3521_rc.ko insmod hi3521_jpege.ko #insmod hi3516_mpeg4e.ko #insmod hi3521_viu.ko insmod hi3521_vou.ko insmod hi3521_vpss.ko #insmod hi3521_ive.ko #insmod hi3521_vda.ko insmod hi3521_region.ko insmod vcmp.ko insmod hifb.ko video="hifb:vram0_size:16400,vram1_size:0,vram2_size:0,vram3_size:64" softcursor="off" u32VcmpBufNum=2 insmod hi3521_vdec.ko insmod hi3521_vfmw.ko insmod hi3521_hdmi.ko insmod jpeg.ko insmod extdrv/gpio.ko insmod extdrv/gpioi2c.ko insmod extdrv/ssp.ko insert_audio } remove_ko() { remove_audio rmmod adv_7179.ko rmmod sil9024 rmmod ssp rmmod tw2960.ko rmmod tw2865.ko rmmod gpioi2c rmmod hifb rmmod vcmp rmmod hi3521_region rmmod hi3521_ive rmmod hi3521_vda rmmod hi3521_vpss rmmod hi3521_vou rmmod hi3521_viu rmmod jpeg rmmod hi3521_hdmi.ko rmmod hi3521_vfmw.ko rmmod hi3521_vdec.ko rmmod hi3521_jpege rmmod hi3521_rc rmmod hi3521_h264e #rmmod hi3526_mpeg4e rmmod hi3521_chnl rmmod hi3521_group rmmod hi3521_venc rmmod hi3521_dsu rmmod hi3521_tde rmmod hi3521_sys rmmod hi3521_base rmmod mmz rmmod hiuser } # load module. if [ "$1" = "-i" ] then insert_ko fi if [ "$1" = "-r" ] then remove_ko fi if [ $# -eq 0 ] || [ "$1" = "-a" ] then remove_ko insert_ko fi :hi3521_chnl.ko9Y9Y9Y|*ELF($z4( -L 3@ -LdM`@PP@@H0pÕᘆS  y\ LX W T @㤉@@@@P?-@0P@0@p0 < @0 DP Lp X` H^ 0OT(KL X@X @ @00@ T0X@X@X@ @^B @^F @PK 1 @Ϡ @J @  P> 00S2 H1 @ @! JK,@^Te@^| @P 0!!X0 @:Π @!J  0 @ 0-LM@PP- P U,0: S.$  Sࠣ࠳\^ AQ0E@ ! ,0,0P K0@@ 7@@@@,@@` 7@@@< 1PP@P@@ i?@@@@ 0-LM0@0 P(0P< T<  \,PL 0E@0  t. $0 S Q@ $K0@@ 8@@@l 8@@@@@@@ 0@@@ I?PP@P@(P -LM@P):0H` Q"$ pØ00@\E 00@QI ɘ00@\M <@SR 3 @ @J(K VA0 V>P@  pPA p2 @ @!J,ʏ00@QTeɘ00@\|ᗎ<@S ʎ1 @ @JP< K 0  ؀ ܠ $ ؠPȀ P 张 ܠ娀 %K'K 崐 尠 堀 ` @@@@t -L$M@K@P0P@ 0  Qڰ` @  Ph2 @e  @<2 @v @ J08(K P`0 G 4P8`0(P`  0 _ 0  `$pPȠ    $  , 4 ( < D H @ P T fh ge  0P PPU P@1P0Q, 0 @gϠ  @@@d O7@@@@@@< N7@@@ 0PP@P -L$M@P0P00  R  Q @(K8K 8 4@ D P0KpJpP00< <0`0P<: n `ZW P0<p&@0Q @@ ?6``@?: `@@ V2@K"d@0 R @@< ?@ @K"0Pb  -LM@Pg 0Sy H0SSP P  @ @K/H !K Rp1 @g`0 @0S 3/ 2/``V\`T 4Q00L004 2/@0@P@ 0L0R0( @00 0 @   @0 @̠  @00@@L 7@@@@@@@ ?PP@P  0-LM@P& 0S1 H0S 0 @ @@$ ,K0P  00!T0 @  @@@ 6@@@@ -L4Mp@W_ `PUR h 2/L1/x03/P h6 @L0 @0p0````aaa aaa@T PK j`X p `\`*: `X`tpx $00(,0 48<00@ DHPP1/0p3/ x@ |0 P P0 @ @<aLH\l -L MPpP00@H R+ p @^[  @P_ ɓ @\c ,00@Rh 0>#@P2 @ ͠ @JK @  `Pv 00Si SE SH !0Q PM?0@K 0P@00 $ , (  0P,Ò ? @PTe>ɓ @\| >0,00@R > !000!0/@P0 @6 @J@@p ?@@@@0TK#@P<0 @M @!Jc| -L Mpp@P0H` Q"$ p×00@\L 00@QP ɗ00@\T <pp@SY l2 @ @J K VH0 VEP@ p PH !PS@ 0PX0S 43/PW!,00@QTe~ɗ00@\|~p<pp@S ~0 @ @J0 @  @!J@@` 5@@@@@@8 5PP@P@@ %5``@` -LP3 8 04P3T3 04T3X3 0 4$ 8File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLs32Index >= 0%8d%8s%8d%8s%12d%12d%12d%12d -----CHNL PERF----------------------------------------------------------------- %8s%12s%12s%12s%12s%12s%12s%12s%12s StartCostIntCostIntCostLHWCostHWCycleHWCostLHWCostAcc%8d%12s%12d%12d%12d%12llu%12d%12llu%12llu -----CHNL CURRENT RUN STATE---------------------------------------------------- %8s%12s%12s%12s VpuName%8d%12s%12d%12s No &: running channel here [Func]:%s [Line]:%d [Info]:NULL pointer for inputunregister channel failed for chnl type out of range Register channel failed for chnl type out of range VpuNum %d in Vpu Information error!(%d,%d] This vpu has already been registed! Chnl has been stoppedChnl has been started. Chnl is been stopping now. Chnl initialzing fails. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/chnl/vedu_chn.cHI_NULL != pstTskTblHI_NULL != pstChnlTblHI_NULL != pstTask/home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLHI_SUCCESS == s32RetStop channel failed for chnl type out of range Stop channel failed for chnl not registed! you must stop schedule this channel firstly! pu32Data != NULLs32Index >= 0register channel failed for chnl type not support! channel id is extand max channle count that CHNL supportregister channel failed for the chnl already exist register channel failed for the chnl number excess the max chnl number allowing to regist! NULL != pstChnlTblNULL != pstChnlTbl->pVirAddr0 != pstChnlTbl->u32PhyAddrs32MaxChnlNum > 0Chnlvalg alloc mmz buffer failed! valg alloc mmp buffer failed! malloc error! pBase != NULLHI_NULL != pstVpuStatsHI_NULL != pChnTcb->InqTaskFuncHI_NULL != pChnTcb->ChnSchecleFuncpstVpu->u32VpuSt != CHNL_VEDU_STATE_RUNHI_NULL != pstChnlCtxpstVpu != HI_NULL%s %d pstNextChnl->u32State err %d pstNextChnl->u32State == CHNL_STATE_READY%s %d pChnTcb->u32State err %d pChnTcb->u32State == CHNL_STATE_READYCHNL can't been find HI_NULL != pChnlCtxCHNL hasn't been initialized Find %s down,now reset it pstVpu->pstLastChnl != HI_NULLChnl IntProcFunc err! %d %s :watchdog here. HI_NULL != pChnTcb%s int status %#x for chn(%d %d) err. HI_NULL != pstVpu->pstCurrChnlHI_NULL != pstVpuChnl receive interrupt veduThere's no ChnlCtx available! register irq failure %:%s %d Stop channel failed for chnl type(%d) out of range,ChnlID: %d %s %d Stop channel failed for chnl type(%d) not registered,ChnlID: %d Stop channel failed for chnl type not registered %s %d Stop channel failed for chnl not registed!,enChnlType : %d ,ChnlID: %d CHNL_STATE_INIT != pstTsk->u32Stateunregister channel failed for chnl type not support! unregister channel failed for chnl not registed CHNL_STATE_PAUSE == pChnTcb->u32State ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vedu/chnl/vedu_drv.cHI_NULL != astVeduInfos32MaxVeduCnt >= s32VeduNumHI_NULL != pstVeduRegsHI_NULL != pReg ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vedu/chnl/vedu_hal.cHI_NULL != pReg ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/common/vedu/chnl/vedu_drv_comm.cHI_NULL != pVeduRegCHNL_INVALID_HANDLE != s_HdlVeduVALUE_BETWEEN(s_s32VeduNum, 1, VEDU_MAX_CNT)[Func]:%s [Line]:%d [Info]:Vedunum %d err, shoule be in [1, %d]. Vedu remap failed. %s%dVEDU_Vedu regist fail. ================vedu %d debug info============= ===debug info from 0000-0154=== %04x : %08x %08x %08x %08x ===debug info from 0a50-0a9c=== <$,hi3521_chnlGNU 걜Lt Ǫ٬q $eA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.320: .1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4Y l-)Zx% 8|ZT4 @C[KxaT28btguc  suPo x } v$y l0w$XwXwpXw/wIy}0t W  x" ' ,6$ ;8 @X ETR` W a f k pPs x8 ~<  p x `     : 0 ` h         d l  D t | 4 & ,T 2 8 > D J P V \ b@ h n t z   $  pH p   0L 0<01@B!p `( k,  p p { X ,WL " P6 ' ;L pR @ pa p48f s( k p04xD ~  p p p`  P ppxx   p  p$p( \ pH#L#( \ < p$$   x  p'',   p+: +P  x  , 2 & ph0t0J \ Dp 8D >\ V P p22p44h b n< p::zp t\ p0<4<pP=T=   p@@ X    p0D4D 8 l p4GpPPdx  -<KZix(@Pdt ,;J Y h,w@ L Xl|pL p p8G" ' ,68 ;P @l pJJR phJlJpJJp(K,Kp|KKpKp  (7p K" ' ,(68 pxL|LpLLpMMpMM: p NNp\N`NpNNpOOpXO\OpOOpPPpTPXPpPp(F(TDb`pt~8Plp P,"H ' W6 ; @$ p$S(Sk s RT f ap x pWW~  , L p p  ( pH p7DNppd[d#n!p  < 8 H$LP'I5AKQ[XPPlYzpYL lJlx4<4 PT9JTNXtbrHMd,|TX T=DH$L# 8G M,/ 8 :E `NPZ XYi KX =D NP QX  dQP 4P (S8 W \OT& PT2 4R< Q [ `i QTu ,KT Md Y   `S\ OT H +  ! , x2 KPC 8M W NXj q  t   t0x T  4 h @X  xX P$ :H0 @ = OTO Y d u JP L< ( Q  2  Y (LT |LP) '7 $G 4D$aCHNL_GetVerMagicCHNL_ModExit.LC0.LC1.LANCHOR0.LC2.LC3.LC4CHNL_ModInit.LC5.LANCHOR1.LC6.LC7.LC8$d.LC9.LC10.LC11.LC23.LC21.LC22.LC12.LC13.LC14.LC15.LC16.LC17.LC18.LC19.LC20.LC24.LC25.LC26.LC27.LC28.LC29.LC30.LC31.LC34.LC35.LC32.LC33.LC36.LC37.LC42.LC45.LC43.LC44.LC46.LC47.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC55.LC56.LC57.LC38.LC39.LC41.LC40__func__.28631__func__.28611g_stVpuState__func__.27858g_strChnlTypeg_strChnlState__param_str_g_bVeduPowerSaveEn__mod_version455__mod_license454__mod_author453__mod_g_bVeduPowerSaveEntype451s_stModules_stExportFuncs__param_g_bVeduPowerSaveEn.LANCHOR2.LC58.LC59.LC60.LC62.LC63.LC61.LC65.LC64.LC66.LC67.LC68__func__.28588__func__.28563__func__.28505__func__.29560__func__.29547__func__.29396__func__.29496__func__.29462__func__.29433__func__.28865__func__.29408__func__.27761__func__.29511__func__.27784__func__.28997__func__.29382__func__.29351__func__.27 : 448__func__.27727__func__.29088__func__.29218__func__.28662__func__.28728__func__.29315__func__.28701__func__.29295__func__.29150__func__.28600__func__.29275__func__.28968__func__.28912__func__.28830__func__.29045__key.29512__func__.15139__func__.15300__func__.15183__func__.15173__func__.15164__func__.15156__func__.15148__func__.7423__func__.7414__func__.7375__func__.7367__func__.7395__func__.7383__func__.7361__func__.7353__func__.7345__func__.7337__func__.7328__func__.7320__func__.7312__func__.7305__func__.28667__func__.28832__func__.28794s_apVeduAddrs_HdlVedus_s32VeduNum__mod_srcversion23__module_depends__mod_vermagic5free_irqCHNL_Registerparam_ops_uintCHNL_QueryStateCHNL_NotifyCMPI_RegisterModVEDU_DRV_Exit__this_modulesnprintfVEDU_HAL_ReadMode__arm_ioremapVEDU_DRV_Initfinish_wait__iounmapVEDU_GetTimeOutVEDU_HAL_ReadIntVEDU_ClearIntVEDU_GetIsIntOkChnlDelOneTasks_s32ChnlStateVEDU_DRV_IsIntOkcleanup_moduleprepare_to_waitCHNL_IRQDeletememcpyCMPI_MmzMallocChnlVeduIntHandlerdo_gettimeofdayVEDU_HAL_ReadEndOfPicIntVEDU_DRV_ClearErrInt__wake_upCHNL_ExitCMPI_RemoveProcVEDU_HAL_WriteMemClkGateModeChnlCheckRegInfoinit_moduleChnlGetCtxByTypeCHNL_IRQInitRC_DRV_GetRcInfoCMPI_CreateProcChnlAddOneTaskChnlExitSchdTabRC_DRV_SetRcVEDU_HAL_WriteTimerModescheduleg_astModulesVEDU_HAL_ReadIntMaskVEDU_StartVeduVEDU_HAL_WriteOutStandingCHNL_RegistVpuVEDU_HAL_WriteIntMaskVEDU_GetRegAddrCHNL_GetScheduleVEDU_SkipInitChnlGetSchedTabLenVEDU_ResetVEDU_OutputDebugInfoVEDU_HAL_ReadEndOfStreamIntVEDU_SetClkVEDU_Exitrequest_threaded_irqadd_timerChnlIsTblFullVEDU_RstSelVEDU_DRV_ClearIntVEDU_HAL_WriteClkGateModeVEDU_ReadIntCMPI_UnRegisterModpanicVEDU_InitVEDU_HAL_ReadBufFullIntVEDU_GetInfoChnlTimerIntHandlerprintkChnlQueryOneTskCHNL_SetScheduleVEDU_DRV_ReadIntCHNL_Init__memzeroVEDU_HAL_StartVeduHI_LOG__init_waitqueue_headChnlCheckUnregInfoCMPI_MmzFreeChnlWatchDogTimerISRChnlSchdOneTaskjiffiesChnlGetCtxCHNL_StopSche:duleinit_timer_keyCHNL_ResumeScheduleVEDU_SetIntMaskChnlVeduISRChnlProcShowVEDU_HAL_ClearIntg_ChnlCtxseq_printfChnlCheckVpuInfoVEDU_DRV_StartVeduCHNL_UnregistVpug_bVeduPowerSaveEnVEDU_SetTimeOutautoremove_wake_functionChnlTimerISRdel_timerVEDU_ClearErrIntVEDU_HAL_ReadOutStandingVEDU_HAL_WriteModeChnlSchedulerChnlInitSchdTabCHNL_UnRegister(+0,4+8,<D+H,L+,++,,++,+,,$+,,08+<+@,D,H+L,P\+ d, hp+t,x+!,!+","+#+$,#,$+%,%+&,&+','+(,(+),)+*,*++,+|+,,,+,+-+.,.,- +/,/(+00,08+1@,1H+2P,2d+3,30t+3x,30+4,8+4<D+5H,5LT+6X+-\,6`,-d+.h,.l,4p+7x,7|+8,8+9,9+:,:+;,;+<,<+=$,=t+=,=p+t,x+>,>+?,?+#+@,#,@+A,A0+8,Dd+3l,3+=,=( < +BD ,BH l +p ,t +4x  +5 ,5  +6 ,6 ,4 +7 ,7 +8 ,8 +9 ,9 +: ,: +; ,; +< ,<  +C +D ,C ,D +E ,E  +C$ +D( ,C, ,D8 +F< ,FD H L P T d +[h ,[ +[ ,[ +[ ,[ +[ ,[ +[ ,[8 +[< ,[@ +[D ,[l +[p +[t ,[x ,[ +[ :,[ +[ ,[@ +[D ,[ +[ ,[ +[ ,[ +[ ,[ +[ ,[ +[ ,[ +\$ ,\T  +] +^ ,] ,^  +_ ,_  +] +^ ,] ,^+`,`+],]+a,a+],]+`,`+](,]4+]D,]P+]`,]l+]|,]+],]+[,[+[,[+[ ,[+[ ,[0+[4,[`+]d,]p|+d,d+[,[+[,[+[,[+],]0<+`@,`DT+]d,]p+],]+],]+],]+],]+],]+] ,]+](,]@+]D,]Pd+eh,ex+],]+],]+\,\+] ,] +h(,h,4H+\L,\d+],]+k,k+],]+l,l+],] +m,m$0X+p\+q`,pd,qp+rt,r|+p+q,p,q+u,uD+pH+qL,pP,q\+u`,uhl+pp+qt,px,q+x,x+p+q,p ,q,+{0,{8H+pL+|P,pT,|`+}d,}lpt+[,[+[,[+[,[+[,[+[,[+] ,] ,+0,4d+],]+,+[,[+[,[$+[(,[x+]|,]+,+],]p+pt+qx,p|,q+{,{+p+q,p,q+u,u+p+|,p,|+,+p: +|,p,| +, D+p+q,p,q+{,{ +p$+q(,p,,q8+{<,{DP+pT+|X,p\,|h+}l,}tx+p|+|,p,|+},}+[,[+[,[ +[ ,[ +[ ,[( +[, ,[D +]H ,]T ` +d ,h    +] ,]  + ,!(!+[,!,[L!+[P!,[t!+[x!,[!+]!,]!!+!,!!""+]",]"#+#, # #+p$#+q(#,p,#,q8#+{<#,{D#H#|###+p#+q#,p#,q#+#,##+p#+q#,p#,q#+#,##+p#+q#,p#,q$+$,$$l$+p$,t$|$$+]$,]$$+$,$$+]$,]$$+$,$%~T&d&+]h&,]t&|&+&,&&+p&+q&,p&,q&+&,&&+p&+q&,p&,q&+u&,u&&+p&+|&,p&,|&+&,'' ''`'x'''8(x(**+p*+q*,p*,q*+{*,{*++p++q+,p +,q+++,$+(++p,++q0+,p4+,q@++D+,L+P++pT++qX+,p\+,qh++rl+,rt+x++p|++q+,p+,q+++,+++x,,,,,-p--8.h....+., //+p/+q/,p /,q,/+0/,8/+]>,](>4>+8>,<>>>+>+>,>,>+>,>>?@?X@+\@,`@@+]@,]@@+@,@:@@@+[A,[A+[ A,[0A+[4A,[DA+[HA,[XA+[\A,[tA+xA,AA+]A,]AA+A,AAHB+PB,hBxBBB+[B,[B+[B,[B+[C,[XC+\C,dCtC+]xC,]CC+C,CC+pC+qC,pC,qC+C,CC+C,CC+]C,]DD+D,D0DDD+[HD,[pD+[tD,[D+[D,[D+[D,[D+[D,[D+]D,]DD+D,D$EHE`EEE+[E,[E+[E,[F+[F,[DF+]HF,]TF`F+dF,hFF+]F,]FF+F,FF+pF+qF,pF,qF+{F,{FF+pF+qF,pF,qF+G,G G+pG+qG,pG,q$G+{(G,{0G4G(I+,I+0I+4I,8I,O@d` @\ @ P 0 ` 0-L00@PP@ @P 0h@   0 -L M@p!0 @O@dp Thhp@ ppT -? 03Pu4pK P0 PP@ 0Q0^w4 00! ? 0  003SC @@@hPpP Oh@P@PP P0O 0 P 0 O 0 p `0 pd q -?04 03\4 @P_ PW^ @N4K I4@ C0 0   pK!0dmb`A Q,c, ?HK@P  T T  08 0@< D @0   0@Q  ``PP0  0 V#  4 FnoO 0-LM@@KPxKd @K0 -L MK00 0  @@@0 !  0K%:  @0 -L -L -L @10 -L@0 -L@0 -L @10 -L@@@00 -LOA 00@ -Lh80(0S%3/ -Lh80,0S3/ -L00@0 -L00@4 -L@@@8Q\0S<\ x-L@@@4( ,>< +?@ ,?H +@L ,@T +AX ,At +Bx ,B +C ,C +D ,D  +D ,D  +E ,E  +F ,F +G,G +H$,H(4+I8,I<H+JL,JP\+K`,Kdp+Lt,Lx+M,M+N,N+O,O+P,P+Q,Q+R,R+S,SD+TH,T`+Ud,Ul+Vp,Vx+W|,W +,+ , p,nL\lpxz+,(+,,DL+P,dl pt+,+,z+,,+ 4, 8Hz$rD LPXr{&|*w<?:hi3521_adec.ko9Y9Y9Y5 ?ELF(4( -L -L -L -L -L@0S0"00 -L 3@ -L@@@?0τ<00@?0C/2 -LMp@PP@@ @ @00@P@@``@@`@@ @@`A`@@P3S00@ 1S00@ S00@ S00@ S00@ %S00@ S00@ +S0 0 `@   `PCO UB 0S4 0S00@ S00@ 1S00@ S00@ #S00@ S00@ %S00@ S00@ +S0 0 `@   `COPQ 0S00@$K0 -LMP0dCϠ # K 0 @0@OϠ 0 @0JJ0 -LM @0 0S. @0pP @CC `p 0 QQQ00OC/ W 䀈QQQ耆䀆0P(K,0 @  @ 0-LMP h0C_@<#<K0@0 @RϠ 0 @0J@@J0 -LMP pPCo@\,p00K@0 @/ 0 @0J@@J0, -L$MP`5 @ 0 @0JJ(KC\@PP?0S7 P2 p?p@ Ӑ@, 0R `0c(0` 0cS$*4 @0 @Z P 0:0S JO@a4 cK0 Q`n( `nP(0Y: n$`b<0K"!B  Jqp   W Aq  pAqp pp ` 1"!  BR  ^ P  P  -?`0 003Sv R` J0`tS0f,(0l,00f0aRx(0 S f $5l $% ! `00!` 30"  JRp  W \  p\p pp (!  BR`  V P  `P` `` 0 0J$<0K` U @@@ 0@@@@P    @@@ 0PP@P  @@0 @0 @J<0 -L MP0 @ 0 @0JJ KCOlP`pPO0S L0 x-L``@0Sx@P@ Tx -LMP@P3 @_ 0 @0JJ(KĈ`ࠆ 0PO 80 80 PYv  0R3Q&S 0 )   @4 4 2 @v4 0  @4 4 4 J  @4 4< 80 4 < @(80  ,004 $@0 0  4 P4* Ԑ 0 3: 00 @ @0k0 @m0 @ Y80 @4 0  @4\0 -L 8 0DQ0h/ (DQ! ( DQ D Q q @ O (Q ( DQ  Qh  -L@ 0-L @@@@@  0 @0@0P$0P@,PP @0hP0@0ADEC_DestroyChnADEC_InitADEC_SetDbgInfoADEC_CreateChnADEC_SendStrmADEC_DccBufExitADEC_DccBufInitversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 adec%s [ADEC] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:46] -----ADEC CHN ATTR-------------------------------------------------------------- %5s%8s%8s%8s%12s%12s%12s%8s ChnIdPlTypeBufSizeAttrSendCntGetCntPutCnt g711ag711uadpcmg726amrnbamrwbaaclpcmmp3%5d%8s%8d%8s%12u%12u%12u%8s [Func]:%s [Line]:%d [Info]:Audio some err:0x%x ADEC mod have init already! your adec stream len is too big! %d > %d DccBuf is full, AdChn:%d Warning! Buffer left is small than the data writing in! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/adec.cHI_SUCCESS == s32Ret Lenght writing in must be multiples of work (32-bit)!ioremap_nocache fail, AdChn:%d Error! Length of buffer must be multiples of word (32-bit)! Error! Lenght reserved in buffer must be multiples of word (32-bit)!VALG_CB_Init_Master fail, AdChn:%d kmlloc tmp stream buffer fail, AdChn:%d ADEC kenerl DccBuf(writer) init ok, CbPhy:0x &: %x, CbPackLen:%d AdecDoIoctl: ERR IOCTL CMD 0x%x, NR:%d hi3521_adecGNUy'g7_'gG=A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 ,)0% 84084 h4ClK T2|g<c 5X q$m x5 $!p/G0 r L(a(#</L,?IxZ0g l <:,o| L  X h D    ( 0 8 < H  l|l #- l 3 l(,llT\9 ? ED K Q W ] l0 8 l  c| i o< u {  lT l ,<L\1l (h 2h( A l lP`,n0!llDxD#h|!l    $ \0  0<L],m8 }   Ph H  ): "2CM$aadec_openadec_closeadec_pollADEC_NotifyADEC_QueryState.LANCHOR0ADEC_GetVerMagicADEC_ModExit.LC0$dADEC_ModInit.LC1.LANCHOR1AdecIoctlAdecDoIoctl.LC2.LC12.LC3.LC7.LC4.LC5.LC6.LC8.LC9.LC10.LC11.LC23.LC21.LC14.LC15.LC16.LC17.LC18.LC19.LC20.LC22.LC13.LC24.LANCHOR2.LC25.LC26.LC28.LC29.LC30.LC31.LC32.LC33.LC27.LC36.LC37.LC35.LC39.LC34.LC38.LC40__func__.29340__func__.29420__func__.29351__func__.29329__func__.29279__func__.29254__func__.29216__mod_version631__mod_license630__mod_author629adec_fopss_stAdecModules_u32AdecStates_stAdecUserRefg_AdecUmapDevs_AdecChn__mod_srcversion23__module_depends__mod_vermagic5CMPI_RegisterMod__this_modulesnprintf__arm_ioremapADEC_SendStrm__iounmapupcleanup_moduleCMPI_UserCopykfreeCMPI_RemoveProcinit_moduleCMPI_CreateProcschedule_timeoutADEC_SetDbgInfoADEC_DccBufExitADEC_InitADEC_ExitCMPI_UnRegisterModpanicprintkAdecProcShow__memzeroHI_LOGseq_printfADEC_DccBufInitADEC_CreateChndown_interruptibleCMPI_UnRegisterDeviceADEC_DestroyChn__copy_from_user__kmallocCMPI_RegisterDeviceX+ \, + , +,z+,+,+ ,++ +$,(,,+0,8,<+D,H+P,T+\,`+h,l+ t+!|, ,!+","+#,#+$,$+%,%+&,&+','+(,(+)(,)Px+*|,*+","+#,#+$,$+%,%+&,&+','+(,( +),)@d+*h,*|+-+.,-,.+/,/+ ,4+ 8, T+-,- +2,2 (|+-,-+/,/+- *: ,-(4+/<,/HTX+-,-+/,/t+-x,-+9,9xx x( +:, ,:0 4 +;8 +<< ,;@ ,<L +=P ,=X \ p x +> ,>  +; +< ,; ,< += ,=  +: ,:   x +- ,-  +? ,? 0 4 \ +-` ,-l x +/ ,/   x { w w x  $ +( ,D P  +- ,-  +/ ,/  u,ux+D,D+-,-+E,Ewwx+F,F0x+-,-+G,G(+-,,-8H+HL,HPXxp+-t,-+I,I+L,LP\|v+ , $|,+ +, , + $, (~4+8+ <,@, DtP+X,`l+ p, t|r+ , |s ,4hsptx| }y : hi3521_vda.ko9Y9Y9YhM <ELF(|4( -LP -L0@;S A#R -LP -LP -LP -LP -L@P -L P -L@P -L@P -L@P -LdP -L@P -L P p-L,0 >Qx+>;>/ Q@ ; ` PHx LP0T0X0\0V PQ\00HLP0T0X0 Px@QHLP0T0X0\00x0 \0HLP0T0X0,Q0 t|;======;99p) NRPA0P *U  R0* @R00:> @P))@p -L -L -L -L -LP00@   -L@0S0"00 -L 3@ -L M0@S  0 @0@Z0  @ JKQ  0 @0@c0  @ J R  0 @0@[Ϡ0  @ J 0S$A\2  RA0LSO BQ]0S  0 @0@0  @ J  0 @0@u 0  @ J  0 @0@~0  @ J  0 @0@b0  @ Ju  0 @0@0  @ Jc  0 @0@ 0  @ JQ p-LM0@P`S*Q' P# Q60B;S 1 @ 3:  = @ ͠ JKp@#Q 0 @0  @ @@ P` J 80 @ 0  @ J -L M@P0dS 01 @.0  @ JK BQ 0 @70  @ J0 S 0 @͠0  @ J\ 80 @I0  @ J -LM0P`p0CS0@ 2 @0  @ JK@Q0" P 2 @0  @ J0S 1 @0  @ J R |1 @u0  @ JQ ,1 @0  @ J0S \% B^ 0 @0  @ J |0 @0  @ Jx 80 @Π0  @ Jg4 -L M@ 0A;SB#P 0 @   = @ ͠ JK0S S P0 @"Π0  @ JD -L00@ -LDM@@ @p  @ @0p@`p`@P`P@@P@@ @@@``@P`P@@P@@ @@ F$ $P$ N R> ,0`^S $ (0@    $$P ,Δ (> @  0:48Δ <DΔHL PΔN$ R @@  @ @00@@@ p@@pp@p@@``@P`P@@ P@@$@@p(p@,p44 `8 R& ,Z# @P< 004@8pP  D@4HLP T$X(\8@P,p,0Sn X4`@8Pp@ @ @00@@@@@@@ @@@@@@@ @@@$@0` P" ,Q N`H 0@`  L0PT\x@P  $,0Sp^ W0@@P@@ P@  @ @00@@P@@ @@@@P@P@P@@@ @@P$@P@(PPa D0S) ΄ RF $NP P @:( Љ}儋p}p}p} p͜嬐 $0S   @:( Љ}儋p}p}p} p͜ $ ΄ R(K\0 -L MP@`厠TqP 0S S! (K RQ9Y& P6 0 0 @T0  @ J VQ! RA 0 @Πl0 @ _0  @ 0 3/ 0A   P 0 @}0  @ J @0 @s0  @ J0 -LM00@\1S 0S 3/P K@@ 7@ -LM00@\1S R   @ @K 1/P K@@ w7@ -LM@l0 0S 3/P K T0 @͠   @@@ E7@ -L M@l 0S    0 0@0 @ K 1/P K T0 @)   @@@ 37@ -L@0@ @`p0 ⮅  T~P~ p(㮅 ΃$ 0D 49 $ Xpn0 -L ?:@@@PP J @l1/00@ PP -L MP@\ QP 0S0 0 0  $00  L$<0 0 KS @@!5PP@P  00$ (Q P `p!gp,0@00<D H8P$ `0S@@8 4@@@@@@ 4@ -L M`Q@; P厠^pPO0S (K 0 @ 0  @ J 0 @0  @ J 80 @   @ J0 -L M@Q P Q00E `P 0 `````` ``$````(P `$PLP PTX@@@@@@ /2@< -LM`Q@[ P 厠㜡p^PNOO%0S% pP2@P ! 1 @,0  @@ @J$K 0 @80  @@ @J 0 @B0  @ @ @J 80 @+  @@ @J0P -L MP@P 0 @0  @ J K0.0$nPOp Q' X Q    !  Љ@@ <@@@@`0 -LMP@pHQ 厠T`^PO0S% S000 0S S0$K 0 @  @ J 0 0 @0  @ J <0 @0  @ J0p -LMP0@0 `.K$K <0 @0  @ J0 -LMQ0@(0 PBnxp^POGPo QT` 񯯇(K ( RO @`4 S  C@^.@^* \0 C 1 @ ): 0  @! J p1 @)0  @ J$K@ @Q Hė0LH4 !! 0 @E0  @ J 0 @50  @ J 80 @(  @ J0 -L MP`#@P 0S >S# 3 @0  @!$K p3 @0  @! J~`>n!^U ?8`K 0 P0@8 ( 4 00 ,   0 P[U ?9mP8`K 080 @( 4 0 ,  e Q n 0Sm  PP]PPYQ2,0S% ^` P, `xPV*LQ  P2L 41 @0  @ J]0~> !V !S  P  @@ 7@O=@@d q>``@`@@< 6pp@p@@ 6@@@@0 -L -L.`  0` KdQ*reQ 0e˘aL\2ˈ5:Q-e0ea^ea + RQPepQ{{{'X Q$  ;  ˆ +@@` >@@@8 D9@@@@@@ X9PP@P -L M@PK ,; @S02n2;5 *P ^ 0 KpP> `VE PUQ&' X QB    PPPn 0[U@@ 8pp@p  Y@@ 8@@@` 8@@@@@@8 8PP@P@@ 8``@` -L MP@ Q 0.4$K d0 @"0  @ J@@ #:@@@@0 -L MP@ Q 0.4$K d0 @0  @ J@@ :@@@@0 -LM@P] [kE& <:oPK 0S> !ePTpp ,ppP" PI} p $͔(0e.QXP4p8p <`d  0K}p ͔$(}0p@@ 8PP@P@@` 8@@@@@@8 8@@@ 9``@` 0-LMP@)P $n1.΃ 0P00  !K0 R ! <0 @0  @ J0( -LM@Πp,>S- /R+ 2SG 0SN H0HP^`P* X K P1 @ 0  @nPP- X  0 @0  @ J@@ 2@@@@@@X 2PP@P <0 @0  @ J0@ -L0npP7&@ 0S S 0@;S !9 !XP h  h00 -L M@P >Sw Pe P PkU p0 -S㰀n}o}8 *1 fq(( p .t(ẍ́f(a(`0  !.-|(0= KS @@!7``@`1ɔf)q(p x-.tQ ' X QL   1 f  y  1 @  @ 0 @  @ 0 @{  @  ): @@` 7@@@8 7@@@@@@ 7PP@PT -L M@P >S Pr Q` P P^p儋W 0.S- 2h1Q: !˓h(P %t] lx hP(倁(00  .#|=( 0! K`PZ 0S  - ̈́2h1Q!9h(P xl#t= 1 @+  @ |1 @&  @ @1 @!  @ 1 @1  @0  @I  @ n 0 J@@` 8@@@8 <8@@@@@@ V8PP@Ph 0-LMP@PT P ː l>+0R  R !K0! <0 @0  @ J0x -L`,0S.M@Pkp` Ppp,x@Q -LP 0:(,0SN.} @pk`P, 0 P V"X0XL0 ,T 娠, ^ ` 0@0xp,Q 0-LM@P ZU  0::΄P*-PPPK0@@ ^>@ -L4MPP 4 @0  @P PJ(K垠L @>P0 P 0S S   .!P p?nLpK 0 `0@L <   *: H D0 @  0 k Q˔\e``@8/0P00 p`8p `@4` P8K5/PP ~ 0S  PP`PiQZ,0S pnpx`S @Q  0@0p,0x`SP!  !P 0  ΄ 0PcP^_O[ p?9mLpK  ` @L < H D @  7 ;Sw  iP $1 @0  @PP PJ 0 @0  @ PP PJ P^_O@@` :@@@8 :@@@ :@@@@0 x-LP`@ S! ^@0S S @^ T 0S^0@S@ T^x0 -L@@@0S -L@0PL D0@0D L@ 5`D Xd@ PDL @D L@ `P@ d? P@  H P@PLsXD @ s @HDPPLS0D0 @0 p H0@0DPP0L`D Zd@ J@ DL @P LD P @ PH@DPPLU@  @ :堠: EP0@00 D09ZZ 堠 P@ DZ( D @ P    @{@PL D偀e@P0DL0 00H @D D @ d@ DL 偠 -L4MQP PR厠\`~PNOOW0S^ @P= @P5TK( @P@ 0@ @0D R0@@@@@@H0 L@ @ < T W S X0 Yf p P# ?㞆@K  0@0 @0 < 8 4 @K P ppP @KWt p |;S 0P: R:P|;$|Q|D!O 2 @R0 @P @P !w~P ?㞆@K   0: @ @0 < 8 4  0  P !L 1 @0  @ J; 1 @;  @, X1 @ @0  J  1 @  @ J 0 @0  @ J 0 @$ 0  @ H0 @+0  @~O0 x-L00@h0S Jx@@@_Po6 ]XPDQA ]QH --QR  QI O5=0HQ7 D QH =0DQ6 `D QX \0 = 0LQ4 PL Q* =0LQ ]PDQ+ =H0DQ D Q?0C/2xH h -LMpQ@x Pe^" `P 0S 1 @u 0  @! JK>S7 .R |;S$0^: \* `1 @ 0@   @@ !P|;$| P| !! 0 @{0   @ |0 @i0  @ J 80 @Ϡ  @ J0 -L MR@/ Q> ͐0SK 0 @f  @ |0 @Z0  @ J 80 @Y  @ J0 0-LMQ@-S< RRPP 3: R? ,0=K0RΠ, R R-0=- 0 @B0  @ J@@< C6@@@@@@ E6PP@P0 -Lqeg/i?W!1!1) 0S` G `*Q 0S `*@0 SQA `P@`PP@@:011111 -L1 gπ!0 01 -L1 eπ!0 01 -L1 iπ!0 01 -L1g/R -L1e/R -LMQ 10 K @@ @Q1@ -LMQ 10 K@@ B1@$ -LMQ 10 K@@ 31@8 -LM1PC K 00 @  @L -LM1PC K 00 @  @` 0-LM 1R P@@" @C@P !0B1K0 00 @  @t 0-LM 1R S @@" @PC@0A1K0 X0 @  @P@@ 0@@@@ 0-LM 1R P@@" @C@P !0B1K0 00 @n  @ -L MRi/g`@e?11!!S VLWP\ 0 p!CX, VOP \0 p/pV! &: P0QP!Pp\0 p☡ V  00 4 400 00 4 4000a11(K 00 4 400 00 4 400 -L -LMPP@,pK `Kl@ (@ $@ V,  03/l @  V03/K -L -LMP00@P K @@ @B0@ @@ @D0@ -L -L M@PK@@ U?@ -L -LMP K@@ =1@ -LMP K@@ 21@ -LMP K@@ &1@ -L 0-LMPP@   $K0@@ 0@ 0-LMPP@]   $(,4K0@@ 0@  0-LM@@@P @ 03/PPPP PK0@@8 0@@@ 0@@@@  -LM @ 0S~ @`V   @(K 0 @0@@@P@P@㠐 @P @@y@ @K 0 P 0@ unload vda.ko ....OK! [Func]:%s [Line]:%d [Info]:enVdaAlg(%d) is not set! enMBSize(%d) is not set! enMBSadBits(%d)  : is not set! enRefMode(%d) is not set! u32MDBufNum(%d) [1,16] Err! u32VdaIntvl(%d) [0,256] Err! u32BgUpSrcWgt(%d) [1,255] Err! u32OBJNumMax(%d) [1,128] Err! u32SadTh(%d) [0,4080] Err! stRect(X:%d,Y:%d,W:%d,H:%d) surpass Chnl Width(%d) or Height(%d)! X(%d) align is not 16)! Width[16,%d] or Height[16,%d] (align is 16) is illegal! u32AreaTh(%d)[0,100] Err! u32OccCntTh(%d)[1,256] Err! u32UnOccCntTh(%d)[1,256] Err! u32RgnNum(%d) [1,4] Err! ODRgn(%d) PARAM Err! u32VdaIntvl(%d) [0,255] Err! u32BgUpSrcWgt(%d) [1,256] Err! enWorkMode(%d) is not set! vda register device failed. vda CMPI_RegisterMod failed. <6>load vda.ko ....OK! [VDA] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:48] -----VDA CHN ATTR--------------------------------------------------------------- %3s%5s%5s%6s%6s%6s%6s%4s%5s%5s%5s%5s NO.WHModeAlgMbSzMbBitRfMBufNItlBgWtRgnN%3d%5d%5d%6d%6d%6d%6d%4d%5d%5d%5d%5d -----VDA CHN ATTR 2------------------------------------------------------------- %4s%4s%5s%5s%5s%5s%6s%6s%6s%8s%6s%5s%5s%5s NO.RgnXYSadThArThOcThUnOcThObjNSadObjPlx%4d%4d%5d%5d%5d%5d%6d%6d%6d%8d%6d%5d%5d%5d -----VDA STATE------------------------------------------------------------------ %4s%4s%9s%6s%9s%8s%6s%5s%6s%6s%12s%8s BgPhyBgSrdRfPhyRfStdbScdubFstOcCtUnOcVdaCbRefUp%4d%4d%9x%6d%9x%8d%6d%5d%6d%6d%12u%8d -----VDA STATE2----------------------------------------------------------------- %4s%9s%9s%7s%9s%6s%12s%12s%12s%12s%12s%12s%12s MemPhyMemVirMemSzCRfPhyRgnIxViSdVdecSdVpssSdUserSdRecvCalDsuCLstPicC%4d%9x%9x%7d%9x%6d%12u%12u%12u%12u%12u%12u%12u VdaChn:%d err vda poll chn:%d vda isn't be created! NULL PTR! Vda(%d) does not exsit! Index:%d err Pls update ref first!!! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vda/vda.cHI_SUCCESS == CA :LL_VPSS_UnRegister(HI_ID_VDA)HI_SUCCESS == CALL_VPSS_Register(&stVpssRgstInfo)Warnning: Sys mod not exit HI_SUCCESS == s32RetpstAttr != HI_NULLpstVdaComm != HI_NULL0pstVdaCtx != HI_NULLs32Index >= 0 && s32Index < pstVdaCtx->stChnAttr.u32RgnNumpstAttr!= HI_NULLpstCommAttr != HI_NULLVda:%d static Attr is changed pstVdaCtx->stCommRef.stVFrame.u32PhyAddr[0] != 0VdaChn:%d chl has released Data! VdaChn:%d chl release Data err! VdaChn (%d) doesn't create! VdaChn (%d) is destroying! pstSrc != HI_NULLVdaChn:%d get data block flag err! VdaChn:%d stop running! NULL != pNodeNULL != pNode->pValuepstCtrl->stRgnRefInfo.stVFrame.u32PhyAddr[0] != 0pNode != HI_NULLpstPic != HI_NULLpRegBase != HI_NULLpstData != HI_NULLVdaChn (%d) has not enough node VdaChn (%d) Lost Pic Warnning: Chn is resetting! Warnning: Chn is destroying! SrcPic BusyQueue is Null! Warnning: Chn is busy! no free node! stop and unbind Vda(%d) first! VDAVDA alloc coef mem failed! VDA alloc mmp buffer failed! Alloc mem err!!u32ToalBufSize == pstVdaCtx->u32MemSizeVda:%d has been create HI_NULL != FUNC_ENTRANCE(CHNL_EXPORT_FUNC_S, HI_ID_CHNL)Vda:%d regist to chnl failed VdaChnSendPic get mmz name fail! VdaChn%d get buffer fail! pfnDsuBeginJob failed ! VdaChn:%d pfnDsuAddOddScTask failed ! VdaChn:%d pfnDsuEndJob failed ! VdaChn:%d VdaChn (%d) doesn't start! VdaChn (%d):please start chn first! VdaChn (%d):is destroying! wait time out! VdaChn (%d): pic's width or height [%d*%d] smaller then channel's[%d*%d]! VDA receive error data from VPSS pvData != HI_NULLMPP_DATA_VIU_FRAME == enDataType || MPP_DATA_VDEC_FRAME == enDataType || MPP_DATA_VIDEO_FRAME == enDataType ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vda/vda_buf.cpLen != NULL[Func]:%s [Line]:%d [Info]:free list empty busy list empty user list empty plist != HI_NULL  : ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vda/vda_drv.cs32VpuID < VDAU_MAX_NUMg_apstVDAUAllReg[s32VpuID] != HI_NULLHI_SUCCESS == s32RetpRegAddr != HI_NULLHI_NULL != g_apstVDAUAllReg[i]CHNL export func exit VDAU unit has been init VDAU memmap failed %sVDAchnlctx handle is invalid! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vda/vda_hal.cpstMduReg != HI_NULLpu32MovePixCnt != HI_NULLpu32TotalObjSize != HI_NULLpu32MaxObjSize != HI_NULLpu32ObjCnt != HI_NULLpu32MaxObjIndex != HI_NULLu32Height > 0 && u32Height <= VDA_MAX_HEIGHTu32Weight > 0 && u32Weight <= VDA_MAX_WIDTH hi3521_vdaGNU:֞82l$JʒA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4|  I) : % KX8\t4 LCЖ KܞT2|g,c MX q$m XM $@p/7w@0B ,d  $ *,9CS_ d il q{< X t 0   L  i  $ i4 8 D `  x i   it   il 4j, % +x 1 7 = C I O  U [ a  g( m, s4 y< d           :    $ ( , X             !$ 'L - 3 9 ? E K Q W ] c i o  u( {0 i` p i   i ii i4< D t i iTX  iii< $  i!!i4#<#i& &X @ i''  i))  ix++ i,,i4.<.i..8  i11%| ,\ 3 i55: A H O i99V i8<<<]H d\ i$>(>kp i>>i??r iAAiBBy  :  iDDiXE\E   iPHTH0 L iKKiLLiNN\ iSSiPTTT|     i]]H   i@`H`h     ide  |  !8 (` i,j4jilntn/ ioo6 = iqiDS b q4D T ` l|% 4C  R0 a<pP` p   $(3@BTQh`xo ~     1i + 9h Bl( i iP_,m0y000q_| d l issis :s{ 4 iXt\tH itt\ iduhup i4v8vivvi$8L`ti| x98_ d l  {8 ` ixz|zizzi8{<{i{{x ih|l|i(~,~ i~~      i$3BQ `o ~  i i8$_ dp 0l {  i48 i  iHL8 iԃ؃i\`iilpiiii<@iiiPTiii\`ii ihliiilpiȋ̋i ix : |ǐЌi(,iii<@iiiPTii idhT i iiԑؑi$(itxi̒Вi $ix|iГԓi(,ixi00H`x  # 2 A ,P <T_ dn t}          0 D" X1 l@ O ^ m |    ( @ T h  t   ! 0 ? N i iiD] D#p h |!i    r$ \ \ <. T  hu TH TT4) |T: Ќ\K _ p tn$} $  :Ll  5    A  9 <#  zT! sh3 v@ K W sTj t  h z\  T\ p\ e0  \ \x%5<KYxiDw  ,P<x~DLsT,)0 |y31@>Uta8r$op, |XTԓX\ ВTr8,5FSlevx$X, t,\ @\H`lr$3TTCSLixX|D؃@r8\\q\E { ?/ \EXPdjpyx||8\(>X.\2<{T?I`^lTn|MؑP|z4'hyL 0%+,2 : \E8vUT, a\ql|z0(P< &,lH`\ @\-@Qd!TrBN̋TS<<xr8]zT4,~+=rTP8 _ \r{5\0\lK\ L'N2\thDX`$aVdaOpenVdaCloseVDA_Notify.LANCHOR0VDA_QueryState.LANCHOR1VDA_GetVerMagicVDA_ModExit.LC0.LC1$d.LC2.LANCHOR2.LC3.LC4.LC5.LC11.LC6.LC7.LC8.LC9.LC10.LC14.LC12.LC13.LC15.LC16.LC17.LC18.LC19.LC21.LC20.LC22VDA_ModInit.LC23.LC24.LC25VdaIoctlVdaDevIoctl.LC26.LC30.LC27.LC31.LC28.LC29.LC32.LC33.LC34.LC35.LC36.LC37.LC38.LC39.LC40.LC41.LC42.LC46.LC43.LC44.LC45.LC47.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC55.LC56.LC57.LC59.LC58.LC60.LC61.LC62.LC63.LC64.LC65.LC66.LC67.LC68.LC69.LC70.LC74.LC75.LC71.LC72.LC73.LC76.LC77.LC78.LC79.LC80.LC81.LC82.LC83.LC84.LC85.LC86VdaPoll.LC87.LC88.LC89.LC90.LC91.LC92.LC93.LC94.LC95.LC96.LANCHOR3.LC99.LC98.LC97.LC101.LC100.LC103.LC102.LC104.LC105.LC107.LC106.LC109.LC108.LC110.LC111.LC112.LC114.LC113.LC115.LC116.LC117.LC118.LC119.LC121.LC120.LC123.LC122.LC124.LC125.LC126.LC127.LC128.LC129.LC131.LC132.LC130.LC135.LC133.LC134.LC136.LC138.LC139.LC137.LC140.LC145.LC144.LC141.LC142.LC143.LC146.LC147.LC148__func__.29395__func__.29342__func__.29369__func__.29440__func__.29484__func__.31770__func__.31594__func__.31450__func__.31247__func__. : 31091__func__.31065__func__.30393__func__.30378__func__.30333__func__.30319__func__.29946__func__.31008__func__.29877__func__.29836__func__.29506__func__.31031__func__.31316__func__.31282__func__.30728__func__.31201__func__.30216__func__.31115__func__.30656__func__.30558__func__.30830__func__.30814__func__.30603__func__.30744__func__.29592__func__.30419__func__.30480__func__.30780__func__.30060__func__.30895__func__.30000__func__.30846__func__.29683__func__.31349__func__.29776__func__.30357__func__.30174__mod_version4048__mod_license4047__mod_author4046s_u32VdaStatevda_fopss_stVdaModules_stVdaUserRefs_stVdaDevice__key.31476__key.31477__key.31478__key.31479__func__.19612__func__.19603__func__.19594__func__.19569__func__.19555__func__.19531__func__.19505__func__.19481__func__.28302__func__.28501__func__.28481__func__.28470__func__.28459__func__.28432__func__.28372__func__.28349__func__.19702__func__.19691__func__.19680__func__.19667__func__.19653__func__.19641__func__.19630__func__.19619__func__.19606__func__.19592__func__.19580__func__.19568__func__.19556__func__.19544__func__.19522__func__.19511__func__.19499__func__.19487__func__.19478__func__.19467__func__.19458__func__.19447__func__.19438__func__.19427__func__.19418__func__.19407__func__.19398__func__.19386__func__.19373__func__.19360__func__.19347__func__.19334__func__.19321__func__.19308__func__.19297__func__.19286__func__.19275__func__.19258__func__.19241__func__.19232__func__.19225__func__.19217__func__.19210__func__.19197__func__.19188__func__.19181__func__.19174__func__.19166__mod_srcversion23__module_depends__mod_vermagic5VDA_BUF_ISFreeEmptyMDU_HAL_ModeObjOutEnMDU_HAL_BgYStrideVDA_InqTaskCallBackMDU_HAL_ObjAddrVdaCheckIntvlNumVDA_BUF_GetBusyVdaPrepareTaskVDA_ExitMDU_HAL_RefYAddrMDU_HAL_MduStartMDU_HAL_MaxObjIndexCMPI_RegisterModVDA_VpssSend__this_moduleVdaExitBufsnprintfVdaGetDataVDA_PollVdaCheckAttrVDA_IntHandlerCallBa :ckMDU_HAL_PicWSizeVdaODIntHandleVdaAttr2Comm__arm_ioremapVDA_SetIntMaskVDA_BUF_QueryFreeVDA_BUF_InitVB_UserAddfinish_waitVDA_BUF_GetFreeLen__iounmapVdaCheckBufNumMDU_HAL_PicHSizeVDA_SetTimeOutupMDU_HAL_ModeTimeOutEnMDU_HAL_CurYStrideVdaUserSendPiccleanup_moduleMDU_HAL_MaxObjCntMDU_HAL_EgSearchTimeOutVDA_VpssQueryprepare_to_waitmemcpyCMPI_MmzMallocCMPI_UserCopyVdaStartRecvPicVdaSrcScaleCbVdaStopRecvPicVdaCheckBgWgtMDU_HAL_ReadIntVdaUnRegisterVpssSendVDA_DRV_Init__wake_upVDA_BUF_GetBusyLenVdaQueryStatVdaSetChnAttrCMPI_RemoveProcgs_u32VdaVersionVDA_Dvr_GetRegAddrVDA_ResetChnVDA_ReadRegsCallBackinit_moduleg_apstVDAUAllRegMDU_HAL_BgMovePixCntVB_UserSubVDA_ReceivePicVdaComm2AttrCMPI_CreateProcMDU_HAL_ClearErrIntMDU_HAL_SadAddrMDU_HAL_ClearIntMDU_HAL_WeightSumExp2MDU_HAL_GetIsIntOkVDA_BUF_PutBusyscheduleschedule_timeoutg_astModulesVdaCheckODRgnAttrmsecs_to_jiffiesVDA_StartVpuMDU_HAL_SetIntMaskVdaCheckObjNumVDA_BUF_GetUserMDU_HAL_ModeSadModeSelVdaCheckOccCntTHVdaResetODRgnMDU_HAL_MinObjHVdaRecPicVdaCheckAreaTHVdaInitCtxVDA_BUF_IsBusyEmptyMDU_HAL_TimeOutVB_GetBlkBySizeMDU_HAL_BgMaxObjIndexMDU_HAL_SetTimeOutVdaCheckSADBitsVdaCheckRefModeVdaCheckWHMDU_HAL_MovePixCntVDA_BUF_PutFreeMDU_HAL_SadStrideMDU_HAL_MBSizeVDA_BUF_ExitVdaPrepareFirstTaskVDA_ReadIntVdaInitVdaMDIntHandleMDU_HAL_ModeClkGateEnCMPI_UnRegisterModMDU_HAL_SetpanicMDU_HAL_ObjCntVDA_ResetVdaCheckMBSizeprintkMDU_HAL_BgMaxObjSizeMDU_HAL_MbSadThVDA_ConfigRegsCallBackDestoryFuncTypeVdaUnRegisterViRecvVdaReleaseDataMDU_HAL_ModeBgUpdateEnVdaCheckUnOccCntTHVDA_ClearInt__memzeroMDU_HAL_TotalObjSizeMDU_HAL_BgYAddrVdaCheckSADThVdaInitBufHI_LOG__init_waitqueue_headMDU_HAL_ResetCMPI_MmzFreeMDU_HAL_BgObjCntVDA_GetIsIntOkg_stSpinLockVdaCheckStaticAttrVDA_SetVdaCheckRgnNumVdaCheckMDAttrVdaUpdateRefMDU_HAL_ModeMdModeVDA_BUF_GetFreeVdaAllocMemMDU_HAL_MinObjWVDA_DRV_WriteRegsVDA_GetTimeOutVdaRegisterVpssSendVB_Handle2Kerng_astVdaChnCtxMDU_HAL_GetTimeO  :utg_VdauHdlVdaInitTaskVdaChnSendPicMDU_HAL_SrcWeightseq_printfMDU_HAL_ModeEgFindEndown_interruptibleVB_Handle2PoolIdMDU_HAL_MaxObjSizeVdaGetChnAttrVdaPutSrcPic2QueueVdaDestoryMDU_HAL_CurYAddrVdaExitVdaRgnIdxCommRefCtrlVDA_BUF_PutUserMDU_HAL_BgTotalObjSizeVdaCreateVDA_ClearErrIntflagsVDA_DRV_Exitautoremove_wake_functionVdaRegisterViRecvVDA_BUF_GetUserLenVdaCheckODAttrMDU_HAL_RefYStrideVDA_DRV_ReadRegsCMPI_UnRegisterDeviceVDA_ResetChnCBMDU_HAL_ModeWrLockEnVdaProcMDU_HAL_ModeSadOutEnVDA_InitVDA_StartOneFrameCallBackVdaGetMemInfoVdaCheckRectVB_Handle2PhysVdaFreeMemVDA_BUF_QueryBusyCMPI_RegisterDeviceVdaCheckAlg+,+ , X+\+`,d,p+,++,,+,++ ,,,+0,4++,,+,++,,+,4+8+<,@,L\+`,d|++,,+,++,,+, ++,,$4+8,<+,+,,+0,<T+\,t+,+, + , $ +!( ,!, \ +` ,l | +" ,"  + ,  +# ,#  + ,  + ,$ 4 x +| ,  +& ,&   + ,  +' ,' @ +D ,P ` +d ,h  + ,  + ,  + ,  + , L +P ,\ l +(p ,(t  + ,  + ,  + ,  +) ,)  P +T ,`  !: l +t ,  + ,  +, ,,   +6$,6(p@+7H,7L+8P,8T\+9`,9d+:hp+;t+<x,;|,<,:+=,=+>,>+?,?+@,@+A,A+B,B+C,C+D,D+E,ED+FH,F+F,F$+G(,G,+H08+I<+J@,ID,JH+KL,KT,H\+Ld,Lh+Mp,Mt+N|,N+O,O+P,P+Q,Q+R,R+S,S+T,T+U,U|+V,V+W,W+X+J,X,J+K,K+Y+Z,Y,Z+[+\,[,\ +]+^,],^$+_(+`,,_0,`<+a@,aH|+b,b+c,c+d+e ,d,e +f$+J(,f,,J0+g4,g<+hD,hH+iP,iT+j\,j`+kh,kl+lt,lx+m,m+n,n+o,o+p,p+q,qh+q,q +,+t,t+,(+,,@P+uT,uXT0eL+P,\h+yl,yp+,+z,ze+,+t,tXe+,+},}e(+,,8H+tL,tPl+p,|+z,ze+,+t,t0de|+,+z,ze+, +t,t@e+,+, ": e+,+z,z$e48L+P,++,,+,+,+l,l+O,O,+0+4,8,D+H,PTh+l,+,+,++,,+,+,<+D,H+P,+,+,++,,+,+ , dt+,+, + , w  + + , , + , !+!+!,!,!+!,!!+!+!,!,!+!,!!$"L"T"ep"+t",""+t",t""+",""+z",z""e#+#,##+y #,y$#4#8#$+$+$,$,$+$,$%+%+%,%,%+%,%%+%+%,%,%+%,%%+%+%,%,%+%,&&`'+d'+h',l',x'+|',''+'+',','+',''x(+|(,((+,(,,(X)+\)+`),d),p)+t),|))+)+),),)+),)))*$*U@*YL*e`*+d*,p**+t*,t**+*,**+z*,z**e*+*,++++,$+,+eD++H+,T+`++yd+,yl+x+|++++,+++t+,t++0,nH,^\,ep,|,+,+,,,,,+,,,,,,$-y@-e\-+ #:`-,l-x-+y|-,y--y-+-,--+z-,z--e-+., ..+t .,t$.4.8.t.y.+.,..+t.,t.../T//+/,//+/,//e0+0,$040+t80,t<000e0+0,00+0,00e1+1,1 1+z$1,z(101eL1+P1,\1h1+yl1,yp1111+1,12+2,2(2+,2,82H2+L2,P22+2,22m3_83+@3,l3|3m3_333HD4d4+h4,t44+t4,t444+4+4,4,4+4,5 5_5+ 5+$5,(5,45+85,@5D5+H5+L5,P5,\5+`5,h5l5+p5+t5,x5,5+5,55555+5,66+6,6L66+6,66e6,7<7mD7X7_`77+7,77+7,77e7H8n 8$8e<8+@8,L8\8+t`8,td88n8+8,88+y8,y88+8,89+z9,z 9_09+49+89,<9,H9+L9,T9X9+\9+`9,d9,p9+t9,|999:xl;n;^;;;+;+;,;,;+;,;;+;+;,;,<+<, <<+<+<,<,(<+,<,4<8<<x<H<n<^ = =4=xH=+L=+P=,T=,`=+d=,l=x==+=+=,=,=+=,==+=+=,=,=+=,==+=+=, $: =,=+=,==+>+>,>,>+>, >$>d>>+>,>>+t>,t>>+>+>,>,>+>,>>>$?@?+D?,P?`?+td?,th?x?+|?+?,?,?+?,????@@x@+@+@,@,A+A, AA+A+A,A,(A+,A,4A8A+ 0SO&0S`@pAT 0S 0S 0Sr0S\@pW AT 0S 0 H0@LĔT @ 0S 0 Ŕ0@$Ŕ @ 0S 0 0@Ŕ @&0S 0Ɣ 0@Ɣ @0 0@Ɣ @0Ŕ 0@Ŕ @z0 0@Ŕ$ @e0HĔ 0@LTĔ @P@@H` @ @00@`PP@@PPP@ P\\$P@  0@P@ (K -L M@  @00@0 @K -LMPx0 @b @J K40 @a @J -LMPx0 @< @J K *:40 @; @J( -L MP@P Q 0S2 ` V0*p\* p`W< WP pW0f 0 `Vl (``,0  ppP PM SV RS K pbA `0'à p&c!`W#3(pl'p, l" X X(pp,p (pl'p,  XX(pp,p  ` ` 0 @Ϡ @0 00 00(  ,000 p0 @\0 @B@ 00 @@Jv  0 @B< 0-LM@RP 00@R3@ K0 BPL Q 0 CRU BQcs 2 @  @3Sn KPP P2 @0 @2 @ 0 @1 @0 @1 @ 0 @ʠ81 @ 0 @Πx0 @ @i0 @ @Zx0 @ M@ P0 @@JH00 @ @9L -L MP@K@0 @r 0 @@\ 0-LMpq@P 0@;SQ%PK00 @e0 @@P0 @W ?: 0 @  0 @^l -L M@PA 0SS 0 S'PK 1 @E > @0 @50 @0 @> : @<0 @1B@ 0 @@J -L MPO Q;  0R  0R\K 1 @Ϡ @0 @" @0 @ @\0 @O@ 00 @@J  0 @B 0-LMPP@ Q 0SRS! 0Sl0SZS 0SS RnQl:Q{Qx 0K0 3R PQ0S3 @0 @3 @ @X3 @0 @3 @ @2 @e0 @2 @ 0 @T2 @ 0 @~ 2 @0 @n1 @ 0 @^1 @0 @NL1 @k0 @>1 @aO@ 0 @@J, 0 @A0 @ @l0 @ @00 @u @ <: 0-LM@P 0@S0 CR AR1 0S R;PH\U\bPUoR P K0Uv \t Sr Sp Q 3 @^ @2 @JϠ0 @2 @5 0 @d2 @;0 @$2 @A0 @1 @G0 @1 @M0 @d1 @VϠ @u(1 @ 0 @a0 @ 0 @M0 @/  0 @:<0 @EO@ 0 @@J( -LM`R@pO P+QP@<QPO 3SN |#R' p $KP1 @z @J1 @y @J0 @ @J0 @xB@ `0 @@J@0 @J͠0 @J -L MpQ@( PP``@<QPO a3S) h' K0 @* @J0 @)B@ `0 @@J@0 @00 @J -L MP@PT1 @ @J K`pp@<aPOq3S ):$ Uh'Q  P!0 @ 0 @J@0 @0 @J -LMP@0 @ @JKP``@<QpPOa3S #R s!@0 @0 @J p-L MP@0 @ @JKpP``@<QPOa3S  !@0 @0 @J  p-L MP@0 @ @JKpP``@<QPOa3S  $!@0 @0 @J0 p-L MP@0 @ @JKpP``@<QPOa3S  $!@0 @0 @JD -L MP@p)Q P``@<QPOa3S( H K0 @+L@ 0 @@J0 @* @J@0 @20 @JX -LMP@`,PpPp@<QPO q3S)  Hc!K0 @ 0 @J0 @ @J@0 @0 @Jh - ):L MP@`4Q"Ppp@<QPOqsW3  dP n `!! K0 @ @J0 @ @J@0 @0 @Jx -LM@@@1P`CT>  Q K^0 VpKh X DK D80V  <00@ 4, (x0 00@ | t pl0 $ x#R ? K1 @ @J0 @) @J0 @A@ `0 @@J@0 @!0 @J -LM`R@pP P,QP@<QPO 3SO #R( p< $KP1 @ @J1 @ @J0 @ @J0 @@@ `0 @@J@0 @0 @J -LMPR@S P/Q`@<apPO3SR #R+  ̀$KP1 @` @J1 @_ @J0 @o @  <: J0 @^@@ `0 @@J@0 @g0 @J -LMPQ@5 P#`pp@<aPOq×\6 @ ό P !K0 @ @J0 @O@ `0 @@J@0 @0 @J -LMPQ@4 P"`pp@<aPOq×\5 @ ό P!K0 @l @J0 @kO@ `0 @@J@0 @r0 @J -LMPQ@- P`pp@<aPOq×\.  ό!K0 @ @J0 @O@ `0 @@J@0 @&0 @J -L M`R@p@ P.QP@<QPO3S? @ q$( ! K1 @ @J0 @ @J0 @N@ `0 @@J@0 @0 @J -LM`Q@+ PPpp@<QPO q#R,  / !K0 @s @J0 @rN@ `0 @@J@0  ?: @y0 @J  -LM`Q@+ PPpp@<QPO q#R,  / !K0 @, @J0 @+N@ `0 @@J@0 @20 @J8 -LMPQ@/ P`pp@<aPOq^0 @  !K0 @ @J0 @M@ `0 @@J@0 @0 @JL -L M`R@pN P,Q:00@!X @<APPOq쀈  K1 @R0 @J0 @K @J|0 @L @J<0 @JM@ 0 @@J\ -L@ @3 _͂0  3 !_! -L MpR@`A P/QP@<QPO3S@ @ _  ! K1 @ @J0 @ @J0 @@@ `0 @@J@0 @0 @Jl p-L M#Ðr@@|00>TWSK R8 3SP Q5*PcPPE U]U3! 3E`@ 0R0b@Q*V 0R0b@ 0R0b@ 0R0b@Q:T30  *:3 RbKpPQPQPERZ@@` 4``@`@@8 4@@@@@@ 4@| p-L M@1cV: p3S_ _ Pppl3S  Pl l#  @PP_  @PPKp@@ 2@ 0-LMPP@4 10S T#XQ"0T$Q @PK0/0 Q!$0 0 0 @! 0T "80S $ K3/T#XQ   @@ h6@ 0-LM@P l3S_ _P lp3PlpK0@@8 ;5@@@ F5@@@@ -L M3S 0 S8#SS S" R  2 P KC T:3S0 @Ϡ @X0 @ @@@ 1@ -LMQ ? ?00 K@@ 0@ -LOMpK@K`R 0@00P040 000p0 0@0 000000 Q  @X SKX 0@qSTq  pP s P1LD1 P HPL!P@ P @  R@ $(KHPPP@ 0Kl0  (Kl 1  @ 0  @ @  0 @0  @@@` }3@@@@@@8 w3@@@ 3``@` -L,MP@3 @ @J(K耐@< P}SU 0 #Rc ÅH` #!Q m?}`@pK 0@ 0@0 < 80 4  #Rx3SO `Vq ` dQ \ !R 1S Pp 4  ,G' 8H0`'dX300 0 3-$#t#33! {  OsP }?`@pK 0  >@@ 4 <   %:8    3S Qm pPX R $` p `2<0S 3/ Pr! -@0 @0 @ J  -L -LMP@ `?Q)Ppp@<QPOqsWU |P;  K@PH0 Q @  !K,1 @E @J0 @D @J0 @S @JJ@0 @K0 @J -LMpQ@\ P*P``@<QPO.acV] xP1  P=O `P ` Q !H1 @ @JK0 @ @JJ0 @@@ `0 @@J@0 @0 @J0 -LMpQ@H P(P``@<QPO,acVI P-O `P" ` P !1 @ @JKJ0 @N@ `0 @@J@0 @0 @JD -LM`Q@J P8PpPp@<QPO#q3SG O pP  ! 1 &: @O0 @JK0 @I @J0 @HN@ `0 @@J@0 @X0 @JT -LM`Q@< PPJ Kp1 @ @JpPp@<QPOq3S, O pP! p P !0 @M@ |0 @@J@0 @ 0 @Jl -LMpR@Pg PQ-@1cV PJ2 (K1 @0 @J1 @ @Jp1 @ @JꄀPO쐆 0P5 0  R% ^ 00 00!0 @N@ p0 @@J  00 00bdP 00 0000 0} -L M`R@h P?Q(Ppp@<QPO,qsWg P; PH A@P   !x1 @ @J K$1 @ @J0 @ @JJ0 @@@ `0 @@J@0 @0 @J -LM`R@Po PFQ/pp@<P 3: O3qsWn PB PO A MP  0 0 !x1 @& @J$K $1 @% @J0 @4 @JJ0 @$@@ `0 @@J@0 @,0 @J -LMPQ@L P/`pp@<aPNOO3qsWM @ 0P+    R@ !0 @ @@@J$K@@0 @_P `0 @@P@J@0 @0 @@@J -L M`QPG P@P@@J (K|1 @? @@@Jp@<qPNOOX/ 8 P   @ @ !0 @>_P `0 @@P@J@0 @LO@0 @@@J -LMP@PXQ `pp@<aPO$qsWW U dQ 0  P!1 @I @JK#R KP@ U   P ,1 @20 @P J0 @H @J0 @O0 @JT0 : @t\P @@@ u<@@@@ -L@P 044 -L M@PKP 043@@ :@ -L4MP@|3 @ @J(K耐@< P}!P SU Q   #!3S }?mLpK0  `@L0 < H D @  Õ\x^ QMd!R \ Q ^ 048K40 8 40 ͅ,0 P ! {  Os m?pL`K < 0>0@L @ H D0  0  Q 0 @0 @ J?@0 @0 @ J, -L$MP@(K`p,p 00@l00 R? $R K4@ 8K0 @,K8@ 0p`(7/pP,@` 0P (`d40 @[ @X0 @b @@@ N:@ -L M@(K`, 00@l00 Rd #R+pP4 8KW0 8P ,K0pp(`8/P",@&ap P& ( 0p$3 tP& V$K0 @ @0 @ @d0 @ @ : @@ :@@@@( -L MpQ@[ PPJ K2 @h @JP`P@<aPOQSUS PE$ PD XXQP. R+ Õ\X  PA !0 @gM@ 0 @@J P  JL0 @u0 @Jw< -L?X0 \ L?T0 XlP-  t#0  0 $3Hlpܣ嘣崢h #YУd먣嬣X尣崣帣 0F$( T&(L(t(6͆,XT @P;l_4P 0@ 8K8 , 2/l0k 8 0 8K4P , 2/lw8 4P  : 0 ,08K3/l-8 4P 0 ,08K3/l 8 8K0 $4P ,03/] xLcH1 @K@0 @P@@J0 @[P 0 @@P@J0 @?K@0 @ @@J`0 @50 @@@J  0 @-L -L M@l0S1  RE 0S; pp@l@PQ AT @Tl@K03/l  pp@p@@< 9PP@P@@ 9@@@@l -LLMPP``@1CT E HȐ\ DKp 1p4p p sW` 8 psWK ꠅ p#\Z5 pp@p` l h h0Sl0D0 -QHZDp0lsWZ /@p E"!0b4`V T CΎ006/P|p3SD DD(Kr0pÔD ˇ2 @ 0 @Dp 0Kp 0Q8p  dKdD `DTpD0(pD P,LD0HpD0pH R1  : @ 0 @.1 @. @e0 @P`1 @Y 0 @1 @0 @Pw0 @0 @Pf0 @_C@ d0 @@JT@@8 q3@@@@@@ ?PP@P| -L\Mp @p@@hK0 P h0 0C0T00000 A"^pl8^ 0Sa  !prCn8` QE0S\P=bV  d`hpLꀅ P`V=0S:8Kpn 8 RE 12<Q8^`E&X4S \$R Ô\h@P,'ͅPQ(K00x'pW|\~ p`P00TPP5 @p0  @P!HK < D P8H0P < P@ P4 @p0 @P H4 @F0K4KP00U @Q4 U.<P Q C @4S} 3 @p0  @P+`p`0rh3 @p0 @P03 @` 0 @ „8<Ĝ'0 Q0@2 @p0  @Pt2 @!p0  @P42 @P p0 @1 @p p0 @1 @P8ė p0 @ : \1 @` p0 @1 @*  @0 @8 0 @s@@ 6PP@P@@l 6@T0 @2G@ @@@ 37@ -LTM@tpK0 <0 C0T0t0 00000 - m_x ?<+̄ ` `V 3fP  \ ,(&^ xSpSlSU x|7 <`K7 P<P$ ' ( P<7QL ' P  Px<4hYt 0(0 xPi<=^ |(| \"`p3RPix Y ,(9 ,  l (h p t (0d0 ,` 0 \ X 0(,9 t0Kp  $)d49` \Xl  h0) X9 TPp  t \x:Vp't8tt p0 tQX 03'8 Vt00t0 sW $T00DHy 080#L @ -L MPP@1`CT t3 CR>S+S&0S 0vQW &\I vQY  R  R  R  Rk pS3s4W`V fpW  : 0S 6^  R ͠} ` `cpc 0@[@@U @ 0 + KW S &pWP p&P6 p&P p&0S pW SU0p3 -,P p 3St;x; pW RvWƔ\ pvQb7\^8$0\ pWp RluWiŔ\f pi'̠ pW\ RXuWU Ŕ\R pY pWH RD8tWA<Ĕ\> lPT: @0 @&`V  0S <QgP R '̠ 0S QQ&`V 7^ Ŕ\Q&`V 7^ Ɣ\Q`V} $ (},Ą(ĄvQ 0vQ &\ vQ'\wQƔ 0wQ'\Ŕ 0',\wQ0'\wQƔ 00S6S70SP p7^Ŕ\QP p'<^ Ŕ\XP p6^<Ĕ\pWPp wQ{'\Ŕ 0u',\mwQ0g 0S^'0S84YYpQt&P<<^9 0S51w\9fV6Q2.gpW&Q#'P' Q %RQ  $ (0,4(4 p  : P0) p3 0=|;Q  6 R5 &Q^  0SK 6 R8 t+Q fP\ Q \  0S op#P PppÄ} 0\<$R 0S\&R 0S'Q5S\'̠ 0S Q'Qv^7 RDĔ\op3PvPj l3S  Plp0l3$sWl0p3 PppsQ{`VwvWtgPkw^g%Rd'`V['pWW5ST$ (,t(t0@@h!v>@L1 @デtS0 @P@@!7@@@@@@ 7PP@P@@ 7@@@@@@ 7@@@` X8@@@8 D8@@@@@@ T8PP@P -LMPP@1p`(p CTn Q$K #R 3S  X &X &X &X& W@ Pp  #PpX0t3t3-S* PP <6Xp Xp &Xp Xpu W\(Q $P6d0-0p33 ˕@@@\00@  7 @^0 @J@l00pW 0` p, 4p 4K00(K3/Pz0Q(X1 ( p{ 041. 4($R1 (   : pp (,$q(ZPp7~'P5 Z P p eZ P 7pS젔Z} pP 'pA- P@L P P+00@4\ 80Sp ^p!- P@HxW L84Q …80Sp Pp.P@vPΔ\ T.00@4^} 80Spx QpE P[T1P X!0 0@4Qr 8\pm (1SPp7 pP7p PM 7pPp7$ (,(<3 @E@0 @@@@Q]@2 @0 @@K2 @ 0 @N`2 @ 0 @A2 @㌅ 0 @pp$1 @ 0 @1 @q0 @T1 @  @<`1  @0 @p3S' XP$!` 0  @ 0@@d 76@@@< 5PP@P@@ 5``@`  -LMpQP Pn`@@@<aP*ACT PP} P Q @l0S# ,0S \&^\Q 0SX K+0L0 P R0S :0 CQ5 6 P/ Q L P.1S+ R PQ$\!6P\D7 @ @J(KH(R^ Z P# ?㭝@K 0@ 0@0 < 80 4 @K P  0P @KZ{  P L+^0SZ !.P] 6 @ @0JE- PG Q PC 0SOp5 @> @0JrP ?@ 孝@0K  @0 4 < 8  "@K P @KOF! P -= P T R:(Q73 @z0 @JK` \T d'h; ` EL3 @F0 @J3 @ @J2 @ 0 @*2 @g 0 @H2 @* @0 42 @3 0 @1 @L0 @ ! Jp1 @H@ H1 @@Jw(1 @0 @JdJ_0 @0 @ ! JK|0 @0  @  :80 @@K O-O] -LtMQPx Pp`@@@<aPOtACTy PP" P Q. @l0S ,0S P&\Pk Q0SpKX +040 Q R$0S0{ CP 6Q. P LQ-1S* R PP#\ 6QX5 @ @J(KH(R^  ӟ P d 4+QXE !.P 05 @. @0JE- Pw Q Ps 0S4 @Z @0J! PA -= P= T R(Pu `  \|< d'h 0 `7  l3 @c0 @J[3 @0 @JH2 @ @J62 @  0 @UT2 @G @0 m2 @P 0 @1 @G@ 1 @@J1 @0 @J@1 @40 @ ! J0 @0 @J0 @0  @ \0 @D0 @0 :  @ ! J -LMRP P@1CT Q Ô\ 0S) `XX X X1 X7 @00  @p7 @wp 0 @p(K6 @0  @p RYP{Q  R 0S'&^P'v\+ H(RpPh 0H00 Sӟ 0`Z*0 R}X? 5 @0  @l5 @0  @p 5 @8wp @0p y4 @|p0 @ppJh4 @? 0 @LQ1SP^\T R(Q3 @x0  @7 pP lp X p0X \0hP pPh;d' ` Ô\{ RQs 2 @p0  @ppÔÔH 0Sh2 @Q p0  @pp! pP 1 @`0  @.pP -} pP E= pP Q pP D1 @ @ppJHP0 @H0  @sp 0  @   @ad0 @F@ <0 @p@pJO@@ 7 :@@@@  -L|MSP Pc00@l R , R ` @CT ^ #R xP Ôz3\^ 2S Z @@H< @? 0 @!(K; @b 0  @#pR 0 0 P!Q0S 0 0CS@h; @0  @ p P; @w @0 P p : @80  @ RX&\P6^  H(RPLQ1S~ 0CYy 0 `RY^ 9 @0  @NH9 @~ 0 @ 9 @00 @J. 0SQ8 @ 0  @l8 @H0  @P 8 @o0  @^) RÔ Q! 7 @0  @ÔÔH ! P6 07 @0  @-= P$ .P! E P Q̈́ P  Plh R KX 0S S p% ZʟP ㌃X㈀  3S0  "R   x^ z3XP ZX7X  \X 0\0h : P P4d7h`'Y2 2 `P  H3PS` P X X  P HP P p  PP @@#6pp@pPΔ\}^zT Rv(Qs3 @0  @d3 @ @JHPS3 @H0  @#0R:^W*Pj R0\0ROp 2  @   @\0X p|  \ X 00 2 @E@ 1 @@Jo1 @ 0  @_ 1 @&\  ptX0t hp h p d\ 0X d0 |  Q Q(, 偠ሠ 傠   ,(@#u( ,( , #h@@8 [=PP@P@@ B6@@@@( -LMp `,K`@\ 0+@1S Q 0S4K,(@240@0P? @l, `(Ph#" j@@S#P@@R %5PSP0 0@ PbUP P0P0@$ nR@ $ (,!$K -LLM`DK V0D0 000 pp@CT 샔XpSlSU p tl @2h0@pb a"P0K R  T X R l h@2t0@pb+ a# S00T0S7^$ PPs7 Rd LPQ,(Q :  HQ/x8 R ^ #R3Sp3 S  Pp0p3 !P̈́pSS 0@ !(K!> @ 0 @SUx\= @0 @3S,P<= @0 @3S~Qxu< @0 @3SUQWS^8   PT 0T0  P00P0  P00L0 P00H0 PkD @ XHDŽ@ @0H @0RÔ\< 'PUP8P  (1S{X\`Q r80S D K3/;   X\"80S D K3/  8 <P"  X0K4KP0 R 00K4KP\4 R0N,@4S0K4KP :M4Qx0L#@$Rr0K4KP>4 RN0N,@4SH0K4KP/4 R$0PA @4Sp3SP lP  Plp3l$Pl30p30K4KP 4P`0 N,@QZD K;0K4KP 4Q0 L.@PD K0K4KP4QU00 C.@Ğ\O0K4KP(00Sg < [D KOD K0K4KP4Q0 L.@PW@0,41h Kd0 (h $Ĕ` \ 08 s3X ,Ĕ71.hKd (h $` \ 8 |3X y@0  ,Ĕ71.hKd (h $` \ 8 |3X @0,1^hKd ($h $Ĕ`P \ 08 s3X &Rq< X0Hp77<< H^PP@P@@ 8@@@@@@l 9``@`T0 @ @@@ 9@@@@8 -L M@Q= 0S0S'SKP 0 @z @0 @[Ϡ0 @|0 @r0 @  :<0 @ZO@ 0 @@JD -LLMlK`@p@ Vd TWPJ! (K2 @ @J1 @ @JP@<QPOZB A$( AP5 Q.@ ( L 㒧,͌   !0 @N@ 0 @@J @0 @0 @JxX -L -L -L -LP00@   -L@0S0"00 -L 3@ -L M@0S@@@?0τ<00@?0C/2K40 @y @Jx 0-LM0(0DQh@0P &HT <HT y 8 HT .$HT (H T %+PPDT 7PPDT C%  DT -DT /DT |4 @W0 @K0`D Ty L"H T HT   HT  TV DTH TB T D TA DTl '  DT  T9 T3 TH TI $  HTA HTXDT$ f 8 DT )@DT X {yvspmk0h0gda_][# D T  !: DTDPM,HT .H T6B?XD T XDT(42HT (H T(&$DT $D T0T  TD T !DT   LT XLT *@HT  -L@@@0S 0-L@@@PU0UPPJ PP @Pl1/00@0 0-L@P@0 0-L 0R0P@@" @`C@P 0L00 -L0`  `d0 00 0-L  0R0P@@" @`C@P 0L00 -L 0P`C -L0`  `d0 00 -L -L -L0 \0  00 -L PM?`a@PP$ 0S P PV( V0F` `P x0  d\  V`Pd0p` xVdp`P0`Pd`` -LP@``U  pPU Q  -LMP 0 @0@S @J K 0 @0@R @J -L MR@. P Q00@1S7 T10K1 @Π @J0 @ @J0 @A@ X0 @@J80 @0 @J ": 0-LMP@PQ"00@!R? U+0 TQ!K0!1 @q @J0 @r @J0 @~ 0 @PJ80 @^Ϡ0 @J -L M00@AT BYK00 @ @ -L M00@P YK<0 @@@ 0 @@J -L M00@P YK<0 @@@ 0 @@J -L M00@AT BYK00 @ @ -L M00@P YK<0 @@@ 0 @@J( -LM@P3 pP'hV0 @ W4 @ Ph U Kh0 @0  @,0 @  @< -L M00@P YK<0 @@@ 0 @@JP -L M00@P YK<0 @}@@ 0 @@Jh -L M00@@1S ƒYPK|0 @p0 @<0 @k@@ 0 @@J| -L MP  PK<0 @[@@ 0 @@J p-LdM`Q@Z PHP 00@1S lQ* t@KX  #:! ?0X  03QX KpX  1 @0 @!J0 @0 @!J|0 @ @J<0 @@@ 0 @@J p-L MP` @PPP  Kp|0 @P @J<0 @E@@ 0 @@J -LMR8 00@Z Q P 8sT`W!< 8/ pHP ^ⅎ!}@a`p@P0ˆ0S 3/ P @R8`BYO0`Kq<pX%XT PPw  Ú\ P008^QPP  <P- PP `  #R 0K4KPj\ 08Q㐡*0S PP `  (K0KP'08 Rn1\<< f@2 @ D@ 2 @@J@@!64@1 @ @@@!4PP@P@@h!4@P1 @bd` @@@ !c4@@@@@@ E4pp@p0 @>TP @@@ ?4@@@` 4@@@@@@8 U4@@@ k4@ -LDMP@`P4@ D00@ATc >p#R   #TRq?E,HP pp@l!X 0 $ : ST u T0K3/l0Y0pP 0\_ D` H @ HK004K3/PP0 4 p\p pP  pE'0"` 0P  @ME$ C.08@ĄDĄAE$C>@8D602 @0 @`#1 @E0 @ J1 @A@ x1 @@JX1 @o0 @`C΁ 0 J@@ 62pp@p@@ .2``@`0 @fRP @@@l g2@@@@T0 @QP @@@ y?@@@@ p-L M00@@P1S  ` PKp@@ j?@ -L MR @ !K<0 @bA@ 0 @@J - %:LMpRP@ PgQu` 00@1S4 Q  R# D2 @͠ 0 @@! JK1 @:0  @@BYOP! J1 @30 @!JPPE X  !!0 @+ @J0 @K @Jd0 @*A@ <0 @@J@@ M1PP@P -L MQ @ !K<0 @A@ 0 @@J -L -L -LQGP;k@C Ft@r0t0l RSPpQP`d%Ņp Rv`{@ l @# P R l @"P R0P l 0"U @0F|` {p  -L1S/ !R, K+D0B|s |@r0@T!SPPQ0ue 0ʠu&f(J,Z  r ;E% ,F$FT "@!;'0? -LMP\0P|\+Q QK\- @dt@T&SUP p`TcK`c4pPD0 e(@T7e ta8p 0< ܃K0dQ0u` p& 8Q pP(K$* lr@T 0SUTR` pKB4D0 l0:\(TD0T0Q( U@S`P@?P/+00SQS  + d PT6zKuQd`p6U 7Ġ d PT6QcK8U 9 0-LP0Ϡ &:Q00Q< , ;QL@TkK[T8O*dpPUQS0UE5 EDE32 /cK\  0 0 B R@: R0B<à:UP#@D@e 00QL@T0PeuPUSQUŌ0E ĠŠ1R a\  0Q S R0PU E%bPK0bà0 -LaP -L00 cP" S @C T@ T  R  R0S 0S  cP"S @C T@ T  R  R  -L <!,+0"  !4%RP(?!("0@0S \ ;\ :PQP!,+ R:P0QS -L0 -LQ A0QQ 0S0S -L00 -L -L Pß00CRà0S:R S0C‘ R#0c# b0c~#  -L`2pp@Pp@@PW p@@P? p@@P' p@@P `@ -LP0@Oߧ ?0 0C c0#, SQ,Q0S: c0#, SQ,Q S K C70S0  b0AQ3Q@0pA~K0c ': @ -LPP 瀐`yY_Vu`@F pT0Z @T0 @@T0` VY -LE -L -L`p 0RP@@pf`  bZ R R0XЀBZQ\pf`X  l@R0ZЀTQL pf` -L00 -LM@ 8 R< &P0Kp`8 <*0AS;;;;;:P0lS0cSWp`V(K x-LPxK~T`PV+@"[@;#+1PD1CVx`K -L+0BPSSS B0cPQ` p-LϠ0AP?S 1S 0 SEP@ ږAQ ``046 1Q\ r0pc 0a4!# QU1U Q -L0Q b @l>  0-L; C00@[P@UPES aR%CaBQTBQ$SR!A%SP@@C& 1_U~t~T;@Ô 0 ??OP d\R0@d -L@ -L@ -LP0Q \ ?R -LM000 (0 ,0 00 C+S-Sr QG00 C+S-Sr Q> P K-S@@00 C(K0`K,PKp0Uq1p 0S  0B| XUq!p 0 (: 0 Cr X.S +S-S eS.R +R-R eR@00S%(Pk,0S Sm*P jpPS:uP`pPe({pJm,Pp%e PD*P ApPP:uP+pe({p(P0_ D@1C@p `{M,0Sp PP -L -L -L;0CHS  0-LP@0 -L@ -LM@@@P0 4 8 `pp@4 0 <0 <   P4  < <0 UPPP`PQPQ`V@`p8 0 8P` 0PV(K x-L@`P P`  x -L MP 0`00 V@04@ 0@ h 0*p`f@PC@ ◦&FcVPPUP U` ```0VXEp @ `cPg p0E% ESUPUppXp2\  `Pb 0E%ES U \  X P pe`P0G'GsW``V``` p f`PL,Là\\ PPXP S ` P@b 0d$DC T \    RS4` ): 0hc((`b@P@喊'GcU  R R  0 0 P0(Kpj@嗌%EsV`V` V `` bP@p@ ⚌,A`Là W \\ R0 -L M,K 00 @P $     ,0 (0 K -LP 0-L M0 K0"N00 00000 Q0 51 = 0S;#;40 \ ˠ,ˠ0 00PS;U#;,0 :4P01 0S;#;(0  R+"+$ 0 $PS;U#; 0 :(P0 10S;#;0 0S; Q#;0 51 K0 0-LM0fO0 Q (!0- \ ˠ,ˠ  PR+"+ (!0S;#;0 0PR+"+ ( ! R+"+  R+Q"+ (!0K0 p-L M0NS [P$ U$ [%[8 1` 0V+ "+S;$ $P #; 0 h a#$`0  ȆQ2$ P$Q!   Q!$ $0\ ˠ,ˠQ ȃ PU[%[$P 0P$S;#; 0 ha0S;#;$0 \ ˠ,ˠ!Kp+"+ p-L M0PS 10$ S$@; #; 0 h a$` 0 @810S$0 0$ S;#;Q 0 8 1 @TK$K$@ 0S;#;!;Kp+"+ -L Pp`@p0@  Z 0   ZI* ZM*T%ZO Y=*  Y9* Y7*T%Y+, X˅ ̅  X˅"* X̅"*T Xʅ0 P$ [  P * P*TP [.\ccPc c0p P *: p4 8 <,&\@"R  X"̅" ˅2 Z "2 -LM@  l M  KK03/ K -LM@ @l @ $K$ M0 K3/K -LQPP00Q00 -LQ00P0SR -L -L -L04$\‘‘  (P  P(,@ 04tP  P8< @D\ \HL PT  P  \X\ ` ,dx h l!p (tt x | ! -L0    -L0Q  0-LP @0@ 0-L,@ P0` -LQ Q Q```"$`"00€0"$0"€ -LQTTTTQ A@A!ŒTBd 00D1210S @0 h ӕ 1\&01 -L -L -L1>1 -LQ Q Q`2?`22?200 -LO00 -LMPP@,`K pKl@ (@ L,  03/l @  L03/K -LM@@ @ @ $ l $K L K03/K -L \€€€02 -L -L -L -LMQ *1?1 KQ @@H O<@! + : 1!/! -L M@P h ` X H D < 4 $              |  d  @ l ( X  D  0! " #  % & '  ) * + t - \. t/ DK@@d j7@ p 8Xx8 !h#%& -L M@PKP 000@@ >@0( -L"01" -L@84 0-LM@PT T T K00 @0 @L0 @0@@ 9@@@@L( -L MQ@# P000 00KP0 @0 @  <0 @I@ 0 @@J`( -L M@P; 0SdQ$ R!K0 @F0 @0 @L0 @|0 @R$0 @<0 @BF@ 0 @@J|( p-L M@RP` 0S(S 0S30S@ RN CvQ\j B4PpKp02 @6 0 @1 @0 @ ,:1 @0 @l1 @0 @P(1 @ 0 @`0 @$0 @0 @*0|0 @cΠ 0 @<0 @F@ 0 @@Jo( -L M@Q 0SK|0 @0 @<0 @E@ 0 @@J( -L M@Q( 0?S?QK0 @0 @|0 @0 @<0 @]N@ 0 @@J( -L MQ P P00K<0 @E@ 0 @@J( 0-LMPQ@' P0SK00 @0 @|0 @[0 @<0 @E@ 0 @@J( 0-LM@QA 0SPP(0SPP!0SP P PK0P0 @0 @P0 @0 @<0 @E@ 0 @@J) -L M@P  0AS|0 CR0 CR Q R0S+Q8 RE0SQK2 @W0 @h2 @h0 @(2 @W0 @1  -: @w0 @1 @| 0 @h1 @0 @(1 @D  0 @0 @M 0 @u0 @V  0 @b<0 @?E@ 0 @@JP0) p-LM00@ l0@0PK ( P$ ,K,P K0 2/`P 1.@P 1 P" 1Kp0 @k @0 @s @d0 @{ @@@ d>@H) -LO -L M@ O 0@@PK00 @% @d) -LM@PP@8 4 `00 0pSP 02 …^ P$tZx !$"(0(2t04,… 8댒Y  @"2SD…<Y  H"d2SL…đY  P"$011\` 0d2h 6>11l p0t 2x6| 8>1 10 26 8:1 -L1 0811 0811 041 -L10 8 > ??11 0 8<11 $0( 8<11,0 0<1148 0<8@ <?11DH 0L4P 8<1T1X 0\4` 8<11d011h l0p 4811t x0| 481 2&:1 04 8<1 -LMQ $$204 8?22048<22 $082 2(,08 220408482<2@4D8?2H2L0P482T2X 082 K0204 8?0242048<4282 $0882<2(,08<2@2040848@2<D2@4D8?D2HH2L0P48H2TL2X 08L2`204 8?`2d2048> ?? 2$2$0$2(2(,00;4<8=<>@>D??(2,2HL08,2P 202 K109 ;<=>> ??11$011(,00;4<8=<>@>D??11HL081P 202P209 ;<=>> ??P2T2$0T2X2(,00;4<8=<>@>D??X2\2HL08\2P€T 20220 ;<>> ??2$€P 202 33: x@@ U6@t -LM K@@ 4@t -LMl K@@ 4@t -LMX K@@ 4@t -LMQ0ꠙtH0  080 K0  0800  0800  080@@ 3@u -LMQ004800 0400 080 KQ @@` !3@00480 00400 080u -LMQ񟗰pěD004 8PP-U 08   Ȑ0Y@@Ƞ LQ0 R00@ -L M@PP (K``@h@P- @PP6  PS tx.@ @|>p~0@p@ e P<d@\@`@X$`P!0 @ @0 @  @@0 @ @ 40 @  @/ 22v -L$@@ 0-LM@P@@  @ 0,P$0P 0 @0@Ϡ @ h @@@K0VPSS_QueryVpssSelfVPSS_SetExtChnAttrVPSS_GetExtChnAttrVpssCalcCropVpssCheckModeVpssCheckDelayVpssCheckFrameRateVpssCheckFilterInfoVpssCheckGrpStaticAttrVpssCheckCropCfgVpssCheckGrpAttrVPSS_GetChnFieldVPSS_GetGrpFieldVPSS_SetGrpFieldVPSS_StopGrpVPSS_StartGrpVPSS_DisableBackupVPSS_EnableBackupVPSS_GetDelayVPSS_SetDelayVPSS_DisableChnVpssBypassSysSendVPSS_GetPreScaleVPSS_GetChnSpParamVPSS_GetChnNrParamVPSS_GetImageQualityCfgVPSS_GetParamVPSS_GetCropCfgVPSS_GetChnAttrVPSS_GetGrpFrameRateVPSS_GetGrpFilterVPSS_GetGrpAttrVPSS_GetChnModeVpssNotifyBindVpssFrmRateCtlVpssCleanPicQueueVpssSendFailVpssReleaseCurPicVpssCheckPresclCapaVpssGetRefStrideVpssPreScaleVpssDsuCallbackVPSS_ResetGrpVPSS_SetChnFieldVPSS_SetPreScaleVPSS_SetCropCfgVPSS_SetGrpFrameRateVPSS_SetGrpFilterVPSS_SetChnModeVPSS_SetChnSpParamVPSS_SetChnNrParamVPSS_SetImageQualityCfgVPSS_SetParamVPSS_EnableChnVpssFreeNrBuffer ;):VPSS_DestroyGrpVpssMallocDieBufferVpssMallocNrBufferVPSS_SetGrpAttrVPSS_CreateGrpVPSS_GrpExitVPSS_GrpInitVpssQueryOneChnVpssCheckQueryRltVpssPrepareHwInfoVpssProcQueryRltVpssStartOneTaskVPSS_UserSendFrameTimeoutVPSS_UserSendFrameVPSS_RecvVpssSelfSendPicVPSS_SendPicVpssGrpIsrVpssCheckChnAttrVPSS_SetChnAttrVPSS_ModInitVpssIoctlVpss_IoctlVpssSendPicToExtChnVpssUserListGetDepthVpssUserListSetDepthVpssUserListGetBusyVpssUserListPutFreeVpssUserListGetBusyNumVpssUserListGetFreeVpssUserListPutBusyVpssExtChnCallbackVpssUserListGetFreeNumVpssUserListDestroyVpssUserListCreateVpssGetVbVpssUserGetGrpFrameVpssPutVbVpssFakeSendVpssFakeQueryVpssCleanUserListVpssUserReleaseFrameVpssUserGetFrameVpssUserReleaseGrpFrame?@? VPSS_DRV_ConfigChnFieldInitSclCoeff((6DTdt       v g XG%66 0@P`pp`P@0  , = Obv     <3: p\ I33 HH ;U /b #q        y o d Y L @$33{ vpke`Z!U%P)K.E2A7<<   ~z!v%q(m+h/d3`6[:W>SBOFJJBqqB AprD ?osF >ntG<l =&:vI:kwK8jxL7iyN5gzP3fzQ2e{S0c|T.b}V!-a~X"+_~Y$)^[&'\\''E]f]E'&D\f]F( %C[f]G) $B[e^G* #AZf^H+ "@Yf^I, !?Xe_J- >Xd_K.>Wd_K/=Vc`L0<Vb`M1;Ub`N2:TcaN29ScaO38SbaP47RabQ56QbbQ6gOg\OpTOyKNCL;I3F+C$?94- ' *@Vlx,f@SSxxqjc\UOHB =82 , ("-037:=AD|GyKvNsRoUlXi\f_bb >%:6:=@DGKNQU}Xz[w_tbqenhkkNN BZ 6g +t !    ~ vmbYMB 5(( , = O b u o \ H 22 hjh^jrTi}KgBd9a1])X!SMG @81' )z*s)l(e']&W$P!IB<60 *  %    |wso ?0: !k$f'b+^.Z2U5Q9M=IAEEBssB @rtD?quF=ovG;nwI9lxJ7kyL5iyN3hzO1f{Q/e|R-c}T,b}U*`~W(_Y!&]Z#$\\$PitiPOhsiQMgtjQLfsjRJesjS!IdrjT#GcrkT%FbqkU'DbqkV(CaplV*A`plW,?_plX.>^plX0<]omY2:]omZ39\nnZ57[nn[7VPSS_DRV_FreeHistRdBufferVPSS_DRV_IsWrongIntVPSS_DRV_GetChnScaleFactorsVPSS_DRV_CheckGrpParamVPSS_DRV_CheckPreScaleVPSS_DRV_CheckChnSpParamVPSS_DRV_CheckChnNrParamVPSS_DRV_GetChnSpCapaVPSS_DRV_CheckChnCapSelVPSS_DRV_CheckChnFrameWorkVPSS_DRV_CheckGrpAttrVPSS_DRV_MallocHistRdBufferVPSS_DRV_RequestIrqVPSS_DRV_MallocModelBufe] 3})g9I[oVPSS_DRV_GetChnScaleCapa?@;?( HH ;U /b #q        @: y o d Y L @$33 hh \t Q G} <{ 2w (s n i c \ T LD:1''WyVoUfT]RSPKMBI 9E 1A  )< "6 1 * $    ! A:  !    { t n g `YR L E ?9!3'-- {vqk#e(`-Z1U6P;K@EE%%!( , 0 3 7 ; ? C~ B : G{JwNsRoVjZg_bbQQOSMU KW IY G[E]C_A~a!?|c#={e%;yg'9wi)7vk+5tm-3ro/1pp1&.59;95.& &.59;95/' &.49;95/' %.49;:5/' %-49;:5/' %-49;:5/( $-38;:60($-38;:60($,38;:60(#,38;:60)#,38;:60)",28::60)"+28::61)"+27::71*!+27::71* !+27::71* !*17::71*!BttB @ C:ruD >quF<ovG:nwI9lxJ7kyL5izN3hzO1f{Q/e|R-c}T+b~U)`~W'_Y!&]Z"$\\$  "}&y)u-r1n5j9f=bA^EZIVMQQ89:;:y:q9i7b6Z3 D: R0J-C* ;&4! ,%%ui]RF;0%|vnf)]5T?JJJJ$;X$-g% v%%%$#"!|qeY! K0>> -?KOK?- ->J E:OK?. ,>JOK@. +=JOK@/ +=IOL@0 *<IOLA0 *<IOLA1 );HOLB1 (;HNLB2 (:HNMC2 ':GNMC3 &9GNMC4 &9GNMD4!%8FNMD5!%7FNME5"$7FNME6##6ENNE6#+EW^WE+*DW^XE,)CV^XF,(CV^XG- 'BU^YH. &AU^YH/ %@U^YI0 %@T^ZJ1 $?T^ZJ2 #>S]ZK3 "=S][L3!<R][L4 <R][M5;Q]\M6:P]\N79P]\O88O\\O8&KfqfK&%JfqgL'#IeqhM("HeqhN)!FdqiO+ EcqjP,DcqjQ- CbqkR. BaqkS/ A`plT1  F:@`plU2 ?_pmV3>^pmW4<]pnX5;\onY7:\onZ89[oo[9!.9ACA9.! .9ACA:/! -9@CA:/"-8@CA:/"-8@CA:0#,8@CA;0#,7@CA;0#+7?CB;1$+7?CB;1$+6?CB<1% *6?CB<2% *6>CB<2& )5>CB<3& )5>CB=3& (5>CB=3' (4=CB=4' (4=BB=4( LL @X 4e )r      | t k c W LA4))mkmckxYhOgEe <a 3] +X "T M  G: G A:1*",~+v+n)g'`&Y$R KD>82 ,&!88 ,F S b p       t g Z L > //    |wso!k$f'b+^.Z2U5Q9M=IAEENNCY8f.s$ ztne^TJ? 3''MMBX8d/p&}| H: x smf^VLB7+jNjaNtWN~NMFJ=I5F-C%?:5. *"  <<1I'Ucq xlaUI :,,p3pg3x_3X1P/I-B*;'4#.("  \dlu~xndZOE9.#  "/?Pcwt^H0s{}umd[SJA8/% ng_XQJC<5.( I:! scalemodeVPSS_HAL_SetChnSpCfgVPSS_HAL_SetChnSclCoeffVPSS_HAL_SetChnSclCfgVPSS_HAL_SetNrThrAddrVPSS_HAL_SetGammaAddrVPSS_HAL_SetIeThrAddrVPSS_HAL_SetChnPicAddrVPSS_HAL_SetChnColorVPSS_HAL_SetChnFrameWorkVPSS_HAL_SetChnCropVPSS_HAL_SetChnImgSizeVPSS_HAL_GetNextInfoVPSS_HAL_GetDbgInfoVPSS_HAL_GetIntStatusVPSS_HAL_GetNodeIDVPSS_HAL_SetOutstandingVPSS_HAL_ClrIntVPSS_HAL_StartVPSS_COMM_HalNodeProcVPSS_COMM_HalListIntVPSS_COMM_IrqProcVPSS_COMM_SubmitOneNodeVPSS_COMM_CreateOneNodeVPSS_COMM_DevInit -------------------------VPSS GRP ATTR----------------------------------- %8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s GrpIDMaxWMaxHPixFmtDieModeDrEnDbEnIeEnNrEnHistEnFeildautonodiedie--semi422semi420BOTHBOTTOMTOP%8d%8d%8d%8s%8s%8d%8d%8d%8d%8d%8s -----------------------VPSS GRP FRAME CONTROL INFO------------------------- %8s%8s%8s%8s%12s%12s bFilterWidthHeightSrcFRateDstFRate%8d%8d%8d%8d%12d%12d -------------------------VPSS GRP PARAM----------------------------------- %8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s LumContDarkBrightIeStrIeSharpSfStrTfStrMotionDiStrChrmRgNrWSfWinDisMode%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d -------------------------VPSS CHN PARAM--------------------------------- %8s%8s%8s%8s%8s ChnIDChnSpChnSfChnTf%8d%8d%8d%8d%8d -----------------------VPSS GRP PRESCALE INFO------------------------- %8s%8s%8s%8s%8s%8s bPreSclCapSeltotdeOFFON%8d%8s%8s%8d%8d%8d -------------------------VPSS CHN ATTR----------------------------------- %8s%10s%8s%8s%8s%8s%8s%8s%8s GrpIdPhyChnIdEnableSpEnFrmWkEnLWRWTWBW%8d%8d%8d%8d%8d%8d%8d%8d%8d %8d%8d%8d%8s%8s%8s%8s%8s%8s - -------------------------VPSS EXT-CHN ATTR----------------------------------- GrpId ExtChnIdSrcC J:hnSrcfrcDstfrcpix -------------------------VPSS CROP INFO----------------------------------- %8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s CropEnCoorTpCoorXCoorYOriWOriHTrimWidTrimHgtABSRIT%8d%8d%8s%8d%8d%8d%8d%8s%8d%8d%8d%8d -------------------------VPSS GRP PIC QUEUE------------------------- FreeLenBusyLenDelayBackup -----------------------VPSS GRP WORK STATUS------------------------- %8s%16s%8s%12s%16s%8s%8s%16s%8s%8s%8s%8s%10s RecvPicViLostVdecLostNewDoOldDoNewUnDoOldUnDoNoHistStartFlbStartCostTmMaxCostTm%8d%16d%8d%12d%16d%8d%8d%16d%8d%8d%8d%8d%10d -----------------------VPSS CHN WORK STATUS------------------------- %8s%8s%12s%8s%16s%12s%12s%12s WorkModeDepthSendOkbConfidentbDoubleUSERAUTO%8d%8d%12s%8d%16d%12d%12s%12d ----------------------VPSS CHN OUTPUT RESOLUTION----------------------- pixfmt%8d%8d%8d%8d%8d%8d -----------------------TIMER WORK STATUS------------------------- %14s%14s%14s%14s%14s%14s CntPerSecMaxCntPerSecMostCostTmCostTmPerSecMCostTmPerSec%14d%14d%14d%14d%14d%14d [Func]:%s [Line]:%d [Info]:[grp%d}:vpss only support bind to VPSS user mode chn! GrpId error! Ext ChnId is error! Null pointer!FUNCTION %s,LINE %d! Wrong Crop Config and noneffective! mode should between [%d,%d] which is %d! picture pix format should be semi420 or semi422 which is %d! arch has no trans capability GetTransChns failed Chn%d has no trans Capblility Width should between %d and %d! Height should between %d and %d! Width should be even! Height should be even! Delay should between [%d,%d] which is %d! s32ViFrmRate(%d) wrong,should be [1, VPSS_CHN_MAX_FPS] s32VpssFrmRate(%d) is wrong,should be [0, %d] bFilter should be 0 to 1 which is %d Filter Width should be 0 to %d which is %d Filter Height should be 0 to %d which is %d MaxH of group attribute can't be changed! u32MaxW of group attribute can't be changed! enPixFmt of group at K: tribute can't be changed! bCropEn should be 0 or 1 which is %d! Crop field enCapSel(%d) is illegal! Crop coordinate should be VPSS_CROP_RITIO_COOR or VPSS_CROP_ABS_COOR! Crop start ritioX should be 0 to 999 which is %d! Crop start ritioY should be 0 to 999 which is %d! Crop start ritio Width should be 0 to 1000 which is %d! Crop start ritio Height should be 0 to 1000 which is %d! Crop start absX should be 0 to maxW which is %d! Crop width should between %d and %d Crop height should between %d and %d Crop X should be 2 bytes align! Crop Y should be 2 bytes align! Crop Width should be 2 bytes align! Crop Height should be 2 bytes align! picture width should between [%d,%d] which is %d! picture Height should between [%d,%d] which is %d! diemode should between [%d,%d] which is %d! bDrEn should be 0 or 1 which is %d! bDbEn should be 0 or 1 which is %d! bIeEn should be 0 or 1 which is %d! bNrEn should be 0 or 1 which is %d! bHistEn should be 0 or 1 which is %d! bHistEn/NrEn/Die and Dr/Db can't be enabled at the same time! 422 image can't use Dr/Db! ChnId is error! [grp%d}:vpss unexist! chip can not support func: VPSS_GetChnField CapSel %d wrong grp %d: SetDelay error!! chip not support func: VPSS_GetPreScale chip not support func: VPSS_GetChnSpParam chip not support func: VPSS_GetChnNrParam ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vpss/vpss.c-1 != u32SrcFrmRate-1 != u32DstFrmRates32DiffTR >= 0HI_NULL != pstCtxpstCtx->pstCurPic == pstCurPicpstVideoFrame->stVFrame.u32Width <= 960prescale width wrong!! prescale height wrong!! HI_NULL != pu32StridepstCtx!=NULLprescale beyond dsu scale cap! vpss creat dsu bypass tsk fail! HI_SUCCESS == s32Ret get mmz name fail! get VB fail,for vpss grp %d DSU scale NULL != pstDsuTaskVpssGrp >=0 && VpssGrp < VPSS_MAX_GRP_NUM[grp%d}:dsu task fail! [grp%d}:vi timestamp err L:or! pstPicNode != HI_NULLchip not support func: VPSS_SetChnField chip not support func: VPSS_SetPreScale grp %d: SetGrpFrameRate error!! chip can not support func: VPSS_SetChnSpParam chip not support func: VPSS_SetChnNrParam VPSS Drv GetTransChns failed 0grp%d,chn%d:creat user list failed HI_NULL != pstCtx->pMadBufgrp %d must be stopped! HI_TRUE == CKFN_SYS_GetMmzName()VpssMallocDieBuffer get mmz name fail! Die bufmalloc vpss Die buffer fail! VpssMallocNrBuffer get mmz name fail! Ref&Mad bufmalloc vpss Ref&Mad buffer fail! remap buffer from mmz for vpss mad fail! [grp%d}:exist! [grp%d}:can't use sys module!check sys_module ko! [grp%d}:malloc vpss grp context fail! [grp%d}:creat picQueue fail! [grp%d}:creat Model fail! HI_NULL != CKFN_SYS_ENTRY()HI_NULL != CKFN_SYS_RegisterSender()HI_NULL != CKFN_SYS_RegisterReceiver()enDisMode should be %d to %d which is %d [VpssGrp%d,VpssChn:%d]:not bind! s32Ret != HI_FAILURE[VpssGrp%d]:no source picture! [VpssGrp%d]:no old picture! [VpssGrp%d,VpssChn:%d]:query fn pointer is null! [VpssGrp%d,VpssChn:%d]:query fail! [grp%d chn%d}QueryRlt not the same as full result! [grp%d chn%d}Not support transform format 420 to 422! [grp%d chn%d}Dest width(%d) beyond max width! [grp%d chn%d}Dest height(%d) beyond max height! [grp%d}:pic height(%d) is bigger than max height(%d)!! [grp%d}:pic width(%d) is bigger than max width(%d)!! [grp%d chn%d} has no scale cap! src reso(%dx%d), dst reso(%dx%d) [grp%d chn%d}ZOOMIN/ZOOMOUT error! [grp%d chn%d}dest addr null! [grp%d chn%d}cannot output during double trans! pstSelPic != HI_NULLVPSS Drv GetChnSpCapa failed VpssGrp%d, illegal DIE mode:%d GRP id %d! illegal modid:%d pstPic == pstCtx->pstCurPicHI_NULL != pstPic[grp%d]new/do but no current picture or old/do but no backup picture! pstCtx->pstCurPic == pstPicTmppstNodeHI_FAILURE != s32Retgrp %d is working ! [VpssGrp:%d,VpssChn:%d]:bind but pfn:Query o M : r Send is NULL [VpssGrp:%d,VpssChn:%d]:Get Bind error no free node left for this task ! GetHistBuff get mmz name fail! pstCtx->u32HistWrPhyAddr == 0[VpssGrp%d]:can't get hist buffer! pstCtx->u32HistWrPhyAddr != 0VPSS_UserSendFrameTimeout:Invalid VB [grp%d}:please start grp first!! [grp%d}:can't use sys,please check sys module! [grp%d}:getbindbysrc fail! [grp%d}:UserSend pic width(%d) is smaller than min width(%d)!! [grp%d}:pic height(%d) is smaller than min height(%d)!! [grp%d}:UserSend pic format(%d) is bigger than max format(%d)!! [grp%d}:vpss can only handle semi_planar image!! [grp%d}:send fail!! [grp%d] User send frame timeout [grp%d}:vpss queue is full,can't receive.!! [grp%d}:modid:%d illegal!! VPSS_UserSendFrame:Invalid VB [grp%d}:vpss grp is destroying!! [grp%d}: channel mode user or channel no bind! [grp%d}:vpss bDestroying! [grp%d}:send failure pic! [grp%d}:Not support modid:%d!! [grp%d}:pic width(%d) is smaller than min width(%d)!! [grp%d}:pic format(%d) is bigger than max format(%d)!! [grp%d}:no bind!! Filter Pic: Input Pic size is(%d,%d), Filter pic size is(%d,%d). timeref %d Vpss %d Timeref %d :lost this frame because of frame control. Picture Queue is full for vdec source! s32Ret==HI_SUCCESS[grp%d}:can't use dsu,please check dsu module! [grp%d}:Not support enDataType:%d!! [grp%d}:prescale size wrong!! pstDelayPicNode != HI_NULLHI_NULL != pstCurPicgrp%d,chn%d:first frame,kill it!!! HI_TRUE == pstCtx->bDoHI_NULL != pstCtx->pstCurPicbSpEn should be 0 or 1 which is %d! bFrameEn should be 0 or 1 which is %d! check stFrame param error! vpss<6>unload vpss.ko ....OK! [Func]:%s [Line]:%d [Info]:vpp CMPI_RegisterMod failed. <6>load vpss.ko ....OK! MPP vpss not init ! ERR IOCTL CMD 0x%x [VPSS] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:49] [Func]:%s [Line]:%d [Info]:GrpId error! Ext ChnId is error! Null pointer!FUNCTION %s,LINE %d! ChnId is error! [grp%d}:vpss N: unexist! Depth should be 0 to %d which is %d NULL point DSU_TASK_DATA_S NULL! Vpss Group%d invalid Vpss ext chn%d invalid [grp%d}:VpssCreateUserList failed [grp%d}:backup null! VPSS:VB invalid ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vpss/vpss_user.cHI_NULL != pstSendInfoHI_NULL != pstSendInfo->pstDestPicInfo[0]VPSS_DRV_GetTransChns failed! 0HI_NULL != pstPicNodeenDisMode should be %d to %d which is %d no bind and queue full HI_TRUE == CKFN_SYS_GetStride()HI_TRUE == CKFN_SYS_GetMmzName()VpssFakeQuery get mmz name fail! [grp%d}:get buffer fail! [grp%d}:get madmsehist buffer fail! HI_NULL != pstCtxVpss%d,chn%d:Only phy chn can get frame! Vpss%d,chn%d:Only in user mode can get frame! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vpss/vpss_drv.c0pSclCoeffSetpstHistBufInfo->pVirtAddr!=0[Func]:%s [Line]:%d [Info]:#########################IntStatus err![int:%d]] Null pointer!FUNCTION %s,LINE %d! Invalid Chn Num%d u32IeStrength should be 0 to 8 which is %d u32IeSharp should be 0 to 100 which is %d u32DiStrength should be 0 to 7 which is %d bPreScale should be 0 to 1 which is %d enCapSel should be VPSS_CAPSEL_TOP to VPSS_CAPSEL_BOTH which is %d prescale u32Width(%d) is bigger than max u32Width(%d)!! prescale u32Height(%d) is bigger than max u32Height(%d)!! Prescale u32Width should be 32 to 1920 which is %d Prescale u32Width should be even %d Prescale u32Height should be 32 to 1080 which is %d u32LumaGain should be 0 to 128 which is %d u32SfStrength should be 0 to 16 which is %d u32TfStrength should be 0 to 16 which is %d Only bstr/lstr does surport chn feild!!Wrong chnid is %d CapSel should be VPSS_CAPSEL_TOP to VPSS_CAPSEL_BOTH which is %d FrameWidth[%d] should between 0x0 and 0xE which is 0x%x! FrameWidth[%d] shoul O:d be even which is %d! picture width should between [%d,%d] which is %d! picture Height should between [%d,%d] which is %d! picture pix format should be semi420 or semi422 which is %d! diemode should between [%d,%d] which is %d! bIeEn should be 0 or 1 which is %d! bNrEn should be 0 or 1 which is %d! bHistEn should be 0 or 1 which is %d! bDrEn should be 0 or 1 which is %d! bDbEn should be 0 or 1 which is %d! HI_TRUE == CKFN_SYS_GetMmzName()VPSS_DRV_MallocHistRdBuffer get mmz name fail! HistRd bufmalloc vpss hist buffer fail! remap buffer from mmz for vpss mad fail! VPSS0VPSS0 failed request irq VPSS_DRV_MallocModelBuf get mmz name fail! model bufmalloc buffer from mmz for vpss model fail! remap buffer from mmz for vpss model fail! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vpss/vpss_hal.c0MULTI_OF_2_POWER(pstSclcoeff->u32HlSclCoeffAddr, 16)MULTI_OF_2_POWER(pstSclcoeff->u32VlSclCoeffAddr, 16)MULTI_OF_2_POWER(pstSclcoeff->u32HchSclCoeffAddr, 16)MULTI_OF_2_POWER(pstSclcoeff->u32VchSclCoeffAddr, 16)MULTI_OF_2_POWER(u32NrThrAddr,16)MULTI_OF_2_POWER(u32GammaAddr,16)MULTI_OF_2_POWER(u32IeThrAddr,16)HI_NULL != pVpss vpss:%d pVpss->VPSS_PNEXT:%#x u32NextPhyAddr:%#x -------------------------DRV WORK STATUS----------------------------------- %16s%12s%16s%12s%12s%12s%12s%12s%12s StartSuc0StartSuc1LinkIntNodeIntStartErr0NodeIdErr0StartErr1NodeIdErr1BusErr%16d%12d%16d%12d%12d%12d%12d%12d%12d -------------------------DRV NODE QUEUE----------------------------------- %8s%8s%8s%8s%8s%8s%8s%8s FreeNumWaitNumBusy00Busy01Sel0Busy10Busy11Sel1%8d%8d%8d%8d%8d%8d%8d%8d -----------------------INT WORK STATUS------------------------- %14s%14s%14s%14s%14s%14s CntPerSecMaxCntPerSecCostTmMostCostTmCostTmPerSecMCostTmPerSec%14d%14d%14d%14d%14d%14d ASSERT failed at: >Fi P?: le name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/common/vpss/vpss_comm.cHI_NULL != pstNodeHI_NULL != pstCurNode[Func]:%s [Line]:%d [Info]:Vpss:%d should be %d but actual %d HI_NULL != pNodestOut.node_num != 0vpss crop over max node num! vpss hal can't get free node! VPSS1 failed create queue sclcoeffsetmalloc buffer for vpss sclcoeffset fail! remap for vpss sclcoeffset fail! IOremap for vpss regbase fail! version=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=scalemode:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 ht$ *: |8;K;#N;D;4 <6!<7<'N<e=P3=dl>Ѿ>>b>J>>oV> >` >fG > >>5>> >J!>=o>>? >OW>>><>>>>!>j">P#>$>I&>ȓ'>](>&*>o+>b,>.>H/>֐0>k1>3>f4>x5>6>:8>9>:> <>O=>>>9?>oA>_aB>C>hD>+F>WnG>H>,I>-5K>vL>]M>N>u:P>{Q>wR>S>c;U>zV>;W>?X>7Z>yv[>\>]>N0_>m`>۪a>b>Y$d>`e>ǜf>g>'i>rOj>zk>?l>m>9o>sp>q>+r>_ t>QYu>v>nw>y>:z>+r{>|>}>>'>M€>]]>L>>->Wȃ>b>>?>L1>8ˆ>e>>?>1>ʉ>&d>4>">.>nj>.`>>퐎>)>0>"Y>>>= >> O>A>Z}>S>.>A>ؖ>o>g>>1>Ǚ>]>}>&>>>mI>ޝ>s>>z>22>Ơ>I[>>胢> >>?>Ӥ>og>>p>!>>H>ۨ>m>>W>%>I>J>ܬ>n>>>i$> >G>ذ>?j>n>>t>M> ?>ϴ>-`>>߀>>!>1>>P>U>o>G>>>ᬼ> Q*:;>ʽ>Y>+>v>+>>!>ݯ>=>>Y>L>t>`>>>4>D7>:>Q>>yj>>s>>>"(>'>@>>W>3>n>>g>>>&>>[<> >Q>>|f>>z>>>>>S,>>`?>>R>3>Gd>A>"v>>>,>> !>S>1>>A>}>IQ>>`>>o>>~>%>*>>> >I>->F>:>> G>>S>>^>h>i>~>t>3>j>>>~>U>>>K!>¥>"*>j>2>>:>>qB>+>I>Z>P>+>qW>>]>>c>p>*i>>,7?gx???;?|?߽?????q?9?B??M??wE??t??DG???(?^H????H?È???zH?L?? ?G ?% ? ?P ?E ?O ? ?" ?|C ?ʂ ? ?F ?t@ ? ? ? ?< ?{ ? ? ?a8?.w???V3?q???-?l???D'?e?գ??= ?b^?{???V?z?`?<? N?Ӌ??B?D????";?x??a?0?n?D?{?%?b????V??? ?yJ?B???_=?z??#?/?l???N!?]??%?Y?N????>?z???t. ?Gj ? ? ?!?0Y!?Ҕ!?j!? "?~G"?"?l"?"?45#?p#?ի#?#?Q"$?]$?$?$?%?I%?߄%?ֿ%?%?5&?p&?S&?&? '?['?:'?'?v (?F(?(? (?~(?/)?Jj)?)?)?8*?tS*?*?*?+? <+?v+?!+?+?$,?],?ݗ,?,? -?KE-? -?-?h-? ,.?e.?4.?.?:/?K/?/?/?/?,10?uj0?0?0?1?@O1?\1?p1?{1?}32?wl2?g2?O2?.3?P3?҈3?3?S3?34?k4?S4?4?}5?N5?5?5?i5?/6?+h6?6?6?7?II7?{7?7?7?)8?a8?8?8? 9?A9?y9?9?o9?;!:?X:?:?m:?;?7;?So;?;?m;??+?>?Qv>?n>?>???R??????q??U.@?1e@?@?@? A?O@A?wA?A?PA?B?}QB?B?B?B?x+C?aC?EC?C?D?=;D?qD?D?D?E?;JE?UE?hE?sE?w"F?rXF?eF?QF?4F?0G?eG?G?tG?1H?X? rX?hX?X? Y?Z?Y?rY?إY? Y?: Z?`?Z?rZ?Z?Z? [?>[?q[?[?[?y \?X=\?1p\?\?\?]?N;]?n]?]?Z]?^?8^?(k^?^?9^?_?/5_?g_? _?k_?_?1`?jc`?`?`?+`?^,a?^a?a?a?a?&b?Yb?b?b?b? c?Rc?c?c?\c?)d?Kd?}d?id?d?e?lDe? ve?e?3e? f?A84D8TI8O8ރU8"I[8fa8f8l80^r8r#x8}8ց88<8~8}a8D8&8\ 88Λ8:8ٓ8xv8Y8;8S888,Ƶ8ʨ8g8n8P8>388w888K88e8H8*8T 888#88Xz8\8?8%"88W8d9D9G9ݸ9)*9u9 9 ~ 9Y 9` 99;C99%99h9y99I\99>9)9t! 9!9 #9Su$9%9W'91(9{:*9ū+9-9X.9/9p19429}S4959679Y89:9;93<9|l>9?9 OA9UB91D9E9-G9uH9I9hK9ML9JN9ܻO9#-Q9kR9T9U9@V9cX9Y9F[9[\9(^9_9/ a9u|b9c9_e9Hf9Ah9Բi9$k9_l9n9wo90p9uZr9s9=u9Ev9x9ϐy9{9Xs|9}9U9c959ԁ9y9F99_9p9(9E9癇9R9* 9É9m|9599R9^996Ў9׈9yA999\k9#9ܓ9?9M99"9w9c0999EZ99˛9'9<9h99f9H9נ99)I99i9 s9+9I9霦9U9(9ƨ9h9899F9a99%ӭ9ċ9cD999An9&9߲99P9\ 99z99399v9]99Rκ99?9-9̰9ji9"9ڿ9E9K999u9[.9995X99q99:9J99d9"99]9F9959p9p)9 99GS9 99}959W9 S<: 9_9.99g9B99<9k9u$999JN999x909W99Z9*99b9<9959f9l999?I99u9s9+9G99}U999N97999a9U999%D99Z9m9&9)9×9^P9|:`::c:u::J.:::1C:~::X:e::l:K:%::1:~::ʖ::dO:: :Id : : :/y :{ :1 : :` :F : :E :[ :޷ :*:wp::):[::=:?::R:$:p :g::S :|::75:::J:f::^:I::s:,:x,:Ĉ::[A:::=V::: k:k:#::M:8::/:zM:ũ::\b:: :=w : :/!:!:i!:D":":J":Y#:#:+$:vn$:$: '%:V%:%:;&:6&:&:P':':a (:e(:(:A):z):): 3*:k*:*:H+:J+:,:\,:),:s-:q-:-:R*.:.:.:1?/:{/:/:T0:Y0: 1:h1:71:!2:}2:2:_63:3:3:=K4:4:5:`5:d5:6:t6:A6:-7:Չ7:7:hB8:8:8:EW9:9:::!l::k::$;:;:G;:9<:ٕ<:#<:lN=:=:>:Hc>:>:?:#x?:m?:0@:@:H@:EA:ڡA:#A:lZB:B:C:GoC:C:'D:!D:jD::3l:S:rȫ::$:R:::1ݬ:Q :q9:g::í:: :/N:O|:n:خ::4:b: :,:K:k:I:w:ʥ:Ӱ: :(0:H^:g::::D:s:$:Cϲ:b:+:Y::൳:::>@:]n:|:ʴ::&:T::8:Wߵ:v :;:i:ԗ:Ŷ::1":PP:o~::ڷ::6: e:?0?d,?B?X?o?[???<Ȁ?ހ??A ?!?8?hN?d?@{??(??Ձ??&??N?e?+}??(?Ç?5ۇ??S ?!?9?Q?h?e???nLj?#߈???]&?$>?U?m??f?A? ͉????,?D?\?t????Ԋ????#5?DM?je?}?•??+Ƌ?eދ???/'?z??W?p?v?Ҡ?3?ь??n??U3?K?Md?|?V?᭍?qƍ?ߍ??8?(?}A?%Z?r??:??Վ?t?;? ?8?Q?j?]?>?#? Ώ????1?J?c?|???Ȑ?/?M?n?,?E?^? x?X??Ñ?ݑ?a??)?VB?[?u?r?ڧ?F?ڒ?,? ?#'?@?+Z?s?F?٦?r?ړ??U ?&?@?`Z?t?ԍ??Y?"۔???(?tB?S\?7v? ? ?Õ?ݕ???+?E?`?z?-?G?fȖ????1?CK?}e???F?Η??8??7?SR?l?'?? ?֘?? ?&?@?,[?u?\??ř?F???Y0?K?e??^?+?К???!?q?Z?bu???Sǝ?? ?n?4?CP?k?*??%?ٞ?2??S,?G?c?(?Κ?y?(ҟ?? ?S%?A?\?x?{?Q?,̠? ???;?W?s???ǡ????8?T?Cp?k??Ģ??>??5?R?_n?? ?kã?ߣ?7??5?Q?n???ä?)??X?5?R?Bo???Yť????h8?8U?r?莦?ǫ?Ȧ???v?o?\?:z???vӫ??? ?,?J?h?z?b?O¬?A?9?6?8:??X?Kv?]?t?Э?? ?+?4I?kg??磮?-®?x???y;?Y?>x???ӯ? ??/?M?(l??W?ǰ??F?#?B?ea?$?鞱??ܱ?W?2?9?W?v?Е?Ŵ?Ӳ???0?O?n??.?T̳?~? ?)?I?`h???Bƴ???T$?C?'c???? ?? ???J_?~??1?ݶ??J?=?\?|?c?7?ܷ???;?[?{???۸???;?[?|?;?h?ܹ???S=?]?}?>??޺?[??5@?`?&??-»??J?#?D?!e?ʅ?x?+Ǽ???h)?3J?k?؋??ͽ?|?h?Z0?RQ?Pr?S?\?kվ???8?Y? {??$h??+??O?7?a?;???h?12?\?ׅ????z-?uW?w????)?S?~?S???'?rQ?{?-???}%?O?z???@?$?O?Az????U%?-P? {????&?Q?|???0?Z)?T???J??,?MX?? ???1?]??L?? ?H7?c???W?.? >?i?????E?q??4?_?"?N? {?V???? ????!?'?,?2?7?=?C?H?N?S?Y?^?d?i?o?t?z?????????????????????????? ???? ?&?+?1?7?<?B?G?M?R?X?]?c?h?n?t?y?????????????????????????? ?????%?+?0?6?;?A?F?L?Q?W?\?b?h?m?s?x?~??????????????????????????????$?*?/?5?:?@?E?K?P?V?\?a?g?l?r?w?}?????????????????????????? ????#?)?.?4?9???D?J?P?U?[?`?f?k?q?v?|?????????????????????????? ????"?(?-?3?8?>?D?I?O?T?Z?_?e?j?p?v?{?????????????????????????? ????!?'?-?2?8?=?C?H?N?S?Y?^?d?j?o?u? W%:z?????????????????????????? ????!?&?,?1?7?<?B?G?M?R?X?^?c?i?n?t?y?????????????????????????? ???? ?%?+?0?6?;?A?G?L?R?W?]?b?h?m?s?x?~???????????????????????? ? ? ? ? ? ?$ ?* ?/ ?5 ?; ?@ ?F ?K ?Q ?V ?\ ?a ?g ?l ?r ?x ?} ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?$ ?) ?/ ?4 ?: ?? ?E ?J ?P ?U ?[ ?a ?f ?l ?q ?w ?| ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?# ?( ?. ?3 ?9 ?> ?D ?J ?O ?U ?Z ?` ?e ?k ?p ?v ?{ ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?" ?' ?- ?3 ?8 ?> ?C ?I ?N ?T ?Y ?_ ?d ?j ?p ?u ?{ ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?! ?' ?, ?2 ?7 ?= ?B ?H ?M ?S ?Y ?^ ?d ?i ?o ?t ?z ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?? ???? ?&?+?1?6?<?B?G?M?R?X?]?c?h?n?s?y?????????????????????????? ?????%?+?0?6?;?A?F?L?Q?W?\?b?h?m?s?x?~??????????????????????????????$?*?/?5?:?@?E?K?Q?V?\?a?g?l?r?w?}?????????????????????????? ????#?)?.?4?:???E?J?P?U?[?`?f?l?q?w?|???? X%:?????????????????????? ????#?(?.?3?9?>?D?I?O?U?Z?`?e?k?p?v?{?????????????????????????? ????"?'?-?2?8?>?C?I?N?T?Y?_?d?j?o?u?{?????????????????????????? ????!?'?,?2?7?=?B?H?M?S?Y?^?d?i?o?t?z?????????????????????????? ???? ?&?+?1?6?<?B?G?M?R?X?]?c?h?n?t?y?????????????????????????? ???? ?%?+?DD@@dd[}Yg[o!Di[3})   !"#%&'(*+,-/01245679:;<>?@ACDEFHIJKMNOPRSTUWXYZ\]^_abcdfghiklmnpqrsuvwxz{|} , = Obv    p Y0: \ I33*@Vlx,f@SS*@Vlx,f@SShi3521_vpssGNUz"8D@JHPpV]djqx PX`lt|0P\dl x '.5 < C Jd Q X _ f m t {  H 8 pt   ` L#P# P   p    8 &&  '$'L  ((  |  |)) ", )\ **07> E L S8Z`ahXo$v \<: }//0X T3355,70788899::;;==\>`>L??DAHABBhhDlDdFhF lHpHIIKKLLNN PPpQtQRRTTVVD%,tXX3YYZZ:[[A HO\\V<8]<]]dkdryT\b`bX@xdehhkk8mdi8WH`pV`hlU!:- 0B 8KRc`fTy|\LB,DD@ m PP  u\y50DTgS,zh,3P@8+D P!*;ЀKXX>(hUzx\;XPPx  2 HAx U3 e d%:A XNK D*V \n  T x)P 8$ lS0 `8 (Ep !Լ !<]$+!xB,;! 8L!4X!\Ids!8 !1!,:!B !!!70!8q""."$WL"X e"P  |"8Q<""ȉ@"0>(" "^" #: (#L=6#C#BT# j#h(#07##o #-0#[8#tQ#$ $4$/$0<<$F$S0_$?o$1z$4,$8$kt$5X$Xc$$$8($@g %XT % 03%| 0=%=XK%<tW%m%k %Y%h%%, %P]0%P%%T%&D$&5&H&O&!h&<*s&xt&&%&'&$'&&$&|wx''e@3'``I'@S,a'Pxu'HU'Z'''`P'30'  ''V( ( Z0#(1(dHD(L tW(h#p(}p((ĺ((غ(0(\`(0({ )@4)X.);)HW e0: S)Ph)>dv) 8)I)`L)Kl)Sx)09))Xs)\\*\A *,`6*dJ*(pc*$Bj* r*(+ {*o*W*`4*̃*,*0*@I +`b+lD.+6;+J+>@Q+p ,>t +? t +@ + ,@ , +A ,A ,? +B ,B +C + + +D t ,D ,C , , +E ,E0 t4 +F< ,F@ t + , +E ,E t +F ,F t + ,$ +=, ,=H tX +=` ,=| t += ,= t +G ,G +H t +I +J ,I ,J +K ,K ,H +L ,L+M ,M+N,N+O$,O(+P0,P4+Q<,Q@+RH,RLtT+SX+T\,S`,Td+Uh+Vl,Up,V+W,WHt\+Wh,Wt+W,Wt+W,WXtt+X|,Xt+Y,Yt+I,I+Z,Z+[,[t$+\(,\,+]4tD+^L,^P+JT+_X,J\,_l+`t,`x+a,a+b,b+c,c+d,d+e,e+f,ft+,,]+g+,g,P+\,+h,ht+i,i+j+k,j,kt+9+ ,9 , +l,l+m$,m,tPS\d+=l,=tS+=,=t+n,n+ot +p+ ,p, +q ,q$,o(+r4,r8+s@,sD+tL,tP+uX,u\+vd,vh+wp,wt+x|,x+y,y+z,z+{,{t+|,|\td+|l,|t+} ,}t +~$+ (,~,, 0+:4,:8+@+D+H,L,X+\+`,d,p+t+x,|,,t++,,+,t+F,Ft+ ,<tH`+d+l,p,tt+,t n):+F,Ft+, t0+4+<,@,DtH+L+T,X,\t`+Fh,Flt+,t+++,,, t++, ,$t(+F0,F4tt+x,t++,,t+,+, +,t$+,,0t<+D,HtT+X,`tt+@x+ |,@, +:,:+,t+F,Ft@D+FL,FPt+,t+F,Ft+,t+F,Ft,+0,HtP+FT,FXt+,t+F,Ft+,t+F,Ft+,,t4+F8,F<tX+\,tt|+F,Ft+,t+F,Ft+,t++,,+, ++,, +(,0tX+\,lt+,+,<+,<+,<+,<<+@,L<X+\,`<p+,<+,<+,<+, < P"+T",h"<t"+x",|"<"+","+",#<#+#, #<0#+@#,L#p#+t#,#+#,$< $+$,$<4$X$+\$,h$<x$+|$,$<$+$,$<$+$,$<$+$,$<%+ %,%<(%+,%,8%<D%+L%,X%<p%+t%,%<%+%,%<%+%,%<%+%,%<%+%,&<&+&,&<0&+4&,@&<L&+T&,\&< o<: x&+|&,&<&+&,&<&&+&,&<&+','< 't'+x','<'+','<'+','<'+','<'+(,(p(+t(,(<(+(,(<(+(,(<(+(,(<(+(,)<)+ ),()<@)+D),P)<\)+d),l)<|))+),)<*+*, *<$*+(*,4*<@*+D*,H*<`*+d*,p*<|*+*,*<*+*,*<*+*,*<*+*,*,+,,,<$,+(,,,,<D,+H,,T,<`,+d,,h,<,+,,,<,+,,,<,+,,,<,+,,,<,+-, -<-+ -,$-<<-+@-,L-<\-+d-,l-<-+-,-<-+-,-<-+-,-<-+-,-< .+.,.<,.+0.,4.<L.+P.,\.<l.+p.,t.<.+.,.<.+.,.<.+.,.<.+.,.</+/,0/+4/,@/<L/+P/,T/<l/+p/,|/</+/,/</+/,/</+/,/</0+0,0<0+0,0<0+0,1<1+1, 1<81+<1,H1<X1+\1,`1<x1+|1,1<1+1,1<1+1,1<1+1,1<1+1,2<2+2, 2<82+<2,H2<X2+\2,`2<x2+|2,2<2+2,2<2+2,2<2+2,2<3+3,3<,3+43,<3<T3+X3,d3<x3+3,3<3+3,3<3+3,3<34+4,(4{h4d4+4,4<4+4, p:4<4+4,4<4+4,4<4d 5+5,5<(5+,5,05<L5+P5,\5<h5+p5,x5<5+5,5<5+5,5<5d56+6,6{H6dd6+h6,t6<6+6,6<6+6,6<6+6,6<6+6,6< 7+7,7<7d,7\7+`7,l7<x7+|7,7<7+7,7{7d 8d$8+(8,48<D8+H8,L8<T8dp8+t8,8<8+8,8<8d88+8,8<8+8,9<9+9,,9{p9d9d9+9,9<9+9,9<9d9:+:,:< :+$:,(:<@:+D:,T:{:d:+:,:<:+:,:<:d:;+;,$;<0;+4;,8;<P;+T;,d;{;d;+;,;<;+;,;<;d; <+$<,0<<<<+@<,D<<\<+`<,p<{<d<+<,<<<+<,<<<d=4=+8=,H={x=d=+=,=<=+=,=<=+=,=<=+=,><>+ >,,><<>+@>,D><L>d\>>y>+>,>{>d>+?, ?<?+ ?,$?<@?+D?,P?<\?+`?,d?<?+?,?<?+?,?<?d??+?,@{(@L@h@d@+@,@<@+@,@<@+@,@<@+@,@<A+A,A<$A+(A,,A<4AdDAXA+\A,AvAt$B+(B,dB+lB,B+B,B<B+B,B<BB+B,B{>ԍ><3h3t33nЎ3܎\3\3\03<\X483Ld`+d,p<+k,k<d+,Ȑ<Ԑ+ܐ,<+,< +l$,l,<4dD+H,\<l+mp,mx<d+,+,+, (00+,<+mĒ,mȒ<ؒ+,+,(+,,T+X,h3xd+,+,+,+, +,+ ,x+|+,,+r,r++,,++,+ĔȔ+̔+Д,Ԕ, v:+s,s++,,+t ,t@+D,_̕ܕ+, v+,<+w,w <4`tȗ+̗,ؗ<+x,x< +,$<4+y8,y@<X+\,h<t+z|,z<+,<Ę+{Ș,{И<+,<+| ,|<,+0,<<H+P,X<h+l+p,t,+},}++,,+},}Й+ؙ,tĚ_+,<+,<,L7h777+,Ĝ<Ԝ+؜,<+,|+,<+,<ԝ+؝,<+,<+ , <,+8,\<+,<+,<Ȟ+̞,؞<+,<+ ,<(+0,<<P+T,`<p+x,<+,<+,̟<+,<+,<(+,,8<@+H,L<`+d,p<x+,<++,,+,++,Ġ,Р+}Ԡ,}ܠ+,<+Q ,Q<++, ,,+R0,R8<T+X,Сv \УRxvvt@X+\,h<t+x,|<++,,+R,R++,,+ĭ,̭Э+ԭ+ح,ܭ,+,+,<(+,,4<8+<+@,D,P+RT,R\l+p, w: |<+Q,Q<++,,+R,RЮ+Ԯ,$+(0,@+PD,P\A |+,<+,<0x$dx̵ $$`ķssȸԸ0lsLX@P+T+X,\,h+l,t+,<+,<++,Ļ,л+RԻ,Rܻ++,,+,+ +,, +$,,0+4+8,<,H+L,TX+\+`,d,p+t,|++,,+,++,,+ļ,̼м+,Gн3H$+,+P,Pо+Ծ,<+,<+ ,pg.ȿؿg4X'''+,X+,$D+L,' <\+`,l<|+,+<,+,<+,<+,< +,$<8+<,H<X+`,h<|+,<+,<+,<+,<+,<$+(,,<D+H,T<\+d,h<+,<+,<-+,<+ +$,(,4+8,@D+H+L,P,\+^`,^hl+p+t,x,+, x: +,{$$+(,vtd+,<+,<(+0,PqX|Yd+ ,<+ ,0<8dXx+,<+,<d$+,,XhqpYdd+,$<4+8,<<P`vpJV+,<+,<d+, <,+0,4<<dX+\,h<l+|,+,<+,+,<+, +,< +0,H+L,X<l+p,x<d+,<+,<+,<+ ,<d,dH+L,X<h+l,p<|d+,<+,<+,Yd<+@,P{|$+,(vld+ ,<$+(,,<hd+,<+,<d4\+`,l<t+x,<d v4JDVt+,<+,<dd+,<+,< +$,0<<+@,D<Ldh+l,x<|+,+,<+,+,<+, +$,0<<+D,L<h+l,x<+,<d+,<+,<d +,<,+0,4<<dP+T,h<t+|,<+,+,<+, y:<d+ ,+,<+,<+,<+,< +,<(+0,8<S0+4,@<L+T,\<p+t,<+,<+,<+,<+,(<8+<,D<\+`,l<p+,+,<+, <s,8P`vxJV+ ,<(+0,T<t+x,<+,<+,<+,<<\|+,<+,<4+,< +,<8+@,P<X+`,d<x+|,<+,<++,,+,+ ,0+4,+,<+,< +,<(+0,8<+,<+,<+,<+,8<d+h,t<+,<HS|+,<+,<+,<+,+, <+ ,(<L+P,\<l+t,<+,<+,<+,< +,<\+`,l<|+,<+,<+,<4TtsvtvJV(s<HPpvJVs++, ,+,$h+l,x<+,<+, z:<+,<4+,<+ ,(<+,<+,<+,<+,,<8+<,P<\+d,l<t+,++,,+,++,,+,$+,,0Xl+,+$,+,<,8hx+,<+,<+,$<4+8,D<l+,<+,<+,<+ ,<@`(4D4P`<$dt+,<+,<+,$<0+Q4,Q8<<+@+D,H,T+RX,R`p+t,<+Q,Q<++,,+R,R++,,+,++,,+, ++,,(+,,48+<+@,D,P+T,\l+p,|<+Q,Q<++,,+R,R +$,0<<+@,D<\+`,l<|+,<+,<+,<+,<+,<H.l+,<+,<+,<+,<+, {\|3vd+,<+, <8{Dd\+`, {: l<|+,<d+.,. +0,0T+.X,.h+0l,0+?,?y+9,9<+@,@<+9,9 <+C ,C$<b4t|Kfw C$'4j<HT`Ml&t,Z&1E$ PX*}ULu;  X d p "x  +. ,.  +. ,.  + , +0 ,0, +F0 ,F4 t@ L  }t t  7  +Z +[ ,Z ,[ <+\,\ <(+Z,+[0,Z4,[@<L+]P,]T<+,+Z,Z<+],]<+Z ,Z<$+^(,^,<H+ZL,ZX<d+_l,_t<+Z,Z<+`,`<+,L+ZP,Z\<h+]l,]p<+Z,Z<+^,^<+Z,Z<+c,c<+Z,Z$<4+`8,`<<L`+d,|s+Z,Z<+f,f<+,+Z,Z$<0+_8,_@<Pd+h,+Z,Z<+_,_<+,+Z ,Z,<8+f<,f@<L`+d,J+Z,Z<+_,_<+Z,Z$<(+q0,q<<L\t|}+Z,Z<+r,r<+Z,Z<+s,s<+,,SD+ZH,ZT<`+_h,_p<+,+Z,Z |:<+_,_<+ ,@ `+Zd,Zp<+z,z<+Z,Z<+_,_<V+Z ,Z,<8+_@,_H<X+,v  +Z$,Z0<@+`D,`H<h+Zl,Zx<+,<+Z,Z<+],]<+Z,Z< +_,_<,\$t+Z,Z<+,<+Z,Z<+_,_<(+,,+,4sHT_ls_vJThvtJ+Z,Z<+_,_< +$+(,,,8+<,DT+ZX,Zd<p+t,x<|++,,+,++,,+,+Z,Z<+,<++, ,+,$(+,+0,4,@+D,L\+Z`,Zl<x+|,<++,,+,++,,+,++,,+,++,,+, $P+T,+,d t   gT!!!!!g@"|"""+Z",Z"<"+","<### ##### #$#(#,#0#4#8#<#@#D#H#L#P#T#X#\#`#d#h#l#p#t#x#|#########+Z#,Z#<#+#,#<p$+Zt$,Z$<$+ }: $,$<$+Z$,Z$<$+$,$<%+Z%,Z%<%+_$%,_,%<H%+ZL%,ZX%<h%+l%,p%<%_%+%+%,%,%+%,%%+%+%,%,%+%,%%+Z%,Z&<&+&,&<&+ &+$&,(&,4&+8&,@&P&+ZT&,Z`&<l&+p&,t&<x&+|&+&,&,&+&,&&&+&,&+&_&''+'+ ',$',0'+4',<'@'h'_'+Z',Z'<'+_',_'<''+(,8(+Z<(,ZH(<L(+\(,d(<(+Z(,Z(<(+(,(<((+Z(,Z)<)+`),`)<0)sH)vT)`)l)_)+Z),Z)<)+]),])<)+Z),Z)<)+^),^)<*+Z*,Z(*<4*+_<*,_D*<T*+X*+\*,`*,l*+p*,x*|**_*+Z*,Z*<*+_*,_*<*.;l/;06163 5c5+5, 5Y45Y@5H5;X5d5Yp5;|5;555;55Y5;5;556;6$6Y06;<6;H6\6d6;x66Y6;6;666;66Y6; 8Y,86<8cP8`88888Y868c8Y996(9Y:::::::Y;;;6;\;d;+h;,p;+t;,;6;c;6;;YD=6X=d=h=+l=,|=+=,=(>YD>cP>l>cx>>@c@c@Y@c@6(Ac4Ac@AYXAc`A6pAcxA6AcAAcAA;AcAA ~ : 0BIB;BB6BBB+B,BcB+B,CcCY$CB0Cc0*8+lFtx |/-1\A:`AdAhAlApAVtACxA|ATATATAANAAAAAHANAAAAAHAA:AAAAQAA:AAAAQAA:AAABQk 0: hi3521_sio.ko9Y9Y9Y$W 3ELF(.4( -L -LP00S S00J00 -LP PJ  000 -L0 -L00@ -L@0S0"00 -L 3@ x-L@@@0SxPP@Px ``@R0``@S8PP@Qxtxt4 8!4! p-L M"FP\@% } \ IDl \ k \F2@U T} Q!@PKpk\ An\ \+.@U T} Q T} Q!@@P) \&|P\ l00m\  0 @0@! @J} \ -L M0@@S @ @2`*` K80 @Q0 @J -L M0@@S@@2 ||\*\ K80 @Ϡ0 @J$ -L MP@ @ @‚0`*` K80 @:0 @J8 -L MP@@00@ƒ ||0\*\ K80 @Ϡ0 @JL -L M0@@S@00@2 \\`+` K80 @!0 @J` -L MP@@00@ƒ \\0`+` K80 @0 @Jt 0-LM0P,@5R  <:0RK0l0 @ @00 @ @ 0-LM0@SS& S$  RRHQSV0CSlPR 0S A0R P0BSQ 0SK0 R} R  R R "R  R } R D R R 2 @ @JR 2 @0 @JP1@RH2 @0  @\PJ1 @ @J1 @0 @Jt1 @ @Jx41 @ @Jh0 @ @JX0 @ @JHt0 @0 @J700 @ 0 @x -L M0@SS S  RR@ RRS 0S^ B0QP0A{S Rd 0SpK R} R  R R "R  R } R D R R `2 @\ @JR R 2 @d0 @J1 @j0 @J1 @t 0 @JD1 @ @J1 @ 0 @J}0 @o0 @Jl|0 @y0 @J[80 @~0 ?: @JJ p-LMPP@@Tn T @@@A0S  P`{ ?`0` \  \  x``@\Ap  Ptx `t \0  \x | ``@RA  Pu /` 0\ \8``@QA0  P4 /` 41@\\8@AFile name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/audio/aio_hal.cAudioDevId < SIO_MAX_NUM0aio dev %d is invalid not support this mclk can not get the bclk_division ratio not support this bclk_division ratio not support this fsclk_division ratio invalid sio workmode:%d SIO_HDMI only support AIO_MODE_I2S_MASTER workmode and clksel of AO should equal to that of AI, when in same SIO SIODevSetAttr err workmode and clksel of AI should equal to that of AO, when in same SIO ,hi3521_sioA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4" E`)"% U8#X4 V(C &: #$Z$$(V 4VPd,$xl%uD&F2&(+X V ,$ W0-0-p0-/_--2p   u%%03 0 Y΃ u%%3  Y> u%%03 0 Y΃ u%%3  Y> u%%03 0 Y΃ u%%3  Y> u%%03 0 Y΃ u%% 3  Y> u%% 03 0 Y΃ u%% 3  Y> u%% 03 0 Y΃ u%% 3  Y> u%%03 0 Y΃ u%%3  Y> u%%Bp q -LM0Q@pR0S1 @-Π0 @ @@JKAoPNOO Q@P  0 D0 @0 @ @@J 0-LMd@Rp 02K080 @ @ J -LM@@@ `lP0` @, 4K( (K4@ 00P 3/pP bP!(0P$K|0 @ @D0 @ @ 0J2 -L80B8P 84P 4  -L,M @p4K0,0 4 (K@P)@e0eepł 5Ņ 5Ņ%ee=P-@0P X@$ 0`uPH◦,`PVXV 0Pw.P0V΃X0`P` V뗦"V>X8}P4@P ,\ 0``@PuP`.V.,0S4@P 4,Q 0``@PuPn"V>,\8@H4@P&  ! 1 @40  @0 @3N@40 @@8@J44,P 0``@Pu Pb#V΃,Q@0 @#40 @ @8@J -LMPP@Js `0` 4` 0K( YI Pv00S ( P`P `YpSZ/ ( P^0Qj ( P` R `pY:p `(PD00SP ( P`P( `pY!( P.00S: ( P`PX4 KPq4Q X @P ?(KX4 KP^4^ &: X @P ,1 @ @p1 @ @X4 KP04^m X @Pg  ``0 @qP @P@p@@ 0PX4 KP 4\^ X @PX X0 @ @@@ 0@@@@  -L|MP0p00 9 @0 @J(K"8 ` bA@ PO^# 0S  8PP@5Y"A\@8 H Q,NP@8 D Q,NP@ 8 L Q,NP@8X Y,NP@8P P"0AS@80%` 00@^ A\@8\ 9 A\@8h 0!őL^@8 d > A\ @8 p 9.@Q @8 l 0.A\ @8 t < NQ @8 x 9,@^ @8| 0,NQ@8 >#%@BTP 7 @ @@屃  @0  T ,PE p @p8 0 ȕ `V`P)  J<  Z< R   Z@,0S`p0K@ P< @  P0P3@PP0^)@TT @ P @9 !@%8H0P*D@T X*TY(mL‐ XQ.` \&͈ Y,PX Y!∐ `Y) ` \Y)8 \ hY)< 嘐h dY)@ 8d pY)D <p lY) &:H @l tY)L Dt xY)P Hx |Y"L]P|P ]‐P PℐP PXP P∐XP ]∐ `P` \\ hh dd pp ll tt xx || 匐⌐ 吐␐ 倐E@儐E@XE@刐E@`E@\E@h5E@EE5E5E5E5EE5EEEEE5EEd@8Ep@<El@@Et@DEx@HE|@LE@85EE<5EE@5EED5EEH5EEL5EEP@5EEEP@TE5EE5EEE 1 @?Π0 @@@@0 @0 @@ J00S T !@X0 @Ϡ00 @JT0!T!( -LMbd3"0 PU(KPPu@@@0 㜥刅w, 0 圥0   圥0   圥0   圥0   圥0   圥0   圥0   圥 0   圥 0   圥 0   圥 0   圥 0   圥`  0 圥 p0 刅 PP00 P<40 @2 0 @P,8 -LMpP`JQ  (XH PN`PD PX@  3: =Z ( P?`Q '@ P(P3` R P@X"( P&`0SX @P @@ 0@@@@X @PP@X$KX @P @@ 0@D -LM " 0,pSP @`$`@㴠 P` `  PM`@P5SX%R OKh pW,p#XQ %u0 h p 40 p5\v, Vp0Sc P 7 @ Ⰰ  X&*Y  X*   X:^ Kh  K0 6 0  K0l  $p7/0,phP. h KK괠W ``@ȅPj$ p`PR@XŔ \q"PO, R@(K@@ 1@@@@L -L,M "4 00@0 ƒ4:S !(K00!꼅, R* 4`@pEP$`, pM `R@DPYXUPUTUUDUO6PI5pD<0@ `XM, @R <PPI , R 4``@@Ua%`R=PXŕ@\Ou  , =RXeP`4 @  @ 0 00 !4 ń @ 0 @@8 l 2/K, R 4`00@6 UN@PMR@UD0NQ  0: pHWdK H eD   R(h D Dy 8H s4 W0 ` H0 6/H0`P Q , ( Dh+^} ^9( (R%RPR"Q?l2 @0 @, (2 @ 0 @, 1 @pp(0 @, 1 @}0 @, {, 4`V**Rn:P L<1p Lp @rp 0 @, ^D 4 03/PD H D , L0 @``40 @, <V  (LpP0` L` @```1r`p 0 @, \l -L\M`@@ᬃ@pp@ppp@ppp@ ppp@,ppp@ @ @00@@@@@(@@ @@$@0@@@ 8 0S , R @P@@Dp <@ @H P=R@XĔ̤u@80H  p$R 0@ uW%5p4 p@ W@ppX@ X@Ŕ} Q0 @%  Q@ Q@ Q@ "Q@  Q@ } Q@ D Q@ < Q^@ ^@ ^@ ^@ ^@ @^40@Pp , =@RuDp H+ZpX(K@~ p-L`00@AhP<`  1  p -L00@ -L`@0!H0 -L M00@40 @ @J -L4MP@@@@ @ @00@@@@@ @@@@H0SJ ,0SM00@$ } R R@! R@ R@ "fR@ }R@ } R@ D R@ R@ ( R@0 @pRD``@<4@ p `8@00@^J $1Sn00@!} R  R@! R@ R@ "R@ mR@ } R@ D| R@ R@  *: !RZ@(!8qRFile name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/ai.cHI_SUCCESS == s32Retaidev%d is not supported ai chnid %d is invalid NULL != pstAioChnNULL != pstAioDevno aichn %d for aidev %d, or can't handle right channels for stereo mode ERR!!! Ai dev %d chn%d invalid addr:0x%x AI dev %d not enable The depth (%d) of user frame buf should less than 30! aodev%d is not supported enable aec fail,samplerate:%d enable aec fail,sound mode:%d enable aec fail,Aidev%d don't have chn%d enable aec fail,frame len:%d enable aec fail,bit width:%d ai chn(%d,%d) not enable ai chn(%d,%d) have enble aec already,but the attributes not the same as before enable AI chn(%d,%d) ok AI chn %d state is not enable or pause the user frame depth is 0, please set it first AI chn not enabled busy list empty AI(%d,%d) state:%d Error ai cmd [Func]:%s [Line]:%d [Info]:AI dev %d is busy, disable it first AudioDevId%d not inited AudioDevId%d not configed must disable AudioDevId%d when config dev attr Vb pool haven't been created!   : get mmz name fail! Init vb pool failed! claculate dma buffer size fail! alloc dma buf err ioremap dma buff failed AIDMAaidev%d is not supported aidev%d is not initialized aidev%d is not configed AI dev %d enable ok! Get user cnt of the audio frame failed! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/ai_trans.cHI_SUCCESS == s32RetGet user cnt of the audio RefFrame failed! Func: %s, line: %d, s32Ret: 0x%x, i: %d, u32PoolId[0]: %d, u32PhyAddr[0]:0x%x, u32Uid: %d. Vb user count of the audio frame is 0, it maybe has been released! AiDev %d AiChn %d not disabled, must disable all chn before disable AI device AI dev %d disable abnormal! Someone(%d) occupies aidev%d's vb %d! AI dev %d disable ok! AI dev %d exit failed! err 0x%x! NULL != pstNodeAI chn %d get vb failed! AI dev:%d seperate channel data from dma buffer failed! AO has no export functions! ao samplerate(%d) is not 8K or 11K ao point num invalid:%d ao bitwidth invalid:%d ao chn for aec invalid,chn:%d AI chn %d get aec vb failed! AI chn %d get aec frame failed! [AI] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time: [May 4 2014, 19:31:46] -----AI CHN STATUS------------------------------------------------------------------------------------------------------- %5s%8s%8s%8s%8s%12s%9s%9s%8s%12s%8s%8s%8s%8s%10s AiDevAiChnStateReadWriteBufFulu32Data0u32Data1AecAoAecFailbAnrbResmpPoiNumSampRResmpType%5d%8d%8s%8d%8d%12uenable%9x%9x 0 0disable8kHZ11kHZ12kHZ16kHZ22kHZ24kHZ32kHZ44.1kHZ48kHZ1X22X11X44X11X66X1 (%2d,%2d)%12u%8s%8s%8d%8s%10s [Func]:%s [Line]:%d [Info]:AiClrCfg fail, sio mode may not insmod aidev:%d, read & write buf conflict! Cur DMA addr:%x, pinpon buf index:%d ! AI not init(DMA Buffer is NULL) bitwidth error -----AI DEV ATTR--------------------------------------------------------------- : ------------------------------------------ %5s%8s%8s%8s%8s%8s%8s%8s%8s%8s AiDevWorkModSampRBitWidChnCntClkSelSondModPoiNumExFlagFrmNumi2s_mas8kHZ8bitmono%5d%8s%8s%8s%8d%8d%8s%8d%8d%8d stereo16bit32bit11kHZ12kHZ16kHZ22kHZ24kHZ32kHZ44.1kHZ48kHZi2s_slapcm0_slpcm1_slpcm0_mtpcm1_mt -----AI DEV STATUS------------------------------------------------------------------------------------------------------- %5s%12s%8s%12s%8s%8s%8s%8s%12s%10s%10s%10s%7s%10s IntCntFrmTimeMaxFrmTimeDMAChnDMAReqTranLenIsrTimeMaxIsrTimeDMAPhy0DMAPhy1CurDMAPhyPinPonErrCnt%5d%12u%8d%12d%8d%8d%8d%8d%12d%10x%10x%10x%7d%10d start dmalli failed AI_DRV_ISR fail, aio module may not insmod AI Dev%d Int Status : 0x%x, cnt:%d DMA chn id:%d not fit ! now not support this mode,chncnt:%d,bitwidth:%d aichn:%d, index:%d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/arch/include/ai_drv.h0AiDev=%d, AI_DRV_DisableDev fail, sio mode may not insmod /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/audio/ai_drv.cAiDev=%d, disable ai rx fail! AudioDevId:%d Get DmaChn fail ! dmac_register_isr failed Dma page num set to %d, len:%d alloc dmalli_space failed build dmalli failed build dmalli failed, dma addr:0x%x, requester:%d AiDev=%d, AI_DRV_EnableDev fail, sio mode may not insmod AiDev=%d, clear ai fifo fail! AiDev=%d, enable ai rx fail! AiSetDevAttr fail, sio mode may not insmod $$hi3521_ai :GNU^; n=?adA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4~ (4)H~0% 08x~4 $C$K4T2g, c 0 sLo  }$y  $HHpH/wwp      )<,7AhP0[ `,cn `s{ # :  $ L 8 l `(  @ `T ``  `   h `  ``$(   0 L l   `d ` $ * 0 6 `  `# #< `%`BQ`o ~, <P`p     %61` F Sh [l( h ` `x,%0`%&[$ n@ `&&& h `((`++ `<-D- `--  `..`,/0/p  @ T `11x    `55 <    : h  `99 $   `CC*0 `XG`G`IIIT `LL70 6d  <   T 4 t `$S0S      `        " ( . 4 : @, F L R4 XP ^X d` jh pp vx |         < `W`       ! 0( ?8 ND]Ll\ {l `$ `0W[ 7xn  `YY l `ee  < D L T \ d l t |  $ *  6 0  <    L  :        ( "0 8 D (L T ` .h $ , 4 < D   p n   `$o(o(oL 4 `pp@ `,r0r` R, Xt ^ d `Pududuj pD v `\w`w | ( @ F   t   `||: `~`xx   @+ 74@CtRap   B\`  ` `  , @`L``B`x\x#o!`   @hh90 $ &4eD0L|(^iu0r : 4Wx0P.PC* 7A&Kq0T0S_o%(|h`w(\ |W, * ; 0E W m <x     X  T'< %( 5 Y   $ 7 J P W 0a xo   8  0/      < `W% (d1 PB N ] pTj |  $v<    p WL   \( +P5 K `GS L8a -j mdy D-      1$aai_openai_closeAI_Notify.LANCHOR0AI_QueryState.LANCHOR1AI_GetVerMagicAI_ModExit.LC0$dAI_ModInit.LC1AiIoctlai_ioctlai_poll.LC2.LANCHOR2.LC3.LC5.LC4.LC6.LC7.LC8.LC10.LC9.LC11.LC12.LC14.LC13.LC16.LC15.LC22.LC24.LC20.LC17.LC18.LC19.LC21.LC23.LC25.LC28.LC26.LC27.LC30.LC29.LC31__func__.25162__func__.25133__func__.25011__func__.24737__func__.24711__func__.24989__func__.24943__func__.24788__func__.24756__func__.24634__func__.24501__func__.24849__func__.24564__f : unc__.25062__mod_version998__mod_license997__mod_author996s_s32AiStateai_fopss_stAiModules_stExportFuncss_stUserRefg_AIumapdAIGetFrmVbBlkAISendChnData.LC34.LC33.LC32.LC36.LC35.LC37.LC38.LC39.LC45.LC48.LC51.LC54.LC40.LC41.LC42.LC44.LC47.LC50.LC53.LC43.LC46.LC49.LC52.LC55.LC75.LC57.LC69.LC56.LC58.LC60.LC61.LC62.LC63.LC64.LC65.LC66.LC67.LC68.LC70.LC71.LC72.LC73.LC74.LC76.LC59__func__.24154__func__.23887__func__.23864__func__.23851__func__.23827__func__.23771__func__.23914__func__.23535__func__.23994__func__.24092__func__.23500__func__.23587__func__.23673__func__.23440__key.24065__key.23921AIDMAStartAI_DRV_ISRAIDMARelease__func__.24149__func__.23950__func__.23780__func__.23555__func__.23983__func__.24035C.314.23637C.316.23643C.317.23648__func__.23603__func__.22596__func__.23750__func__.23433__func__.23415__func__.23717__func__.23692__param_str_dma_cir_lli__param_str_use_tasklet__mod_dma_cir_llitype59__mod_use_tasklettype56dma_cir_lli__param_dma_cir_lli__param_use_taskletuse_tasklets_pfDmaCallback__mod_srcversion23__module_depends__mod_vermagic5AIDisableChnAUDIO_FB_GetBusydmac_start_llim2pparam_ops_uintVB_InquirePoolUserCntAiDisableDevCMPI_RegisterMod__this_moduleAIEnableChnsnprintf__arm_ioremapAI_DRV_ProcShowAI_InitAI_DRV_SetDevAttrVB_UserAddfinish_wait__iounmapAI_DRV_DmaBufInfoInitupAI_DEV_ClrAttrcleanup_moduleAUDIO_FB_PutFreeprepare_to_waitmemcpyCMPI_MmzMallocCMPI_UserCopyAIDmaBufExitkfreeAI_DEV_Exitdo_gettimeofdayAIDisableAec__wake_upAiClrAttrAIDMAIsrAIProcShowCMPI_RemoveProcAI_GetDevCtxAUDIO_FB_GetFreeinit_moduleVB_UserSubCMPI_CreateProcdmac_channelstartscheduleg_astModulesVB_GetBlkByPoolIdAI_DRV_EnableDevAIEnableAecAI_DRV_DevDeInitVB_CreatePooldmac_buildllim2pg_stAiDevfree_dmalli_spaceallocate_dmalli_spaceAIGetFrame__aeabi_idivdmac_channelcloseAISetChnAnrInfoAISetChnParamAIDetectBufConflicttasklet_initAiGetDevAttrAI_GetChnCtxAISubVbAI_DRV_GetChnDat :aAUDIO_FB_InitAiGetDMAChn__tasklet_scheduleCMPI_UnRegisterModpanicprintkg_stAiChnAIGetChnParamdmac_register_isrVB_IsBlkValidAUDIO_FB_Release__memzeroAIDmaBufInit__aeabi_uidivHI_LOG__init_waitqueue_headAUDIO_FB_QueryBusyNumCMPI_MmzFreeAIReleaseFrameAI_DRV_SetDmaISRAI_DEV_InitAUDIO_FB_PutBusyAIGetPoolIdVB_Handle2KernAIDMATaskletAISetChnResmpInfoseq_printfAI_DRV_DisableDevdown_interruptibleVB_Handle2PoolIddmac_channel_freeAUDIO_FB_QueryFreeNumAI_DRV_SetDmaBufAddrautoremove_wake_functiong_stAiDrvDevAI_ExitAiSetDevAttrCMPI_UnRegisterDeviceAIAddVbAIDmaCallbackAIVbInitAI_DRV_DevInitAIVbFreemsleep__kmallocVB_DestroyPoolVB_Handle2PhysCMPI_RegisterDeviceAiEnableDev (+ ,, H+ L, + , +,+,,X+ , Ll+,++,,+ ,(+,,4<+D,L\+`+d,h,t+,+++,,,+,$+(,4D+"H,"Lh+l,x+#,#++,,+$,$(+,,8H+#L,#P`+d+h,l,x+'|,' + , $ +"( ,", H +L ,X h +#l ,#p  + + , , +$ ,$   $ +( ,4 D +"H ,"P h +l ,x  +# ,#  + + , , +$ ,$   + ,4 T     8 ` | + ,  +. ,.   + ,  + , 0 +"4 ,"8 P h   :+ ,  +# ,#  + ,  +/ ,/ DX4Xt+,+","4+8,DT+2X,2\dl+,+#,#+,+3,3 +$,0@+/D,/L\+`+d,h,t+$x,$++,,+','4P+T,`p+#t,#x+,+3,3++,,+$,$++,,+',' $hx+,+8 ,80+4,@P+"T,"Xp+,+9,9$+(,4D+:H,:Pl+p,|+;,;+,+#,# +$,0@+<D,<Hd+h,t+=,=+,+>,>+,+?,? 0+4+8,<,H+$L,$TX+\+`,d,p+'t,'|,Td+h,p|+B,B+,$4+B8,B@Tp+,+B,B$+(,4D+"H,"L`p+t,+3,3+,+#,#+, +/$,/,<+@+D,H,T+$X,$`d+h : +l,p,|+','+,4l+t,<LTx+, +" ,"$@+D,P\+E`,Edl+,+#,#+,+3,3 +$,0@+FD,FH\l+p,|+/,/+,+G,G  + , 8 +H< ,HD T +X +\ ,` ,l +$p ,$x  + ,  +I ,I     !@!d!x!!!!!!" "<"+@",L"\"+"`","d""+",""+#",#""+"+",","+$",$""+"+",","+'",'###+ #, P#+ `#, ##H$+L$,X$d$+Nh$,Nl$$$$% %<%H%T%\%h%t%|%%%%%+l%,l%(&L&\&t&+ox&+p|&,o&,p&&+q&,q&&&&'('4''''+o(,o ((+u (,u$(,(H(+oL(,oX(h(+vl(,vp(x(((((+(,(+l((,l)0)`)))) *P****+@+p++++0,+o4,,o@,P,+vT,,v\,x,,,,,+o-,o --+{ -,{(-0-<-@-h--+o-,o--+~-,~----+-,@.`.+od. :,op.|.+.,..+o.,o..+.,...//,/@/+D/,l/x/+|/,//00,0+o00,o<0D0+L0,P0d0+oh0,ot00+0,00+o0,o00+0,00+o0,o00+0,1111D1+oH1,oT1d1+h1,p111+l1,l2<222+l2,l3,3X3h3x333+l3,l333 4+l4,l04L4X44+o4,o44+4,44+o4,o44+4,445 5 5+l$5,lD5d5+oh5,ot55+5,555555(6d6666$7H7l77777+o7,o88+8,848+o88,oD8P8+T8,X8p888+8,8+8,88+8+8,8,8 909L9+oP9,o\9h9+l9,p9|9+9+9,9,9+9,999+o9,o99+9,:4:d:+lh:,lL;+lP;,l<<+o<,o<<+<,<=X=`=|========>>H>h>>>BB+oB,oBB+B,BBB C+oC,oC,C+0C,8ChCxC+o|C,oCC+C,CCCD(D+l0D,l\DDDDE4E`EEEEF,u+?0u,>4u,?@u+@Du,@LuPuTuXu\u`upu+0tu,0|u+u,uuuuvv8v+v+Ev,>v,Ev+@v,@vw+ w,w(w+F,w,F0w+@4w8w+>Dw,EPw,@Xw\wtw+|w,ww+w,ww+0w,0xx4x`x|xxx+x,Dy+Hy,TyXy+I`y,Ipyy+y,yy+Jy,Jyyy+y, z$z+(z,4z@z+KDz,KHzPz+Tz,Xz+L\z,Lhzz+z,zz+Mz,Mzzz+z,z{+N{,N { {0{D{+H{,T{X{+M`{,Mh{{+{,{{+K{,K{{+L{,L{{+{,{{+O{,O{+@{{+>|+E|,>|,E|,@|,|+0|,<|L|+PP|,PT|+@X|\|+>`|+Ed|,>h|,Et|,@|||+|,||+Q|,Q|+@||+>|+E|,>|,E|,@||||}+},}+ },4}@}}+},}}+T},T~~+ ,$,++,, + (, ,8+<+@,D,H\h+l,p+,   : $08ltx|   !: pinmux_hi3521_2X1080P.sh9Y'X8Y%#pin select muxctrl_reg0 himm 0x200f0000 0x00000000 #VIU0_CLK / GPIO12_0 / / muxctrl_reg0 himm 0x200f0004 0x00000000 #VIU0_VS / GPIO12_2 / VIU0_CLKA / muxctrl_reg1 himm 0x200f0008 0x00000000 #VIU0_HS / GPIO12_3 / UART2_RXD / muxctrl_reg2 himm 0x200f000c 0x00000000 #VIU0_DAT15/ GPIO0_0 / / muxctrl_reg3 himm 0x200f0010 0x00000000 #VIU0_DAT14/ GPIO0_1 / / muxctrl_reg4 himm 0x200f0014 0x00000000 #VIU0_DAT13/ GPIO0_2 / / muxctrl_reg5 himm 0x200f0018 0x00000000 #VIU0_DAT12/ GPIO0_3 / / muxctrl_reg6 himm 0x200f001c 0x00000000 #VIU0_DAT11/ GPIO0_4 / / muxctrl_reg7 himm 0x200f0020 0x00000000 #VIU0_DAT10/ GPIO0_5 / / muxctrl_reg8 himm 0x200f0024 0x00000000 #VIU0_DAT9 / GPIO0_6 / / muxctrl_reg9 himm 0x200f0028 0x00000000 #VIU0_DAT8 / GPIO0_7 / / muxctrl_reg10 himm 0x200f002c 0x00000000 #VIU0_DAT7 / GPIO1_0 / / muxctrl_reg11 himm 0x200f0030 0x00000000 #VIU0_DAT6 / GPIO1_1 / / muxctrl_reg12 himm 0x200f0034 0x00000000 #VIU0_DAT5 / GPIO1_2 / / muxctrl_reg13 himm 0x200f0038 0x00000000 #VIU0_DAT4 / GPIO1_3 / / muxctrl_reg14 himm 0x200f003c 0x00000000 #VIU0_DAT3 / GPIO1_4 / / muxctrl_reg15 himm 0x200f0040 0x00000000 #VIU0_DAT2 / GPIO1_5 / / muxctrl_reg16 himm 0x200f0044 0x00000000 #VIU0_DAT1 / GPIO1_6 / / muxctrl_reg17 himm 0x200f0048 0x00000000 #VIU0_DAT0 / GPIO1_7 / / muxctrl_reg18 #VIU1 muxctrl_reg19 himm 0x200f004c 0x00000000 #VIU1_CLK / GPIO12_1 / / muxctrl_reg19 himm 0x200f0050 0x00000000 #VIU1_VS / GPIO12_4 / VIU1_CLKA / muxctrl_reg20 himm 0x200f0054 0x00000000 #VIU1_HS / GPIO12_5 / UART2_TXD / muxctrl_reg21 himm 0x200f0058 0x00000000 #VIU1_DAT15/ GPIO2_0 / / muxctrl_reg22 himm 0x200f005c 0x00000000 #VIU1_DAT14/ GPIO2_1 / / muxctrl_reg23 himm 0x200f0060 0x00000000 #VIU1_DAT13/ GPIO2_2 / / muxctrl_reg24 himm 0x200f0064 0x00000000 #VIU1_DAT12/ GPIO2_3 / *: / muxctrl_reg25 himm 0x200f0068 0x00000000 #VIU1_DAT11/ GPIO2_4 / / muxctrl_reg26 himm 0x200f006c 0x00000000 #VIU1_DAT10/ GPIO2_5 / / muxctrl_reg27 himm 0x200f0070 0x00000000 #VIU1_DAT9 / GPIO2_6 / / muxctrl_reg28 himm 0x200f0074 0x00000000 #VIU1_DAT8 / GPIO2_7 / / muxctrl_reg29 himm 0x200f0078 0x00000000 #VIU1_DAT7 / GPIO3_0 / / muxctrl_reg30 himm 0x200f007c 0x00000000 #VIU1_DAT6 / GPIO3_1 / / muxctrl_reg31 himm 0x200f0080 0x00000000 #VIU1_DAT5 / GPIO3_2 / / muxctrl_reg32 himm 0x200f0084 0x00000000 #VIU1_DAT4 / GPIO3_3 / / muxctrl_reg33 himm 0x200f0088 0x00000000 #VIU1_DAT3 / GPIO3_4 / / muxctrl_reg34 himm 0x200f008c 0x00000000 #VIU1_DAT2 / GPIO3_5 / / muxctrl_reg35 himm 0x200f0090 0x00000000 #VIU1_DAT1 / GPIO3_6 / / muxctrl_reg36 himm 0x200f0094 0x00000000 #VIU1_DAT0 / GPIO3_7 / / muxctrl_reg37 #VOU1120_CLK internal sync himm 0x200f0098 0x00000001 #GPIO12_6 / VOU1120_CLK / LCD_CLK / muxctrl_reg38 himm 0x200f009c 0x00000001 #GPIO4_0 / VOU1120_DAT15/ UART3_TXD / muxctrl_reg39 himm 0x200f00a0 0x00000001 #GPIO4_1 / VOU1120_DAT14/ LCD_DATA_G1 / muxctrl_reg40 himm 0x200f00a4 0x00000001 #GPIO4_2 / VOU1120_DAT13/ LCD_DATA_G2 / muxctrl_reg41 himm 0x200f00a8 0x00000001 #GPIO4_3 / VOU1120_DAT12/ LCD_DATA_G3 / muxctrl_reg42 himm 0x200f00ac 0x00000001 #GPIO4_4 / VOU1120_DAT11/ LCD_DATA_G4 / muxctrl_reg43 himm 0x200f00b0 0x00000001 #GPIO4_5 / VOU1120_DAT10/ LCD_DATA_G5 / muxctrl_reg44 himm 0x200f00b4 0x00000001 #GPIO4_6 / VOU1120_DAT9 / LCD_DATA_G6 / muxctrl_reg45 himm 0x200f00b8 0x00000001 #GPIO4_7 / VOU1120_DAT8 / LCD_DATA_G7 / muxctrl_reg46 himm 0x200f00bc 0x00000001 #GPIO5_0 / VOU1120_DAT7 / LCD_DATA_B0 / muxctrl_reg47 himm 0x200f00c0 0x00000001 #GPIO5_1 / VOU1120_DAT6 / LCD_DATA_B1 / muxctrl_reg48 himm 0x200f00c4 0x00000001 #GPIO5_2 / VOU1120_DAT5 / LCD_DATA_B2 / muxctrl_reg49 himm 0x200f00c8 0x00000001 #GPIO5_3 / VOU1120_DAT4 / LCD_DATA_B3 / m):uxctrl_reg50 himm 0x200f00cc 0x00000001 #GPIO5_4 / VOU1120_DAT3 / LCD_DATA_B4 / muxctrl_reg51 himm 0x200f00d0 0x00000001 #GPIO5_5 / VOU1120_DAT2 / LCD_DATA_B5 / muxctrl_reg52 himm 0x200f00d4 0x00000001 #GPIO5_6 / VOU1120_DAT1 / LCD_DATA_B6 / muxctrl_reg53 himm 0x200f00d8 0x00000001 #GPIO5_7 / VOU1120_DAT0 / LCD_DATA_B7 / muxctrl_reg54 #VGA himm 0x200f00dc 0x00000002 #GPIO13_0 / VOU1120_HS / VGA_HS / muxctrl_reg55 himm 0x200f00e0 0x00000002 #GPIO13_1 / VOU1120_VS / VGA_VS / muxctrl_reg56 #BT656 himm 0x200f00e4 0x00000001 #GPIO12_7 / VOU656_CLK / reserved / SDIO_CCLK_OUT / muxctrl_reg57 himm 0x200f00e8 0x00000001 #GPIO6_0 / VOU656_DAT7 / LCD_DATA_R0 / SDIO_CARD_POWER_EN / muxctrl_reg58 himm 0x200f00ec 0x00000001 #GPIO6_1 / VOU656_DAT6 / LCD_DATA_R1 / SDIO_CARD_DETECT / muxctrl_reg59 himm 0x200f00f0 0x00000001 #GPIO6_2 / VOU656_DAT5 / LCD_DATA_R2 / SDIO_CWPR / muxctrl_reg60 himm 0x200f00f4 0x00000001 #GPIO6_3 / VOU656_DAT4 / LCD_DATA_R3 / SDIO_CCMD / muxctrl_reg61 himm 0x200f00f8 0x00000001 #GPIO6_4 / VOU656_DAT3 / LCD_DATA_R4 / SDIO_CDATA3 / muxctrl_reg62 himm 0x200f00fc 0x00000001 #GPIO6_5 / VOU656_DAT2 / LCD_DATA_R5 / SDIO_CDATA2 / muxctrl_reg63 himm 0x200f0100 0x00000001 #GPIO6_6 / VOU656_DAT1 / LCD_DATA_R6 / SDIO_CDATA1 / muxctrl_reg64 himm 0x200f0104 0x00000001 #GPIO6_7 / VOU656_DAT0 / LCD_DATA_R7 / SDIO_CDATA0 / muxctrl_reg65 #SIO0 himm 0x200f0108 0x00000001 #GPIO7_0 / SIO0_RCLK / muxctrl_reg66 himm 0x200f010c 0x00000001 #GPIO7_1 / SIO0_RFS / muxctrl_reg67 himm 0x200f0110 0x00000001 #GPIO7_2 / SIO0_DIN / muxctrl_reg68 #SIO1 himm 0x200f0114 0x00000001 #GPIO7_3 / SIO1_RCLK / muxctrl_reg69 himm 0x200f0118 0x00000001 #GPIO7_4 / SIO1_RFS / muxctrl_reg70 himm 0x200f011C 0x00000001 #GPIO7_5 / SIO1_DIN / muxctrl_reg71 #SIO2 himm 0x200f0120 0x00000001 #GPIO7_6 / SIO2_XCLK / muxctrl_reg72 himm 0x200f0124 0x00000001 #GPIO7_7 / SIO2_XFS / muxctrl_reg73 himm 0x200f0128 0x00000001 #GPIO8_0 / SIO2_R<: CLK / muxctrl_reg74 himm 0x200f012c 0x00000001 #GPIO8_1 / SIO2_RFS / muxctrl_reg75 himm 0x200f0130 0x00000001 #GPIO8_2 / SIO2_DIN / muxctrl_reg76 #SPI himm 0x200f0134 0x00000001 #GPIO8_3 / SPI_SCLK / muxctrl_reg77 himm 0x200f0138 0x00000001 #GPIO8_4 / SPI_SDO / muxctrl_reg78 himm 0x200f013c 0x00000001 #GPIO8_5 / SPI_SDI / muxctrl_reg79 himm 0x200f0140 0x00000001 #GPIO8_6 / SPI_CSN0 / muxctrl_reg80 #himm 0x200f0144 0x00000000 #SPI_CSN3 / NF_BOOT_PIN4 / CLK_TEST_OUT0/1/2/3 #I2C #himm 0x200f0148 0x00000001 #GPIO13_2 / I2C_SDA / muxctrl_reg82 #himm 0x200f014c 0x00000001 #GPIO13_3 / I2C_SCL / muxctrl_reg83 #HDMI pinmux -uboot #himm 0x200f01cc 0x00000001 #GPIO11_4 / HDMI_HOTPLUG/ muxctrl_reg115 #himm 0x200f01d0 0x00000001 #GPIO11_5 / HDMI_CEC / muxctrl_reg116 #himm 0x200f01d4 0x00000001 #GPIO11_6 / HDMI_SDA / muxctrl_reg117 #himm 0x200f01d8 0x00000001 #GPIO11_7 / HDMI_SCL / muxctrl_reg118 &:hi3521_tde.ko9Y9Y9Y0ELF(T4( -L 00@  -L00@ @! -L00@ -L@b00@b @@ -L0 @@@0Q L !@ x-L@` PP@ 00 0@!S ,`@@ xPxH$@@x x-L@@@P`@0S03/ 0 C A !x8$0@ -L M@@ P,Pt 0 @0@@K 0 @0@@ 0 @0@@ 0 @0@@ 0 @0@@ 0 @0@@ 0 @0@@ 0 @0@@ 0 @0@@ 0 @0@@ -LM``@ PK0 0S   @  L LRe gF fFF@  ,@1a L RS P J0 0 @@@ 0@!p @0 *U e T00< @A3@Q @0 d TPp0 2Q K  @ 00K @0 0SG  C LQPR!J؀Ap 0@ S xDt  0 @0@PU@DZ 0 SC\ \L!L^؀ 0p@N P񟗓0  h @  x  0 @0@PU@DZ  0 @0@PU?:@DZ  0 @0@PU@DZ  0 @0@PU@DZ  0 @0@PU@DZ  0 @0@PU@DrZ  0 @0@PU@DeZ  0 @0@PU@DXZu  0 @0@PU@DKZh@ p @P0 p  0 @0@ 0@DC0 NTY   (K  0 @0@  0 @0@  0 @0@  0 @0@  0 @0@  0 @0@  0 @0@  0 @0@  0 @0@0000  @ p-L,M P?P0  003S <@K P@`P5@P7@`P!@PKp<K@PU  @0@@8`@8@``@  @00@@` p-LM4H0DQ >  DQ a4P1DQ H Q 40HQ `DQ 0?03^OK.P>K;.K :>K07^KP<2KP P @PvDQV ND Q& b TPDQ  @D Q 40DQ^ @K# #PPY ?003P PNTPDQ {DQ T QDQl D Q; ]? 03\ROK PT40$ d@H@P"TPDQ 40DQ DQ T<:PDQ @K# #PP 40DQ DQT ]_OKp$Q  QP(DQ TD04 tP @K#  =? P#0P3UM PGPRK P =?P0P3UROK P0D04 Ht@@Px ?0@03PRK@ PK Q,<1$  @P^ =? 03\RK 0P00H@P=,0L 0J0@ P@`|JȌP GH Y}3r:GJ{ Y~l}G⃏=pGW }2~ep@ PJϠw @` xTp9@0P0 @@ @@ @@ @0 -LMP\ QM 0 @@S@0 3=R4; R4 R- @ ` Px@$p,X @ ` Px@$`|\p@P`(@t |`p`@X$pdpj@ @ P@0JK4@Xj4o@X`P4_@XPP0 @@ @'͠@ @@ @0 -LMP Q& p0@WP`pqp)xtpBPj08 @Px0JKP0 @@ @@ @@ @0Π -LMPv R h0Q@>A p`Ppā`l P` xPP |ppQ:`V`:\;Q;pWp<`V`<\ = R =jJh0G 0 0@*Q Q K  \lPpP `Pp\:`V`: `P xp \lP `P t``P0 @@ @@ @@ @0  -LMP Q P@ 80j45P@P80;h> ?H?@@8@T@0=x= RpqP ` A#0h` P(K RPpq `P S R@!qw 0 g 8P 0S @ *\ 0S *0S :p`P S Q@Qu 0 e 0 >0 P $0S@  *Z 0SŌ*0SɎ:$i Rpq P` S QHPP@QuB 0 e 0 90 P9 $0S@  *Z 00:SŌ*0SΉ:$! R0pq^pPqW` F0pqW`>RpqW R4 ` 4$؊0 RpP̠ 0P ``$0$0 R؊p P 0`P  `P 0 @@ @q@ @@ @L0 @@ @(0kΠ @@ @0{ -L4MPJ (0@,p`SSL ,P0DP 4H @ @<@ 0P8P 4 0 -P@H@JKL@pxDP@0zH@||8P@40<{0 PH,X%KNF 0}*(0P,p4@(KJEK@@ 0 @@H -LMP+ Q6 @0R( 00p8,`: P<< >@j (P@P@0 J `0 p0Pl8@ 0JKP0 @@ @@ @@ @0\ -LMP Q RR   KP0 @@ @@ @@ @0t -LMP Q) 0 (@00p8,`: P<< >@j (P@PJ0 KP0 @@ @@ @@ @0 p-L M`PP@ Q" R TT , 0 0 0 *Kp5P0 @@ @@ @@ @0 -LMPB QM P0(@U0 8,:< `< >P@P0pW@p؊PP@P PJ p(`P@0J $KJ p$Pp@0؊P|@ P %: Ap@JP0 @@ @L@ @@ @0M 0-LMP "00 @c0 PS2Q Pa0A0SE0A23Q0+S ,K0@@ 0 @4@ -LMPt @0\HPQ0  c4Q5Q Q0 0 0  0 0  0@  &: ,00  +000;  0:  09 046 ! '0  G % 0 S 4 #Q a40 Q5>Q0  c4Q 5Q #Q% 0 S 41 Q a40 Q50Q0  c4Q A5Q Q!6 0h #WH @@P !1 CCX `\@ EK@`pPL\p `(Kl R0t S@ # % dS0 4à0S c4à S5 Q  b40S 0A53Q0S1600 1^0  $K00S  4 ^ 0   0 00   0 0   0@ 00 0 0  ,0 0  0ˠ 0*0 0  0 @08 t50K6K8 !-Yz @@ @41>=$"@=x t0xw"0@x x t0l"x0@x|0 x | x|a"0@xfP0 @@ @:@ @@ @0; x-L@@@ P0*0`v ` 8  00x@0* -L M@P Q t @0R <<@0 0 F*ı  0 0*K@@ 0 3: @@$ 0-LMP@PQ% R Ϡ !Bd0.K0|0 @@ @@ @@ @00 @@ @ 0\8 -L@Pp 000 -LMPPpV `00@ @T< `   0 0 0"%0 c S1 A2,Q!  b0S< Ό A1Q0+S 00@`PK$@P x@G.@@ L0 @f@  $ 0@@L -LMP Q R ``@ 00pP  PPPUi @  B  c ! 2 000 0 0  0 0 @ T0 0 0  0 0 0 P -  A 0B0(Kp 00@^( BdJ @P'dJ0 @@ @@ @@ @X0H.,@ @@ @0 &,@` -LMPPp`6Q+ R 1!@P @P.K? Re.0 @@ @@ @@ @P0 @@ @,0,0@<\t -LM@Qp4 `V*PP@ 0p P ):  6 KQ 0 pPP@ R\"p @0S@@ x0 @@T+@PP@0+@0@+p -LM@@@ P$0<P@H0pKTl`$ K ` P,` 0*$0 0 03/lQ K03/`K -L@Mp`P K\PK@ @@@T @0 @ `P `P@0 @ `PtT P`Pn@0 @$,`Pb$ `P\@0 @08`PP0 `PJ@0 @<D`P>@@@< `P6@0 @HP`P*LH H`P$@0 @T\`P T PP P 00HȂ80`O $0<HT?\<  ,D!<HT`lx -L MPZ QK  0(P80@,:<R<@>  `p`0PU*؊@0H`@p0L P08 0(K P$`0pPPpj`p؊PTPPP0 @@ @@ @@ @0 -LPPP"P#P$P,P 0-LP@T ggggP0P0P 0P0 0P0 <:P0P0P0P00 -L@P`PhhhhPhXhh pPhhhhPhhhppppPEUPEU  -L@P Ti\ilitiTiZZ @Q 4@ HXȠX @Q-@0S-dJ @Q @[ @P t@} 00@^ D@ (@f  L @ x-L@`P PZ T 0S4S:0SC SXPS`V: x R@H!R  R@0SWxH^@0S `@2 x @QFdJx@\ @ x@0S @ dJx@0S @ x@ R |@$ x@^ L@, x0@ x@ dJx -LPQ`P@@@Q0(@/0S@#0P#@ 0 R@#0\9.@0Q0t@#0ST@#0P#,@ 0 R @/$0p\#@%0Q0@#0S@/P#x@0 RX@#0\8#@0Q 0 /@@ p-L$MPQ`P @@@QKp0@g#0S @w#00  000P y#D@ R $#@00 0X -LP Q#  R- P @\00@P, dJ @Q*dJ@0S)dJ @Q @)dJ00@\ h@)dJH)@00)@@)dJp -LP- Q?  R/ P@@T00@\@< @P< @d@J@0S@d@J 0e)@@d@J@0S)@d@J@@T @`)@d@J: @Q h@_)@d@JHw)0@,m)@@^)@d@J -LMP @ Q R S \ T `$VrPP@a0`VlVplW````` D`V8HY5P`V V: VD V< (Kp`W$X0$Z QP0_ P0P IP 0 '&#ȁX000000P\ @0Sr r30  s 3 0  s 3 0q030@0S@ dJ @P @<(@P @(0 @@ @Π@ @@ @0 @@ @0 @@ @h0 @@ @D0 @@ @ 0@(Q -L M`P@P Q R p!W00 GR0S00@ pGW pj 2 bQ `flzhw 2wpZ%p$p23@22)TTTAx~0t@f!v`~rPWd̕<d*1 c .JmF3C `F0LA L,à0#à 8ă|p(KOㆂC! 1f!1^a!d@<.H@ ",0 0.$s 8 ,|ph |p @Q@g%@P @ %t0 @@ @@ @@ @(0 @@ @0JΠ -L p0SC$Q0^ x`00|0  pP5 0")x0x`D 0\|  V|`H`p \ `|` x` 00 0,  S`X P T` h H  \ h L l hK p  p`t` `d \ tp`0 h` D @ 0S ;hK `@> Ri@@T4 <@!@d@J.@@@\' @"@d@J!fx0 SG@@@\ @!@d@J` ^ ㌐ 刐 ,0K\#0  #@\^ @Xd  0 `P @d@J R0XxK@@T@d@J<| P@ : R @!@d@J@ R% d@"@d@J@ 0ZZ4ʡ0  0Q= @@@^ #@@d@J@@T @#@d@J  00@\ l@#@d@JZ+, @@T P#@@d@J 0 0Q @0S @@#d@J@#@d@J @0S #@@d@JH!@0@!@d@J+!@L -LM0 0K M K -LDMQR@`pdJ# lPK0K0@ K\!?0K= Kl 0U* 1p!4< 0pATKhhpA l @B@b PaQ#t %*@0S~@d@J hl08@l$ %0l$ %0ll 0hl 0@ @Q #@@d@Jn@#@d@Jfp0 9h|@(40 \ PL@(<HT0 ! !QW @ RJ t;@)<0P) `\)XP@d0PP{%@zV10 @@@Q! t4(@] @ R t!, @ -LMP@`PU RQ! p0).VXd `` 0@ 0K`  b P]Ppp0 d0p p0Pp -LMQR`P0@p00 40 @d@J(KVX 4 pK 4 K P 0P @ Z Y 00 . 0    RvQf00@H\ H1S  0 P HT  0@P @d@Jg   0 Q  R: R $ %0 @! pK\3 $l0 X 0\0 T 0@ D H0 p (0P0 ,h L 0d0  ` 0Y! T\# 0P P ( , 0 |P 0P  x0 P  嘀 t0  L RR@PU@d@JP 0C,@d@J)K  4KP U2 .0K0KU/ K-KY_ DHP HPE~ RY`40PS p3SQ 00@@T @d@J T0 7  01@@@PU !@P05S S0<0 H  <K8P |@p P   0@~PHUPE~@ R@d@Jn <@&@d@Jf`0PS p3SQP 5SS< 0<0  @\@d@JB 0@&@d@J90)"@Z0 <K 8P 4@& @d@J$@ R( @!@d@JM@0S @!@d@J@@@T &"@Z@d@J2K  @@T H@!@d@J @0S @!@d@JX t -LQMK\`KlpK|KP@K⌠KLA @`p|KH IK(q 伐KpK, @(( (X 0 4 `0 P< p8 D ,@ T0@ \ l | , $ ' \Q&PP@``00`|VZ : ^0S  R\@!H!R !H\  P P$ H^*  4b PbQ@@T@d@J L 0 C(KD R|H0SyvHL0|K K`P @d@J|K0K 4K@P  K @KS? K=K0T CR00'Np( n\l @@T!@d@J"@ R @d@J&@Q l'@(1 LKH0  0`W P 0 SS$ %0H\* P!4<0TL  hX0(pC&SWY%SW 'S,S 00 D K00\@KlpK @D R00V@ @1 < D! F QK PR p3R^f @0S @d@J@0A0 d@J L @@@P@ T&@:@ R5 (&@/" 00@@T'  '@!@@T %'@@0S '@ @^ l'@@P @'@< <P45S0S(0  :L0 $ @ R@d@J- 0&@@d@J$@@ 0 @s@{%@dv*@L@*@d@J(&@&@P t @ -LMp`@PSW`d`J(KQX   U lK<K K?`K@0K=K`T FR( ^  ⼀K^` ^q4,`K&y K 0PYp 0Sm 0 SjSgP 0 SSH\D R h24l$dJ84< 0R0`0055040 5@0D 5D Pc0 54?Y P0V0 Z   URA@Qz @Q$dJtZ00S0 VP  @\a P@$dJ[0 Sp ,P.@@@PM @#\E @$dJ?\ 0,S`@@@\3 @#^+ x@X$dJ%A0 Y- Y8 ) Q4 % Y< ! Y@ *YH YL *"P5 $P,AY%P @@@ R #@@@@\ p#@00@Q H@$dJ/@Q0 7 Q4 3 Y8 / P< + P@ '* RH # RD *"S $S @10YYɑT P T PQ @@@^ #@j@@@0S #@_@H 0YY6ɑX0 P X0PQ @^w H#@dJp00@\i l@#dJc84  @ RW $@#dJQYg @ RE H#@dJ><4 @P*<i4 L H8LY `0 54P P@@@0S <#@@D 0YYRɑT X0 P T X0PQ  @@@^ D0#@ P PQN 00@P H#@dJ> 00@P H#@dJ, B/P%S @@@ R %:#@<8  @@@\ #@<8@0P0i005 5480 5D 5H D0S0b 08?Pg Rd,P@@@0S @#0S @_$dJ0/CQ< R8 Q0 4 Y8 0 YD ,*Y@ 'Y< #*"P $P@4 0YYɑT X0 P T X0PQ @@@^E 4 @#@@@P9 #@@@@\. #@\& HQ# V  0P pPP 0  0P pPP  P Q!  4 Q Y 1\ R @0S `@$dJV  0p  0p<4D  @@@ R #@sY}z @@@Q D#@b,0C?Q %P @@@\ D#@ 080DQ*0i000 < @<0P0a 0?0 R Q@@@\y #@ T P T PQ @@@Pe 4#@Y+ @@@0ST 4#@804  @@@\B #@0 @@@0S4 D#@ @@@ R& 4#@0 T P T PQe @@@Q #@( YV0c @@@\ #@0 T X0 P T X0PQ @@@\ D @# P @Q @h$dJ0 SH^Q P1  &: 0S ^010000  0P p-PP 0@p 0 @@@Q #@c -LMpK@ Q R`P @0  4 @d@J(K S Z  Q P Y 4 K 0 P  0P   0PP D00 ?P\Q P @ 0 R 0   Q R 0 dPh Ql PT0   0 PHT    0 P @d@J  0 Q 0 SS 0S 0 SSF $ %0@ 0 !K\Ò$ | x d0 h0 l (t , p 0 K0`   !d ` 0`\#0 ( ,00 0 | x l` t p `0 ` d h  0 p`  p4` 0 \Ú0( ` , ` ` L p ` 0 0p`  0 p ` Ƞ  4K0S"pSa. K0pK-`K/K`D FpP `p@pGqP ``@@T $@&@d@J` A  0PS  p 3S R @\ @& @d@J P`eVM pW=W \KW& W 00@Q @0#@d@J,`K4&':  |p @ 0@VV00`0 ` K @@T+ <@#@d@J%V<` 0<0  00@`V@d@Jv 0@&@d@Jm$ %0 <K8p @@T @"@d@J@@@P P@"@d@J @@T @"@d@J00@\ @"@d@J@0S @"@d@J 0` @`@ @00@\ L@"@d@J@ R @"@d@Jt @ -LM@ P` p0P T0  (KPdJ 0 -LCMKPlpK`p\K@0 W SPK|@KA  4 0 < 8 D @ \ l `@d@J(K P V U R @,\@\0So@T@ R@d@J,QG?LP N@TA J R F \C \ ?*0S0 ;@S@ 7*"QO $Q @0@TTWA!  ! Q! ! QF 00@\ #@@d@J@@T @#@d@J00@Q X@#@d@Jw@P (@"@d@Jj 0 @\ @#@d@JYT" 0 P@l00 5 5S0b0 ?\\ @\\ L@#@d@J4 @@@\I #@@d@J!,Q ?B(: P p\ t\ | R @R@ *x@T@ T |*"Q $Q @10@TTA!  ! Q @^ #@@d@J! ! Q7  0AR`0 t 50S0b/p0 \p0SH@T ^ S0!0 p0  Q \! t @ @0 | @^T@@ |0 @@  Qh@pW[@d@Jp A 0CsT@ @P #@@d@Ja0 .@ [ ,O @R|%Qz @ Rl @#@d@JD@ R_ \@"@d@J7, ?@BT%Q@"@d@J'@"@d@J R @@T @"@d@J 0A tQu0x ^@@@pWx P@"@d@Jr@d@J0 C 0L0| P @\W @"@d@JQd0   0 `Xd @|K K0@P @d@J04@K P'0 4 0S 0 SS$ %0|K0K \; P 7 P! 3*@TA /T +*"Q $Q8@! 0@TTA1  1 Q @@@^ #@^ @.pdpJ@@@Q X#@<-@,/p@W %Q @@@\ #@q W`0 55@5q@ 5 R g@ \c @T_,P@@@Qr d@#^j @@ .pdpJOp/@GT7 X*:4 \1 Q - @QA )*@TA %T !*"P $P3@! 0@TTA1  1 Q @@@\, 0#@@@@P #@@@@0S #@O, @BT %P @@@\ #@  pQb05p5Ap 5Qd \ \i@@@0S ,#@p#@@  @@@0S #@ 1 1 Q. @@@Q 0#@T  I @@@pW `#@1 1 Q @@@^ #@ @ F @@@pW #@,P@@@Pw x@#^o T@.pdpJTp/@GT6 X3 Q / R + R '*\ #@\@ *"P: $P&@!0@TT A1  1 Q @@@^1 #@@@@pW& 4#@,@AT%P @@@\ #@  @@@0S #@ ApTpb0p55p 5 5 R ` @T \ @@@0S $#@i@,P@@@Q @#^ @.pdpJ/p@GT; \7 @T@ 3 @T@ / T **@ R! %@R *"P $P@!0@TTA1 1 Qf @@@0S #@@@@pW| #@Tv @@@pWl `#@ @@@P^ #+: @W @@@ RP #@1 1 QA @@@P; #@T4 j @@@0S+ #@1 1 Q @@@\ #@B ,@pDW%P @@@0S #@/TC @pAT* ` p  A R d /\@ P6@@@P #@@ 1 @@@P #@ @@@pW #@E @@@pW #@p Q @0S @%.pdpJp  pQ\p Q QPAPpWt@1 @@@T1 1 pp@0p !  t\#  q p K0(1 (0 ,   ! ( 0 ! 1 0 p p ,1  K !  \Ò ! ! 0(  圠   匠 !0 夠 p p K |p d X T0! 0 `\[[[   K 1  p  \3 0 1 0 p p p Y ZZ ^ 0 SS0   0(pPpK 1\#4 圐  p p 匐 ( ,0 吐 00 K 0 K  1 \3     ( ,( 0 0 0 Ȑ 0( 0 ؐ ,:p p  D4K\"0 . K 00K\1/ K-0K  0PK@p L P R! ZZ pW 0 SS)1 0pP BA$ %0C@0S T@ /pdpJ%0$ ! 1,! 1 @P @.pdpJ@^pdpJ @@@ R #@8/@ -LMK `☐KP ` V Q@@  04 0  T Y pp@0SlpdpJ(K Z S P U P ,Q@@@ R"pdpJpG\D X@ \= P 8 P 4*PPUP /U +*"Q $Q8PP@!P 0PUUQ0  0Q @@@^ #@^ $@.pdpJ@@@Q #@-@, pBW %Q @@@\ #@p Pg0 55P5P 5pWp`P p\c R_,P@@@Qp @#^h @ .pdpJMp/G\7 X4 \1 Q - Q )*PUP %U !*"P $P3PP@!P 0PUUQ0  0Q @@@0S* #@@@@pW #@@@@0S #@O, BQ %P @@@0S D#@p  PRg05P5P 5PQe \ \i@@@0-: S #@p#@P  @@@0S t#@ 0 0Q. @@@Q 0#@U I @@@pW P#@0 0Q @@@\ #@ P F @@@P L#@,P@@@Qu @#^m @.pdpJRp/G\6 X3 Q / R + PRP '*\ # \ *"P: $P&@!0PUU Q0  0Q @@@0S/ #@@@@P$ #@, BQ%P @@@\ #@P  @@@pW H#@pP PU g0 55 5 5pWp` p R \ @@@0S #@i,P@@@P @#^ `@.pdpJP/pGQ; \7  R 3 PUP / U ** R %PPRP *"P $P@!0PUUQ0 0Qf @@@0S #@@@@pWz (#@Uv @@@pWj P#@ @@@ R\ А#@W @@@ RN Ԑ#@0 0QA @@@^9 #@U4j @@@Q) #@0 0Q @@@P #@Bp, pBW%P @@@pW H#@/UC P PU*p`p p  P/ p W pe p.: PP P6@@@0S #@P 1 @@@\ d#@ @@@pW #@EP @@@\ #@ pQ @Q @%.pdpJ QpW   Q pQP@Q qQ@0Sv @U.pdpJ[p  \i@0 pPPPU0w 0 pp@0p !  t\# p p K01 (0 ,    | p 0 x 0t 0 hp lp ,0  K !  \Ò  0( Р 倠 |   p x t 0 删 hp lp dK `T H < 80 0 D@[?[  K 1  p  \3 0 0Đ 0 p p p АY ZZ ^ 0 SS 0 0pPpK 1\#4 倐  | hp lp p ( x ,0 t 00 K 0 K  1 \3     ,( 0 0  0 嬐 1 Đ  0 弐 p p  媼4K0S". K 0KS/ K-K  R& Z$Z! pW 0 SS.6 0 0pP BL$ %0N @0S @[.pdpJ%0$  07 0/ :@^pdpJ @@@ R #@d.@ -L -L ?0P@P dJ z(@ -L ?0$0S@P dJ a(@ -L p-L M@P`T =? 0S P 0Kp@P dJ 8(@ -LPQ @0SdJ (@ -LMP K    K@0SdJ (@ -LMP K    K@0SdJ '@ -LMPQP@`pE R 4@X1Ǔ   c  X  00WU ``@4 0Xaǖ X0J0Z 񟗃| ~}|} 0J  Z |~~00@^ $K @ 00?@c 000 LnP 0 00 00 00    00 ?A c   0  ϠA 0 0l  @P @c%0X 0t 0  00y X 0#?A c 00P  /L" n.@Px @%M0X 0!*  ?A# 0n,0): 0X 0?L c   00  0G .1 !  @0S L@%0@W%@%( -LM@KLPK\`K@p " TYc WZ` X^ Q 0,S00@\} `d`J(K``@ R @-`d`JLP/ R" + P ' R " # R *P P *"S $S ,/@Q#%S! @ R @#`d`J@`V @#`d`J@0S `d`J  0Y 0a0055" 52 50S0a 0\ Q 0S @P @$`d`J}\ R 0S2 S R ?YY \ *20S 2 S *0Y* l    0 S 2 c Q 0S2 4cS:aQ:$ R,\(Y4 P 00 S2 00@42 P 80< S080R <                  ؑ  1 ! PU KK PMQ :  P2 $ \0@L D H @ \@ X0 P T I,^(pWY4Z0@0@T 0   p `K@ 倠 P@@@`V `d`J``@Q L@$`d`J- - \@ p l 01<:0t tbV VKr T tr@ P P0X  \ ` d" hR 82 B lBT b 0 000b?KPR80 @B `0P @\b `@ (B @$R P, < 0 UD  PH 0Y0DB0LR 00001 0 R$(b,B0H<0TR00X\b00`Bd0 h80@R000000X1 1 1 <0 80 Q ` P@a Q 1 A  1  Y 42@TJ qP@6K`8@KP7`K5K"|0@T 8 t  ˠ  ʠ42QL`d`J P98Q6<^3 PU0 2P"U+ P000 4KP 4R0PP@SdJ )d t 4BY`d`J4`V <@)`d`JPPP4KP 4PP@0S( d J" Q  Q r mS  VKL"YR ,`K 0PP&0 0RPh0T Q  Q T 0U00 00 UU0E UC 0 0 0 Rh0,03 54PUPl hP SK*d ` | x0 t pP XD H LLH1P0TTQU( Pt^ 0 SxQ l K|0KP\P@PPPIK cKL"YH  0000 0 0 RPh0N Q  Q >  0U00 00 U  U  Oˠ2Q ;0 00  Sh35 R, 3 54PUQ 1lP !|txQh d0 ` | x t pP X1D0H!L |P TQUP(P \tP  Qx R l K|0K@PPP<KVK cK L"KY   3*: 00`00 X`LDH!H  LP TT1S0(0n`P"0`P2Q  "Q 00Su Ss Y8?O0S AIK ,PKVKL"0 %x Yx2  2 hBP| ;00R0 000 Sh35 P,3 54 R !L1Hl h @Dd  ` |0 x t p X D1H0|0KLLHP TT!R ( l K@x xP  k <K 00 VK L"KY   0  0  `P.0 ^Ph Q  bQ  0U00 00 UU  0n U0k 0 ^h,3 54"0S!1al h d ` | x0 t` p XDH!L l K1P0|0K`T`\(Y RR O 0;P0 ; 0 0ˠP:002Q  "Q 0Pb 84R0 SP<K IK L"KY]   0 ,K!  ˿`P 0`0h0V "Q  Q  0  S h 3, 54bP St0S  \xQ 0ؐ40:!al h0 d ` | x` t p X0D0HL!P `T`PP$\  "  Q P010! 0 00"S "S0!00  "QB 4"0B042 0R0BRS;002R00SlRj R 0 0;0 CSR+  S  RySw S ]ˠQ  Q D ?0EUS;00U00SU U0;00"Q0 UU00 2Q UU 00S= S6 S- Y6?O >?O 0``@Q 00,@(3-4P@`@d`JP Y;060S" S S# YO8 O      I 4bY` 4bYE b 0S S S Y6?OR >?OO4\p @ @0 Sb004R0PP@S2 +@x x0 54\  00@@ SY T! 0@ <  < D PX      3 x 4bxY  `Y;0?PX |Uh 4bY `d`J   - 0@(p4P 4`Vt`PKPo 4BQk -1@`d0Ӿ`I0@,(p45%: Y:?Od < 0sY < 0nY< 0i0@4Y ̠ ̠ Y̠ YO ̠4"0aY:?O<`Y <<\Y<YP s  Y  0T t! @! < p  x D E 0x! D!  <1 p ; @0YY7ɑ|" x |"xQK ``@^ #@`d`J@`V |@#`d`J   @0S 4@#`d`JIY9` ``@P #@`d`J 0 `@ |" |"Q 00@\ #@`d`J42`V`d`J 4"0S 0d-@`n$A@ 0a@ ` @#`d`J{ 00@\r #@`d`Jl@l!@(l!@p@!*`"03-@ ,PXl!@+@0dJ W|6+@4QW T7+@Q4R09@Z-` -@n*@)l!@4)@@* b@l!0h|)@%d*@Hl!@n4@)`d`J-@1@{%\* @/-`d`J@@ 0 @{p@|+@0dJ Xl!@iD@S*x x `l+@d  @ -LMpK⼠KP@@@6&:  0 ㈀ 开 4 `PP 00`|PVU 00@QdJ B0A0(K  0`堹P5 ^txD 04Kd04 0\0X a`0 0ad0 XAd  0dPg  0\Pl     ,K!0P|px pDp tp0@ 8 T < P0 L Hp 0 ZphP Q  Q Z  0W0 [ W00W   OˠR ;0 GWR   W0SW W 0  R R R X6?O >?O 00/ QsZ  0W0 Q ZP}WWZZ  0 0 Z00S W 0   S0ppp3p5 Spp@ 3 5 h , XX| D xHLPTP( St0S  ^xQ D KT0KDPYP R @&@dJZ  ZZ& WW=ZZ:  0W0 |04 W^|  0 00+><WW  0 <X0X +B wX<A>;0< 0W0  @ 0 0 OX:?O<$X << @X |@%dJ<00@P H@%dJ/(73:%@'@l!0= -LMpK⼀K @@@ `  0 4` P 00`|PVU00@XLdJL0 C (K  0`zP dJ  0hP  0txZP  Y Q  04K墹 d04 ,K! Y\ 0ph` padp|xp0tp D <0 8 @ T P L Hp 0Ȁ0Qph* Q    Q*0W0X  R' WW0u0Sv St Y8?O 0 0 0Q    Q X00SFp pp0pp@ Sh3, 5 Rv S/t0S, Q%xX"X|DxH尀LP0T0T0K R(D KDP{P\ lT%@WY   +B W 0Y; 00 ,K! Y4 @QdJ00@X h@$dJH$@4@l!0@$dJ -LMLpKlPK@p `p <Kt x0 l L @tVXa TP]  QRX \Q\Qt0 R?Q @@@Q5dJ(K83:t PP Q 0 S0 S R*X X*0Y 0b0 t505 5 R ht \@@@P @$0S t@D&dJ@0SdJ Y ?R QQ R \0S Y* 0S0 S*0\ 0i0 505  5Pb0 5 5PxZX| CxZPH\@ Rt  0  Q P! t0  0R0 R !t0  t0bS4`Q R@@    yp \8  0  0KD0 P d0 0T @ ` \ l0 L H P0\ d 0`0 RPX LK&0< 8 40 t x0LK &dJM@XdJE @\dJ=x0 ,R@ R2 $@#dJ,00@X @&0@dJx0HPက ; \ 7 \4 P 0x P +*0S0 'xS 9&: "*"R $R@1 0XXaxȁ QC @ R 0#@dJ00@ R @#dJx@$0`@7&dJ@&@m(@&dJk&@3{%@ Q @X #@dJXH  0Ph05x5 50 5X0`0 05?\ RD@Qn @#dJhx,@Q%R @QY @#dJS W @\H |@#dJBx0  @Q7 #@dJ0H0Sht 0S R01 0 0 t0 S \ 010 000X@@@\ @$^ h@`&dJY- ? R( Q$Q" R 0 S XY*0S S*0X i0 51 5 50\ h0 5 5t0 s@@@ R p$@t  t0  `, 00@ R #@dJt @ -LMdpKD`KP @000 40 UT@d@J(KXY  RQ00 \ H0              K   40 00 0 P0 ' '`  0` `4@K@ `@P PP KP @0S (0@KK0P9pQC K@P3@X1 K \0  :%: pp `$p%` `` `Pd ` D` PK`L HpKGKT <` @P 8 l\@ X@ @K p @0S@= P@@@P 0@'@-0'@@% -L]MQR@Pp`@d@J(KSZ Y ZK $00 S4 ,\(Qx 4 Rt! 0 Pp @Q80<S080P<DKTKhKK<8 <0 4 00 p t  x |    x p  t|   0 P= KKP6tQ K@P$pD W 0< @ T L0 8 P H x,`V0(P4t(PU04o4^0k0\hpKD KT0KD@\r' s' 0M/K! p \^$ p8 ZK 0  !  1K4@K`0AS@0 1 0 @P*P&P>KP Q d'0@@\@d@J 0,P'(@4`@d@J @` (P`PX KpD KT0K\ hKhp dP `` DPY@T@x't@lp  t R 0,S'@@@I'@ -L -L @0R0@   -L@ P#3 -L00@P  -L00@P -L@00@0Q0Q  T x-L@`00@ PR PR T Lx00@\x0^&@;0:@x -LM@@@P` pRpR 0U PL0SV app@ PF@ Re0P0@PbKSeTP#@@TB PX4/P@T  @0S P0@&@^ X@&P0VTVP JT  @0S5@ P 0 @0@0P0@\ @&@l 0`@&@@ 40 @F@@0t @D \ 0-LM@P@P) 0Q0Q  PEQ @0000 U 00@ BK0@ 0@@ 0 @y@p -LP00@ P 0-LP00@ @R @R U <0@Q00(@0 -LM< P<@4 00@X `V X0 <04 0,( $0PYD0pP@4pH@0D@T p48pX$< 40p0 C8 g   Z H:40pSf:0H RL 8\@@ TE 00`  ``Z.:4pQL: H0S1 8^00@@ T)  `Z: H0pS 8 R00@@ T  ``Z*1 @@ @@0`<<(K0` @\ @@ @h0 @@ @D0 @@ @ 0@'<*: x-LP`00@ @R @R U x@x -L MPP@`!@TE 00@ qpW? 0pG"P41 Q / @W@) X 1 P ! @pW@ 0pG"P1 Q @@ 0"P K -L@@@0S0C0S p   -LM@Q` R800@PQPQ  PVp W @PmKVPp W PL0SV1DP` TV PTPPT S8TP 00@0S% X3/00@XT\ P0 '@`DT`P V PTPzPxT@ R X'@@@ 00 @ G@@ &@ -L MPQ< P``@! P`@`@pWP0 @p0P0@P@ B 00CXP B 00C K@@ 0 @@ -L`P`@tp0@ Q@"0PS:Y: 40SP@@ @ R @0Q$ {0A00@T0  -L00@0@Q @Q  S$ T@P !@ -LMPP@p8Kp@ 0`AV``1  @ 00 P. P+  SCP=?:QN 0@N@ @000@S@ S# 8 R  0<8Q(K\ H"'@PC $0  Q1 0S \#3/00S ^ 0( R ('@Xtb 0@0L@L' 00F'0@?'0@  -L MPP@p0 p@0`S= 8@T1@S! L0 0 0@S@^:0 08@T 0  <1@S !000 0P`(KQ0 R 0S( 0P#0@8b 0@/0@, x-L`00@ @R@R V 04PU  $ xx @Qx0 !@< x-LPU @?U`E` V 8@U@3@1Ux -L@P@@ 00^0PPUPP@p``@0L0pPp Ap x-LPPx ? 0S@U`E` V @U@@Ux@x -LPP @@@ `V  ? 00@\'00Q0 `@`@p@ pp@ 0@p P0 0 .@2 \  0 @p@@@0S @@; 0S @><:> @0P -L 0-L@@@(@0@ @ < 8 0SPP@ @0 H T0 P00@PP@@@ H$  000Y0PP@P0P NP0 -LM@00@0Qn0Qk  T P(@0X: `Q }?p8K ( 0 0@8 00 4 ,  Q `K`PP3 @0@ v400@P- 0@$%\ `}?p8`K 08 (0 @,0 0 4    R K@ R dJnoO0$@d -L$M@P@@1zG S) } @?pH i @`K8 <5 SE 0HP < 8 00 40 h <\ 0PBPP(1 0s 0SZ S :U @P&1S 8 <0<080(K u@Q B$@ @\ P <\PD@>$1^_O $@@1| -L4MH 0S @P Pt 00P @@@tQ0SE }?p0Y`@`@L` @`K0S R L < 8 0 4   P 0S40S P PNPodJ5PQP@ppt 00 S@`4d ^ 0S0 R 0 S `@0?): 0H0 000H  LP(KQ0 P`@@ R_@QdJ @z!dJ@Q \@a/dJ@0!@]@!dJ -LMpP`00@ @RY@RV U @4Q]00@8PPPU_ W  Y PPP\ \0S $` X0 0 0p0 0  PP$PD<P`0\<0DPHP@ 0@0(K@ RdJ` \@ R 0p@Q"dJ@^ dJ0,@I"dJ ^"@ -L,MPpP@H @ 00`V+  0Z0 H DK@p pK@D` pP @0S L (K` @PpdpJ 00@^(pdpJu(0@ -L M@P P  K@@ 0 @@ 0-L$P PU0P @U0 -L$MPP@pH0  `Rf`Rc 0W @4P \r $ 4H 10@@ 1!@Q@bY> P\ pm?`@pK 0 00@@ 80 < 4   R PPPHQ0  uQ00@Q{@\RdJ(K@:P ?4\dP 00@^3PP@0SH0P R8( 0 @Q 0@!#dJw @P dJ)#@0@/dJ0t/@`b 0@^_Oy4#0@0@# -L00@ AR*01R*`0 -L00@x P:| P*0 b -L00@ R| P*x0 b -L@ 2R1Q!%Q!Q010!P! -LM@Pp @` @`@p; @p; @p= @p< @p0 @p00 @p @pK -L M@P P P P P P @0SK00@x T:| T05 b00:0 @@ -L MP@S\6R4 P@RQ \ p 0R pp \0 `p vp`wp0\0@P 1 P@P  P (K@0S 8@9 0@N @ 0-LMPP@0S @@@xp |xK0\@ P @ @Q @@@ @; R ;@ A: 0S @ =P @ <Q \@0 R 000@ 0S  @ p-L M@@@@ 0PP@p4 P @@@PxE 0@+x0+8x-7x,9x` 9x0``@*90 Ǡ|Q!Kp0S @ 0p@@@0Sf Sip @ R  @Q X@ ;P ,@ ;\ =@ 0S @< R @ 0Q |@ 00P T@ 8@ 0 @@0$ -L00@1@T D Q@  p-L M0@ S@#!*@PP!`e`@PPU% V @PPU@PU `P@P KpPP PP PP PPPPP@P; PP@R ``@0@ 0S @ 0P @ 0Q h@0 R @ 0@@ 0 @0 -L00@ R   -L @0S0S -L00@'P -L@@@ @@ -L@Pp`T0/T`0+  R Q\ Q P^B:  P0S 0``@T0T0 -L M@P X@@@ 0R P T0K@@ 0 @0@S@ -LM`@PpV! VB VU 0 80@( , $0  ( ( 0K080( $(` ( 8,`0 4 `  " Ȃ080Ȃ$`( 4(` ,`0 @@ 0 @@@@L -L M`P@<KVk8,p004 a pl2 &8$p Ȃ( ` 8(< 8 4 0 ,0 `@PU0< <KP0p,(S 3 P0 V P \ ^ W Z X 00@R  PP0TTU $`PP$KV V7$0p 0`(p 0.(h(,0Ȍ<` 8 h4 0 , (` 4p(`,0 p!0`,p2$"8 `Ȍ r@@ 0 @@@@L p-L M`@P V, VM V`  @Ȏ( ,0$0  0!ȃ 8 000@P0PKp  80$( 808,0 40  , 2"  0 P $0 (04, 00@@ 0 @@@@L 0-L@@@0S 0 C: @@ @PPNA0 -L@`PPpp@@ @P @BV0@0P -L@ -LMQ) PP@0S9)q `G`QU@T*V PB@T *0`S @T@T:\pǃ (K0@e 0 0Ae @00 @0a @00 @0P tb 0@0H@e 00 00@e 0 0d -LdMPP@@0S(4(K@o P0P ( @`P pH 0,40 <040 88 @< D0@0 HD 0 H0`Pp $4<8(0D@,48x -L@@@bQ @@@00@ P  -L MaBP@b <@@@@P @YhP bO00@0P P@ @ @P P@@P@ P@  @@P00@80040 @P 0@40<@@KGNU@kJQ4s4snO*;CYz s~5m A(Q3D;D: Na!/tde_osr_hsrtde_osr_freevmem $,4<HT\dp| $,8@LXdlxtde_write_procg_u32TdeTmpBufHg_u32TdeTmpBufWg_pszTdeMmzNameTdeHalFillVFilterAddrByTypeTdeHalFillHFilterAddrByTypeTdeHalFillAddrByTypeTdeHalNodeSetBlendRvsTDeHalNodeSetCscTdeHalNodeSetMbModeTdeHalNodeAddChildTdeHalNodeSetColorConvertTdeHalNodeSetResizeTdeHalNodeSetFlickerTdeHalNodeSetClippingTdeHalNodeSetColorKeyTdeHalNodeSetClutOptTdeHalNodeSetColorizeTdeHalNodeSetBlendTdeHalNodeSetRopTdeHalNodeSetAlphaBorderTdeHalNodeSetExpAlphaTdeHalNodeSetGlobalAlphaTdeHalNodeSetBaseOperate  TdeHalNodeSetTgtTdeHalNodeSetSrc2BaseExTdeHalNodeSetSrcMbCbCrTdeHalNodeSetSrc1ExTdeHalNodeSetSrcMbYTdeHalNodeSetSrc1TdeHalNodeGetNdSizeTdeHalNodeInitChildNdTdeHalFillLastNodeNextInfoTdeHalUpdateHwAddrTdeHalNodeInitNdTdeHalGetFiltParamTdeHalNodeMakeNdTdeHalLoadFiltParamTdeHalSetFiltParamTdeHalAllocMmzForFiltParamTdeHalNodeSetSrc2TdeOsiGetHUpdateInfoTdeOsiGetVUpdateInfo  TdeOsiCheckOverlapTdeOsiGetPatternOptCategoryTdeOsiCheckSurfaceTdeOsiCheckDoubleSrcPatternOptTdeOsiCheckSingleSrcPatternOptTDE_DEBUG_PRT_SFCATTRTDE_DEBUG_PRT_MBATTRTdeOsiGetFiltParamTdeOsiSetFiltParamTdeOsiGetScanInfoTdeOsiColorConvert                  TdeOsiSetCliE:pParaTdeOsiSetPatternClipParaTdeOsiMbSetClipPara     TdeOsiConvertSurfaceExTdeOsiSetNodeFinishTdeOsiSetFilterChildNode@ ( %"TdeOsiSetFilterNodeTdeOsiSingleSrc1BlitTdeOsiQuickCopyTdeOsi1SourceFillTdeOsiQuickBitblitTdeOsiCheckResizeParaTdeOsiSingleSrcPatternFillTdeOsiSetClutOptTdeOsiSingleSrc2BlitTdeOsiCheckSingleSrc2OptTdeOsiYC422TmpOptTdeOsiDoubleSrcBlitTdeOsiCheckDoubleSrcOptTdeOsiGetOptCategoryTdeOsiDoubleSrcPatternFillTdeOsi2SourceFillTdeOsiBitmapMaskCheckParaTdeOsiBitmapMaskBlendTdeOsiBitmapMaskRopTdeOsiWaitAllDoneTdeOsiWaitForDoneTdeOsiEndJobTdeOsiBeginJobExTdeOsiBeginVideoJobTdeOsiBeginJobTdeOsiConvertMbSurfaceTdeOsiMbBlitTdeOsiCheckMbSurfaceTdeOsiSetMbParaTdeOsiCalcMbFilterOptTdeOsiAdjQualityTdeOsiMbOutBlitCbCrTdeOsiMbOutBlitYTdeOsiMbOutBlitTdeOsiOsd2MbTdeOsiMb2MbTdeOsiListGetBuffTypeTdeOsiListGetPhyBuffExTDE_GetPhysicBuffTdeOsiListReleaseHandleTDEOsiListTplPrepareTdeTplCreateTemplateTdeOsiListPutPhyBuffExTdeOsiListFreeNodeTdeOsiListDestroyJobTdeOsiListFifoCompTdeOsiListSafeDestroyJobTdeOsiListResetTdeOsiListCancelJobTDE_AllocPhysicBuffTdeOsiListWaitForDoneTdeOsiListWaitAllDoneTdeOsiListBeginJobTdeOsiListAddNodeTdeOsiListCreateTaskByTplTdeOsiListFlushNodeTdeOsiListSubmitJobwfreeMemoryBlockInitwmemtermwmeminitwmallocTdeTplInitTemplateTDE_TPL_MAKE_KEYINFODebugPrtTplNodesDebugPrtTplInfolicense=Proprietarydescription=Digital Media Chipset and Sulution Development Dept,F : HSparm=g_u32TdeTmpBufH:The max height for tde tmp buffer.parm=g_u32TdeTmpBufW:The max width for tde tmp buffer.parmtype=g_u32TdeTmpBufH:uintparmtype=g_u32TdeTmpBufW:uintparm=g_pszTdeMmzName:The mmz name for tde.parmtype=g_pszTdeMmzName:charpdepends=vermagic=3.0.8 mod_unload ARMv7 $$$tdetdeinfographicstde_osr_isr<3>request_irq for TDE failure! malloc for tde proc fail! failed to create the proc graphics ! Load tde.ko ...OK! $$$$$$$$$$$$%ld$$$$$$$$$$$$$$$$ <3>%s(): Line%d : Malloc TDEFREEWQ_S failed! <7>%s(): Line%d : Count = %d cmd (%s): start from %d BIT_BLITSOLID_DRAWQUICK_COPYQUICK_RESIZEQUICK_FILLQUICK_DEFLICKERMB_BITBLTBITMAP_MASKROPBITMAP_MASKBLENDTDE_CMD_PATTERN_FILLtde proc malloc fail! --------- Hisilicon TDE Node params Info --------- --- HWNode update: 0x%x%x --- (%s): 0x%x <4>%s(): Line%d : <%s> Line %d:copy_from_user failed! trace ontde trace on trace offtde trace off proc ontde proc on proc offtde proc off hi_tdeINSS1_ADDRS1_TYPES1_XYS1_FILLS2_ADDRS2_TYPES2_XYS2_SIZES2_FILLTAR_ADDRTAR_TYPETAR_XYTS_SIZECOLOR_CONVCLUT_ADDR2D_RSZHF_COEF_ADDRVF_COEF_ADDRRSZ_STEPRSZ_Y_OFSTRSZ_X_OFSTDFE_COEF0DFE_COEF1DFE_COEF2DFE_COEF3ALUCK_MINCK_MAXCLIP_STARTCLIP_STOPY1_ADDRY1_PITCHY2_ADDRY2_PITCHRSZ_VSTEPARGB_ORDERCK_MASKCOLORIZEALPHA_BLENDICSC_ADDR OCSC_ADDR Assertion [%s] failed! %s:%s(line=%d) enFiltType < TDE_HAL_FILTCOEF_TYPE_BUTT/home/pub/platform_h3/mpp/component/tde/tde/driver/src/tde_hal.cAssertion panic <7>%s(): Line%d : fill Coef VY:%d %x <7>%s(): Line%d : fill Coef VY: dflt %x <7>%s(): Line%d : fill Coef VC:%d %x <7>%s(): Line%d : fill Coef VC: dflt %x 0<7>%s(): Line%d : fill Coef HY:%d %x <7>%s(): Line%d : fill Coef HY: dflt %x <7>%s(): Line%d : fill Coef HC:%d %x <7>%s(): Line%d : fill Coef HC: dflt %x HI_NULL G: != pHWNodeHI_NULL != pMbCmdHI_NULL != pChildInfoHI_NULL != pConvHI_NULL != pResizeHI_NULL != pFlickerHI_NULL != pClipHI_NULL != pColorKeyHI_NULL != pClutCmdpHWNode != HI_NULLHI_NULL != pstColorFillHI_NULL != pDrvSurfaceHI_NULL != pDrvMbCbCrHI_NULL != pDrvMbY<7>%s(): Line%d : fill last hw nextaddr:Lastnode: phy:0x%x; Curnode: setting phy:0x%x, CurNodeUpdate=0x%08x-%08x NULL != pstInImgAddrNULL != pstOutImgAddrNULL != pstOsdInfo<7>%s(): Line%d : fill S1 phyaddr(%x) as 0x%x (addr type:%d) <7>%s(): Line%d : fill S2 phyaddr(%x) as 0x%x (addr type:%d) <7>%s(): Line%d : fill Tar phyaddr(%x) as 0x%x (addr type:%d) <7>%s(): Line%d : -----------------TPL case --------------------- <3>fatal err: TDE_INT_CNT==-1! NULL != pu8HParamNULL != pu8VParam<3>%s(): Line%d : malloc for hwnode failed! <7>%s(): Line%d : make hw node:u32NodeSize:%d word, viraddr:0x%p phy:0x%x NULL != pstParaTable<3>%s(): Line%d : Alloc horizontal coef failed! <3>%s(): Line%d : Alloc vertical coef failed <3>%s(): Line%d : Load param filter to mmz failed:%x! <3>%s(): Line%d : already bind mmz addr %x for this param table:%s! <3>%s(): Line%d : new_mmb failed!<3>%s(): Line%d : Alloc coef memory failed ! TDE_COEF_MMB%d<7>%s(): Line%d : update_start:%d, update_hstop:%d, ori_in_width:%d <7>%s(): Line%d : update_vstart:%d, update_vstop:%d, ori_in_height:%d, ratio:%ddratio:%d <7>%s(): Line%d : update_vstop:%d zme_voutstop:%d <7>%s(): Line%d : zme_voutstart:%d, zme_voutstop:%d <7>%s(): Line%d : u32Rect1StartPhy:%x, u32Rect1EndPhy:%x, u32Rect2StartPhy:%x, u32Rect2EndPhy:%x <3>%s(): Line%d : Dst/Dst Rect should not be null! <3>%s(): Line%d : color format error! <3>%s(): Line%d : invalid surface size or operation area!<3>%s(): Line%d : x, width of YCbCr422R couldn't be odd! <3>%s(): Line%d : Bitmap address is not aligned! <3>%s(): Line%d : stride is not aligned! <3>%s(): Line%d : Invalid CbCr stride! <3>%s(): Line%d : invalid operation H: area!<3>%s(): Line%d : <3>%s(): Line%d : Background Rect/Foreground Rect/Opt should not be null in two src pattern fill! <3>%s(): Line%d : Size of background rect and Dst rect should be the same in two src pattern fill. background x:%d, y:%d, w:%d, h:%d;dst x:%d, y:%d, w:%d, h:%d <3>%s(): Line%d : Max pattern width is 256! <3>%s(): Line%d : Background rect shouldn't be NULL! <3>%s(): Line%d : Foreground rect shouldn't be NULL! <3>%s(): Line%d : No src!<3>%s(): Line%d : enAluCmd error! <3>%s(): Line%d : Unkown color format! <3>%s(): Line%d : Target must have alpha component! <3>%s(): Line%d : Unsupported operation! <3>%s(): Line%d : It doesn't support ROP! <3>%s(): Line%d : If background, foreground , dst are clut, they should be the same fmt! <3>%s(): Line%d : It doesn't support ROP or mirror! <3>%s(): Line%d : Unkown color transport type! <3>%s(): Line%d : enColorKeyMode error! <3>%s(): Line%d : It doesn't support colorkey in single source pattern mode! <3>%s(): Line%d : Only support single s2 rop! <3>%s(): Line%d : Alu mode error! <3>%s(): Line%d : It doesn't ROP/Blend/Colorize! <3>%s(): Line%d : If src fmt and dst fmt are clut, they shoulod be the same fmt! <7>%s(): Line%d : ===========stSfcAttr:%d============ <7>%s(): Line%d : pstDst->enColorFmt= %d <7>%s(): Line%d : pstDst->u32Width = %d <7>%s(): Line%d : pstDst->u32Height = %d <7>%s(): Line%d : pstDst->u32Stride = %d <7>%s(): Line%d : pstDst->u32PhyAddr = %X <7>%s(): Line%d : pstDst->bAlphaMax255 = %d <7>%s(): Line%d : pstDst->bAlphaExt1555 = %d <7>%s(): Line%d : pstDst->u8Alpha0 = %d <7>%s(): Line%d : pstDst->u8Alpha1 = %d <7>%s(): Line%d : pstDst->bYCbCrClut = %d <7>%s(): Line%d : ===========Surface Rect:============ <7>%s(): Line%d : pstDstRect->s32Xpos = %d <7>%s(): Line%d : pstDstRect->s32Ypos = %d <7>%s(): Line%d : pstDstRect->u32Width = %d <7>%s(): Line%d : pstDstRect->u32Height = %d <7>%s(): Line%d : ===========stMBAttI :r:%d============ <7>%s(): Line%d : pstMB->enMbFmt = %d pstMB->enPicMode = %d pstMB->u32YWidth = %d pstMB->u32YHeight = %d pstMB->u32YStride = %d pstMB->u32CbCrStride = %d pstMB->u32YPhyAddr = %x pstMB->u32CbCrPhyAddr = %x <7>%s(): Line%d : ===========MB Rect:============ <7>%s(): Line%d : pMBRect->s32Xpos = %d pMBRect->s32Ypos = %d pMBRect->u32Width = %d pMBRect->u32Height = %d <3>%s(): Line%d : param illegal: NULL Ptr <3>%s(): Line%d : illegal filter type:%d! <3>%s(): Line%d : not allow to get param filter except to user1/user2! <3>%s(): Line%d : not allow to set param filter except to user1/user2! <3>%s(): Line%d : Set param filter to Hal failed:%x! Assertion [%s] failed! %s:%s(line=%d) NULL != pSrc/home/pub/platform_h3/mpp/component/tde/tde/driver/src/tde_osictl.cAssertion panic NULL != pstSrcRectNULL != pstDstNULL != pstDstRectNULL != pstSrcDirectionNULL != pstDstDirection<3>%s(): Line%d : Subbyte's start or width for writing is not aligned! <3>%s(): Line%d : Could not support VF/FF/HF and Mirror !<3>%s(): Line%d : bits per pixel less than 0! NULL != pstFillColorNULL != pstSurNULL != pu32OutColor<3>%s(): Line%d : Unsupported color! <3>%s(): Line%d : Unsupported color transport! NULL != pstOptNULL != pstHWNode<3>%s(): Line%d : clip and operation area have no inrerrect! <3>%s(): Line%d : clip and operation area have no inter-rect! <3>%s(): Line%d : error clip mode! NULL != pstForeGround<3>%s(): Line%d : enClipMode error! NULL != pstMbOpt<7>%s(): Line%d : Osd bitmap: picmode:%d w:%d h:%d x:%d y:%d phy:%x s:%d <3>%s(): Line%d : TdeHalNodeMakeNd fail! <7> <7>01 u32TDE_INS 0x%08x <7>02 u32TDE_S1_ADDR 0x%08x <7>03 u32TDE_S1_TYPE 0x%08x <7>04 u32TDE_S1_XY 0x%08x <7>05 u32TDE_S1_FILL 0x%08x <7>06 u32TDE_S2_ADDR 0x%08x <7>07 u32TDE_S2_TYPE 0x%08x <7>08 u32TDE_S2_XY 0x%08x <7>09 u32TDE_S2_SIZE 0x%08x <7>10 u32TDE_S2_FILL 0x%08x <7>11 u32TDE_TARJ:_ADDR 0x%08x <7>12 u32TDE_TAR_TYPE 0x%08x <7>13 u32TDE_TAR_XY 0x%08x <7>14 u32TDE_TS_SIZE 0x%08x <7>15 u32TDE_COLOR_CONV 0x%08x <7>16 u32TDE_CLUT_ADDR 0x%08x <7>17 u32TDE_2D_RSZ 0x%08x <7>18 u32TDE_HF_COEF_ADDR 0x%08x <7>19 u32TDE_VF_COEF_ADDR 0x%08x <7>20 u32TDE_RSZ_STEP 0x%08x <7>21 u32TDE_RSZ_Y_OFST 0x%08x <7>22 u32TDE_RSZ_X_OFST 0x%08x <7>23 u32TDE_DFE_COEF0 0x%08x <7>24 u32TDE_DFE_COEF1 0x%08x <7>25 u32TDE_DFE_COEF2 0x%08x <7>26 u32TDE_DFE_COEF3 0x%08x <7>27 u32TDE_ALU 0x%08x <7>28 u32TDE_CK_MIN 0x%08x <7>29 u32TDE_CK_MAX 0x%08x <7>30 u32TDE_CLIP_START 0x%08x <7>31 u32TDE_CLIP_STOP 0x%08x <7>32 u32TDE_Y1_ADDR 0x%08x <7>33 u32TDE_Y1_PITCH 0x%08x <7>34 u32TDE_Y2_ADDR 0x%08x <7>35 u32TDE_Y2_PITCH 0x%08x <7>36 u32TDE_RSZ_VSTEP 0x%08x <7>37 u32TDE_ARGB_ORDER 0x%08x <7>38 u32TDE_CK_MASK 0x%08x <7>39 u32TDE_COLORIZE 0x%08x <7>40 u32TDE_ALPHA_BLEND 0x%08x <7>41 u32TDE_ICSC_ADDR 0x%08x <7>42 u32TDE_OCSC_ADDR 0x%08x <7>43 u64TDE_UPDATE 0x%08x-%08x <7>%s(): Line%d : hwnode:pBuf %p, u32NodeSz %d, u32Update 0x%08x-%08x! <6>%s(): Line%d : TdeOsiListAddNode fail, ret = 0x%x! <7>%s(): Line%d : slice calc u32MaxSliceNum: %d! <7>%s(): Line%d : one slice block for filter! <7>%s(): Line%d : NoLap slice block for filter! <7>%s(): Line%d : OverLap slice block for filter! <7>%s(): Line%d : slice real u32SliceNum: %d! <7>%s(): Line%d : InHeight:%d, InWidth:%d, OutHeight:%d, OutWidth:%d,UpdateX:%d, UpdateY:%d, UpdateW:%d, UpdateH:%d <7>%s(): Line%d : bHScale:%x <7>%s(): Line%d : bVScale:%x <7>%s(): Line%d : zme_instart_w:%d, zme_instart_h:%d, zme_in_width:%d, zme_in_height:%d, zme_outstart_w:%d, zme_outstart_h:%d, zme_out_width:%d, zme_out_height:%d, zme_hphase:%d, zme_vphase:%d, def_offsetup:%d, def_offsetdown:%d <3>%s(): Line%d : There is not enough memoryK: ! <3>%s(): Line%d : NULL ptr! <3>%s(): Line%d : color format is different! <3>%s(): Line%d : NULL pointer! <3>%s(): Line%d : enRopCode error! <3>%s(): Line%d : Unknown blend cmd! <3>%s(): Line%d : Unknown blend mode! <3>%s(): Line%d : invalid alu command! <3>%s(): Line%d : enOutAlphaFrom error! <3>%s(): Line%d : Null ptr! <3>%s(): Line%d : Resize parameter error! <7>%s(): Line%d : stSrcScanInfo.enVScan:%d, stSrcDrvSurface.enHScan:%d <7>%s(): Line%d : stSrcOptArea.s32XPos:%d, stSrcOptArea.s32YPos:%d, stSrcOptArea.u32Width:%d, stSrcOptArea.u32Height:%d <7>%s(): Line%d : stDstScanInfo.enVScan:%d, stDstScanInfo.enHScan:%d <7>%s(): Line%d : stDstOptArea.s32XPos:%d, stDstOptArea.s32YPos:%d, stDstOptArea.u32Width:%d, stDstOptArea.u32Height:%d <3>%s(): Line%d : Surface overlap! <3>%s(): Line%d : Single src pattern fill dosen't support out alpha form background! <3>%s(): Line%d : The clut table is not exist! <3>%s(): Line%d : clut fmt not same <3>%s(): Line%d : pClutSur->pu8ClutPhyAddr=%p <3>%s(): Line%d : It doesn't support colorkey in single source mode! <3>%s(): Line%d : It doesn't support deflicker or ROP or mirror! <7>%s(): Line%d : One Pass For Tmp Operation! <7>%s(): Line%d : Two Pass For Tmp Operation! <3>%s(): Line%d : Could not output the format For YCbCr422R! <3>%s(): Line%d : Could not malloc memory! <7>%s(): Line%d : tmp x:%d, y:%d, w:%d, h:%d pstOpt != HI_NULL<3>%s(): Line%d : unkown format! <3>%s(): Line%d : It doesn't support Blend/ROP/Colorize! <3>%s(): Line%d : null pointer in single source 2 operation!<3>%s(): Line%d : pstOpt can not be NULL in single source 2 operation! <3>%s(): Line%d : Unsupported solidraw colorkey in background mode! <3>%s(): Line%d : Contains NULL ptr! <3>%s(): Line%d : pstBackGroundRect does not correct! <3>%s(): Line%d : pstForeGroundRect does not correct! <3>%s(): Line%d : pstMaskRect does not correct! <3>%s(): Line%d : pstDstRect does not correct! <3>%s(): Line%d L:: Don't support scale! <3>%s(): Line%d : Maskbitmap's colorformat can only be An in TdeOsiBitmapMaskBlend! <3>%s(): Line%d : Alum mode can only be blending in TdeOsiBitmapMaskBlend! <3>%s(): Line%d : ForeGround bitmap must contains alpha component! <3>%s(): Line%d : Maskbitmap's colorformat can only be A1 in TdeOsiBitmapMaskRop! <3>%s(): Line%d : can not wait in interrupt! <3>%s(): Line%d : can not be block in interrupt! <3>%s(): Line%d : param illegal: null ptr! <7>%s(): Line%d : W:0x%x, H:0x%x <3>%s(): Line%d : Unspport color format! <3>%s(): Line%d : param illegal: NULL ptr! <3>%s(): Line%d : mb color format error! <3>%s(): Line%d : invalid parameter in operation rect! <6>%s(): Line%d : The Scale is too large! <3>%s(): Line%d : Filt Coef err: type %d, HL %d, HC %d, VL %d, VC %d <7>%s(): Line%d : Filt Coef: type %d, HL %d, HC %d, VL %d, VC %d <3>%s(): Line%d : get tempbuff for template MB2MB failed <3>%s(): Line%d : creat task from template MB2MB failed:0x%x <3>%s(): Line%d : There is no enought memory! <3>%s(): Line%d : TdeOsiConvertMbSurface error! <7>%s(): Line%d : <3>%s(): Line%d : could not transfer mb paras! <3>%s(): Line%d : osd size is too large,should less than 800*600! <7>%s(): Line%d : auto chage resize quality from high to low, because temp buff over size <3>%s(): Line%d : must use buffer, high qulity get buffer fail! HI_NULL != pS2Tmp->u32PhyAddr<7>%s(): Line%d : High Quality Mb Resize! <3>%s(): Line%d : mb high quality pass1 fail !<3>%s(): Line%d : mb high quality pass2 fail !<7>%s(): Line%d : Middle Quality Mb Resize! <3>%s(): Line%d : mb middle quality pass1 fail !<7>%s(): Line%d : Low Quality Mb Resize! <7>%s(): Line%d : Mb CUS by Filter! <3>%s(): Line%d : create MB2Surface template(type:%d) err <3>%s(): Line%d : could not transfer mb src paras! <3>%s(): Line%d : could not transfer mb dst paras! <3>%s(): Line%d : mb in mb out CbCr pass fail !<3>%s(): Line%d : mb in mb out Y pass fail !<3>%s(): Line%d : enM: MbPicMode error! <3>%s(): Line%d : ForeGround or dst surface has illegale param! <3>%s(): Line%d : ForeGround or dst MB's picmode must same! <3>%s(): Line%d : dst surface has illegale param! <7>%s(): Line%d : No Resize!<3>%s(): Line%d : osd size is larger than g_u32TdeTmpBufW(%d)*g_u32TdeTmpBufH(%d)! <3>%s(): Line%d : get tempbuff failed <3>%s(): Line%d : get tempbuff for template Osd2MB failed <3>%s(): Line%d : creat task from template Osd2MB failed:0x%x <3>%s(): Line%d : create template(type:%d) err <3>%s(): Line%d : query temp buff err: query handle invalid:%d <3>%s(): Line%d : TDE_GetPhysicBuff failed, because no temp buff exist <7>%s(): Line%d : add temp buff ref:%d <3>%s(): Line%d : query temp buff err: func g_pFuncMallocCb not exist <3>%s(): Line%d : query temp buff with size %dbyte failed <7>%s(): Line%d : query temp buff with size %dbyte from user ok Assertion [%s] failed! %s:%s(line=%d) 0/home/pub/platform_h3/mpp/component/tde/tde/driver/src/tde_osilist.cAssertion panic NULL != pstJobHeader<3>%s(): Line%d : job %d doesnot exist! <3>%s(): Line%d : malloc failed for create template HI_NULL != pstSwNode(u32CurCmdNodeNum != 0) && (NULL != pstSwNode)u32TempSize <= u32CurCmdSizeu32TempNum <= u32CurCmdNodeNumjob %d doesnot exist! <3>%s(): Line%d : free temp buff err: query_handle invalid <3>%s(): Line%d : free temp buff err: func g_pFuncFreeCb not exist <7>%s(): Line%d : free temp buff with size %dbyte to user ok NULL != pNode<7>%s(): Line%d : handle %d does not exist! <3>%s(): Line%d : handle %d already delete! <3>%s(): Line%d : The Job list should not be empty! <7>%s(): Line%d : handle:%d! <7>%s(): Line%d : handle:%d has callback func! <7>%s(): Line%d : query handle %d complete! <7>%s(): Line%d : reset free handle:%d! <3>%s(): Line%d : Handle %d has been submitted! <3>%s(): Line%d : It can not alloc mmz buffer in interrupt! TDE_TEMP_BUFFER<3>%s(): Line%d : new_mmb failed!<3>%s(): Line%d N: : alloc mmz buffer failed! <4>%s(): Line%d : query handle (%d) interrupt! <3>%s(): Line%d : query handle (%d) time out! <7>%s(): Line%d : list empty!!!!!!!! <7>%s(): Line%d : wait for All done time out, continue wait <4>%s(): Line%d : tde wait all interrupt <3>%s(): Line%d : invalid param: enTempBuffType:%d, u32TempBuffSize:%d! <3>%s(): Line%d : TDE BegJob Malloc Fail! <3>%s(): Line%d : Too Many TDE Jobs! <3>%s(): Line%d : invalid handle %d! <3>%s(): Line%d : job %d already submitted! <3>%s(): Line%d : malloc failed! <3>%s(): Line%d : malloc hw nodes buff(%dbtyte) for template instance fail! <6>%s(): Line%d : Add Sw Node to job fail, ret = 0x%x! <6>%s(): Line%d : invalid handle %d! <6>%s(): Line%d : job %d already submitted! <6>%s(): Line%d : no cmd ! <7>%s(): Line%d : handle:%d complete! <4>%s(): Line%d : handle:%d interrupt! <3>%s(): Line%d : handle:%d timeout! ----------------------------------------------------- MemBlock Info total free 64 %d %d 128 %d %d 256 %d %d 512 %d %d 1024 %d %d 2048 %d %d ------------------------------------------------------ <3>%s(): Line%d : Free mem failed!vir:%p, phy:%x <3>%s(): Line%d : <7>%s(): Line%d : num of size(%d) = %d, vrt addr = %p <7>%s(): Line%d : ----------------------------------------------------- <7>%s(): Line%d : MemBlock Info total free <7>%s(): Line%d : 64 %d %d <7>%s(): Line%d : 128 %d %d <7>%s(): Line%d : 256 %d %d <7>%s(): Line%d : 512 %d %d <7>%s(): Line%d : 1024 %d %d <7>%s(): Line%d : 2048 %d %d <7>%s(): Line%d : ------------------------------------------------------ TDE_MEMPOOL_MMB<3>%s(): Line%d : new_mmb failed!<3>%s(): Line%d : malloc mempool buffer failed! <3>%s(): Line%d : %d free units:%d... Assertion [%s] failed! %s:%s(line=%d) NULL != pstTplMng/home/pub/platform_h3/mpp/component/tde/tde/driver/src/tde_template.cAssertion panic 0<7>%s(): Line%d : ~~~~~node %d info:~~~~~ <7>%s(): Line%d : node pO:hyaddr:%x size:%d byte <7>%s(): Line%d : %d 0x%08x <7>%s(): Line%d : ~~~~~~~~~~~~~tpl %d info~~~~~~~~~~~~~~~~~~ <7>%s(): Line%d : pstTplMng->enTplType = %d pstTplMng->stKeyCode.u32OutimgSize = 0x%x pstTplMng->stKeyCode.u32InImgSize = 0x%x pstTplMng->stKeyCode.u32OutImgStride = 0x%x pstTplMng->stKeyCode.u32InImgStride = 0x%x pstTplMng->stKeyCode.u32OtheKey = 0x%x pstTplMng->stKeyCode.stPosSize = 0x%x pstTplMng->stTplAttr.u32AllHwNodesNum = %d pstTplMng->stTplAttr.u32AllHwNodesSize = %d pstTplMng->stTplAttr.pu8HwFistNodeVirAddr = %p pstTplMng->stTplAttr.u32HwFistNodePhyAddr = %x pstTplMng->stTplAttr.u32HwFistNodeUpdate = 0x%08x-%08x pstTplMng->stTplAttr.u32HwLastNodeOffset = %d pstTplMng->stTplAttr.bUseTempBuff = %d pstTplMng->stTplAttr.u32TempBuffSize = %d tde_get_procentrytde_write_proctde_read_proctde_releasetde_opentde_ioctltde_osr_disableirqtde_osr_enableirqTdeOsiCloseTdeOsiOpenTdeOsiIsBusyTdeOsiGetJobNumTdeOsiGetJobNumInFifoTdeOsiGetFiltParamTdeOsiSetFiltParamTdeOsiRegisterMemManageTdeOsiMemRequestTdeOsiMbFillExTdeOsiMbFillTdeOsiOsd2MbTdeOsiMb2MbTdeOsiMbOutBlitTdeOsiSetVideoHandlePriorityTdeCalScaleRectTdeOsiEnableRegionDeflickerTdeOsiPatternFillTdeOsiSetAlphaThresholdStateTdeOsiGetAlphaThresholdValueTdeOsiSetAlphaThresholdValueTdeOsiGetDeflickerLevelTdeOsiSetDeflickerLevelTdeOsiSolidDrawTdeOsiBitmapMaskBlendTdeOsiBitmapMaskRopTdeOsiMbBlitTdeOsiBlitTdeOsiQuickFillTdeOsiQuickFlickerTdeOsiQuickResizeTdeOsiQuickCopyTdeOsiQuickBitblitTdeOsiResetTdeOsiWaitAllDoneTdeOsiWaitForDoneTdeOsiCancelJobTdeOsiEndJobTdeOsiBeginJobExTdeOsiBeginVideoJobTdeOsiBeginJob X ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * P&: -037:=@CFI$@#?"@ @>>>>>=>=<::8$&')*+,./013 4 5 6 77)=(<(;';&:%;$:#:";!:;;99:7)*+ - . / 0 1123456677 ! !  !    ! !                           ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * -037:=@CFI$@#?"@ @>>>>>=>=<::8$&')*+,./013 4 5 6 77)=(<(;';&:%;$:#:";!:;;99:7)*+ - . / 0 1123456677 ! !  !    ! !                           ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * -037:=@CFI$@#?"@ @>>>>>=>=<::8$&')*+,./013 4 5 6 77)=(<(;';&:%;$:#:";!:;;99:7)*+ - . / 0 1123456677 ! !  !    ! !           Q3:                ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * -037:=@CFI DDBCCBAA@?>= = < ; : "$%')*,-/0235678)=(<(;';&:%;$:#:";!:;;99:7)*+ - . / 0 1123456677 ! !  !    ! !                           ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * -037:=@CFI DDBCCBAA@?>= = < ; : "$%')*,-/0235678)=(<(;';&:%;$:#:";!:;;99:7)*+ - . / 0 1123456677 ! !  !    ! !                           ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * -037:=@CFI$@#?"@ @>>>>>=>=<::8$&')*+,.R0:/013 4 5 6 77)=(<(;';&:%;$:#:";!:;;99:7)*+ - . / 0 1123456677 ! !  !    ! !                           ~|zwuqmie`\WR #(-28=BHM b a b ` a ^ \ [ ZYWVSPNL   # & * -037:=@CFISTTSSR Q Q PMMKJGFD!#&)+.1368;=@B)=(<(;';&:%;$:#:";!:;;99:T)*+ - . / 0 112345666* ! !  !    ! !    <(             !      @=6 -!#. 7>@< 91(*4;?@< 91(*4;?@< 91(*4;?>;81!'*05 7 < ;50#').1 2883-#&(,..$# #" "$ $                                    @=6 -!#. 7>@< 91(*4;?@< 91(*4;?@< 91(*4;?>;81!'*05 7 < ;50#').1 2883-#&(,..$# #" "$ $  S%:                                                                                                              @=6 -!#. 7>@< 91(*4;?@< 91(*4;?@< 91(*4;?>;81!'*05 7 < ;50#').1 2883-#&(,..$# #" "$ $                                    @=6 -!#. 7>@< 91(*4;?@< 91(*4;?@< 91(*4;?>;81!'*05 7 < ;50#').1 2883-#&(,..$# #" "$ $                                    @=6 -!#. 7>@< 91(*4;?@< 91(*4;?@< 91(*4;?>;81!'*05 7 < ;50#').1 2883-#&(,..$# #" "$ $                                   T?: @=6 -!#. 7>@< 91(*4;?@< 91(*4;?@< 91(*4;?>;81!'*05 7 < ;50#').1 2883-#&(,..$# #" "$ $                                    hi3521_tdeA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo.rel__param.rodata.str1.4__ksymtab_strings.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4 .ȵ)% 84 $Cx$Z$V h$ U*: d P p/|}(10y DH 2X1I {^l~# 8$ p/K XSJ -0 x8)<AF KN^`jo$tHyd~K K`dK0<HTdp4KKLtK  | D!'K $ KKhlK -  <  K  W f   K Kpp!V):  &D <X8 T7 l  + . KPPD K   0  K@H@^s KtK``NKhhaK$KKX X3; KFTaz$(Kxx/ KHH0<F j8~ttyAoLK##t LKH&X&K&&K''K ($(K((K))K++K--K..K,202K33K440K77HK77\KX8\8K88Kd:h:K::Kd;h;K<<@<K<<K=0=pKAAK8C0KXKvKXXKK((KppKKh4hKHQHK8w8KK\%: KK((K00K+KM4|#<8, o9t9jl9A8y4:~\:`::FD9Kc:K:K;;8;P;;K;{LXT\<<;KHLLT<KK<K04< ==d=D=K!=K=K|l@d>'$>t> >K>>K'?L?!$?K-?3@?0@K E@9X@W@KK@Q$AKKtxAA]\A BAAKK, ,  D  \  -p  <  K  Z  i  x     , < P d |]0:     , K|#;|#M#Y#K8Kfy <HBABFBjBoBtByB~BB0C dCxCKCC,DLDlDDDDDK8EHElEK  EKpK  ) 8  G$  V0 KHBKextTX\t`<EAEFF8 jLFo`FKKK~FtdFyFKF$GKK8 8 L d x KEK`` K KKKP P  Y! K  p+<L7apyX&P,H^3:$$L d. r& `D= @TS @_ 4yo $} L  0, l    H4!lst'!3!=!R!p l!8|!a!$!F!A|!at!Y!!!!@"\zx#"3"Ix@"G"<V"\"q"|"D"."0""x" "k0"j"#|4#Hy #7#,^PJ#JZ#$r#~#tH#|K ##HK ##(#`$$$+$@$X8Y$i$<x$h;$$$($X8 $H$Txp$$7 %$%<%M%dZ%tv%\% %hK%% %$%\ %&4'&2&|J&0]&t&&4&x&&& l&&d &&'0'$ "')'KD?' Q'Wd' Iz'''xH'K '@x'\'0 '(0(| .(02C(I(<_&: _(@h(||(Hh(p(((:((3($($)K3)(F)T)8ef)(|t))()<p)zt)@))xp)\8))**%*:*P*Tg*8w*:*0* *<*H*Vl*p+82+D,S+d+z\u+PJ++ +H4+\8 +`+D,,0#,5,H,@<|a,TjTr,K ,,,4,,,jD,DH-)8-#4-Z4H-ptX-T`w- -0k0-$- -,---d. .4j 1.4PG.c.0s..p.<.$W..|P ..K /E/h:./D?/P/'|f/w//X /|_/t8//(b//x 00$a.LANCHOR0tde_tasklet_func.LANCHOR1tde_cleanup_module.LC0.LC1.LC2$dtde_init_moduletde_osr_isr.LC3.LC4.LC5.LC6.LC7.LC8.LC9.LANCHOR2.LC10.LC11.LC21.LC12.LC13.LC14.LC15.LC16.LC17.LC18.LC19.LC20.LC23.LC24.LC25.LC22.LC27.LC29.LC31.LC33.LC26.LC34.LC32.LC28.LC30__func__.22102__func__.22090C.307.21932__func__.21865__para`%: m_str_g_u32TdeTmpBufH__param_str_g_u32TdeTmpBufW__param_str_g_pszTdeMmzName__ksymtab_TdeOsiOpen__kstrtab_TdeOsiOpen__ksymtab_tde_read_proc__kstrtab_tde_read_proc__mod_license1116__mod_description1115__mod_g_u32TdeTmpBufH77__mod_g_u32TdeTmpBufW76__mod_g_u32TdeTmpBufHtype75__mod_g_u32TdeTmpBufWtype74__mod_g_pszTdeMmzName69__mod_g_pszTdeMmzNametype68__ksymtab_tde_ioctl__kstrtab_tde_ioctl__param_g_u32TdeTmpBufH__param_g_u32TdeTmpBufW__param_g_pszTdeMmzName__ksymtab_TdeOsiClose__kstrtab_TdeOsiClose__ksymtab_tde_write_proc__kstrtab_tde_write_proc__ksymtab_tde_osr_disableirq__kstrtab_tde_osr_disableirq__ksymtab_tde_osr_enableirq__kstrtab_tde_osr_enableirqtde_dev__ksymtab_tde_open__kstrtab_tde_opentde_lockflagsdisablecounts_stTdeGraphicsProcEntryg_TDECountg_TDEUserSpaceCount__ksymtab_tde_release__kstrtab_tde_release__ksymtab_tde_get_procentry__kstrtab_tde_get_procentryTdeHalNodeSetSrc2BaseEx.LC35.LC37.LC36.LC38.LC39.LC40.LC42.LC41.LC43.LC45.LC46.LC44.LC47__func__.19133__func__.19074__func__.19046__func__.18988__func__.17962__func__.17945__func__.17852__func__.17818__func__.17743__func__.17653__func__.17623__func__.17436__func__.17409__func__.17386__func__.17334__func__.17318__func__.17300__func__.17273__func__.17259__func__.17136CSWTCH.324__func__.17068__func__.18269__func__.17048__func__.16972__func__.17020__func__.16912__func__.16794__func__.16773__func__.16877__func__.19205__func__.16737__func__.18135__func__.16820__func__.18041__func__.18110__func__.17991__func__.17010s_u8AlphaThresholdValues_pu32BaseVirAddrs_eDeflickerLevels_bEnAlphaThresholds_stParaTableTdeOsiGetFmtCategoryTdeOsiGetFmtTransTypeTdeOsiDoubleSrcGetOptCodeTdeOsiSingleSrc2GetOptCodeTdeOsiGetInterRectTdeOsiGetHUpdateInfoTdeOsiGetVUpdateInfo.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC56.LC55.LC58.LC57TdeOsiGetScanInfo.LC68.LC70.LC59.LC60.LC61.LC62.LC67.LC66.LC65.LC64.LC63.LC69TdeOsiColorConvert.LC75.LC74.LC73.LC72.LC71TdeOsiSetCla0:ipPara.LC79.LC78.LC77.LC76.LC80TdeOsiSetPatternClipPara.LC81.LC82TdeOsiMbSetClipPara.LC83TdeOsiSetRasterInfoForMbOut.LC84TdeOsiSetNodeFinish.LC86.LC129.LC130.LC131.LC85.LC128.LC127.LC126.LC125.LC124.LC123.LC122.LC121.LC120.LC119.LC118.LC117.LC116.LC115.LC114.LC113.LC112.LC111.LC110.LC109.LC108.LC107.LC106.LC105.LC104.LC103.LC102.LC101.LC100.LC99.LC98.LC97.LC96.LC95.LC94.LC93.LC92.LC91.LC90.LC89.LC88.LC87TdeOsiSetFilterChildNode.LC132.LC133.LC135.LC134.LC136TdeOsiSetFilterNode.LC137.LC138.LC139.LC140TdeOsiSingleSrc1Blit.LC141.LC143.LC142TdeOsi1SourceFill.LC145.LC146.LC149.LC148.LC147.LC144.LC150.LC152.LC153.LC154.LC155.LC151TdeOsiSetBaseOptParaForBlit.LC158.LC160.LC157.LC159.LC156TdeOsiSingleSrc2Blit.LC161.LC162TdeOsiYC422TmpOpt.LC163.LC164.LC167.LC166.LC165TdeOsiDoubleSrcBlit.LC170.LC169.LC168.LC171.LC172TdeOsi2SourceFill.LC173.LC175.LC174.LC176.LC177.LC178.LC179.LC181.LC180.LC182.LC183.LC184.LC185T.589.LC188.LC187.LC186.LC190.LC191.LC200.LC193.LC202.LC212.LC196.LC199.LC206.LC194.LC201.LC211.LC195.LC197.LC210.LC209.LC205.LC208.LC198.LC189.LC192.LC204.LC207.LC203TdeOsiMbOutBlitCbCr.LC215.LC213.LC214TdeOsiMbOutBlitY.LC216.LC218.LC219.LC217.LC222.LC223.LC221.LC220.LC226.LC224.LC225__func__.18500__func__.18571CSWTCH.526__func__.21652__func__.21556__func__.19286__func__.21463__func__.21403CSWTCH.520__func__.16478__func__.16446__func__.23132__func__.23095__func__.17439__func__.16853s_u8FmtBitAndOffsetArray__func__.19738__func__.19822__func__.19880g_enTdeCommonDrvColorFmtg_enTdeArgbOrder__func__.22166__func__.20121__func__.18341C.377.20059__func__.18707__func__.20511__func__.20396__func__.18928__func__.20296__func__.16958__func__.21805__func__.17072CSWTCH.523__func__.20547__func__.17143g_enTdeFilterMode__func__.20822__func__.20652__func__.17209__func__.19443__func__.21916__func__.19080__func__.21133__func__.2128b3:0__func__.21218__func__.20254__func__.20235__func__.20204__func__.20180__func__.20165__func__.20150__func__.19589g_enTdeMbDrvColorFmt__func__.20969__func__.19391__func__.17645__func__.18836__func__.17834CSWTCH.539__func__.22360__func__.22259__func__.22464__func__.22823__func__.22659__ksymtab_TdeOsiWaitForDone__kstrtab_TdeOsiWaitForDone__ksymtab_TdeOsiBeginJobEx__kstrtab_TdeOsiBeginJobEx__ksymtab_TdeOsiMbFill__kstrtab_TdeOsiMbFill__ksymtab_TdeOsiMemRequest__kstrtab_TdeOsiMemRequest__ksymtab_TdeOsiIsBusy__kstrtab_TdeOsiIsBusy__ksymtab_TdeOsiQuickFlicker__kstrtab_TdeOsiQuickFlicker__ksymtab_TdeOsiGetDeflickerLevel__kstrtab_TdeOsiGetDeflickerLevel__ksymtab_TdeOsiBeginJob__kstrtab_TdeOsiBeginJob__ksymtab_TdeOsiMbOutBlit__kstrtab_TdeOsiMbOutBlits_bRegionDeflicker__ksymtab_TdeOsiReset__kstrtab_TdeOsiReset__ksymtab_TdeOsiQuickResize__kstrtab_TdeOsiQuickResize__ksymtab_TdeOsiGetJobNumInFifo__kstrtab_TdeOsiGetJobNumInFifo__ksymtab_TdeOsiQuickBitblit__kstrtab_TdeOsiQuickBitblit__kstrtab_TdeOsiGetJobNum__kstrtab_TdeOsiGetFiltParam__kstrtab_TdeOsiSetFiltParam__kstrtab_TdeOsiRegisterMemManage__kstrtab_TdeOsiMbFillEx__kstrtab_TdeOsiOsd2Mb__kstrtab_TdeOsiMb2Mb__kstrtab_TdeOsiSetVideoHandlePriority__kstrtab_TdeCalScaleRect__kstrtab_TdeOsiEnableRegionDeflicker__kstrtab_TdeOsiPatternFill__kstrtab_TdeOsiSetAlphaThresholdState__kstrtab_TdeOsiGetAlphaThresholdValue__kstrtab_TdeOsiSetAlphaThresholdValue__kstrtab_TdeOsiSetDeflickerLevel__kstrtab_TdeOsiSolidDraw__kstrtab_TdeOsiBitmapMaskBlend__kstrtab_TdeOsiBitmapMaskRop__kstrtab_TdeOsiMbBlit__kstrtab_TdeOsiBlit__kstrtab_TdeOsiQuickFill__kstrtab_TdeOsiQuickCopy__kstrtab_TdeOsiWaitAllDone__kstrtab_TdeOsiCancelJob__kstrtab_TdeOsiEndJob__kstrtab_TdeOsiBeginVideoJob__ksymtab_TdeOsiMbBlit__ksymtab_TdeOsiQuickFill__ksymtab_TdeOsiBitmapMaskBlend__ksymtab_TdeOsiSetFiltParam__ksymtab_TdeOsiEndJob__ksymtab_TdeOsiOsd2Mb__ksymtab_TdeOsiWaitAllDone__ksymtab_TdeOsiPatternFill__ksymtab_TdeOsiSolidDraw__ksymtab_TdeOsiBegic&: nVideoJob__ksymtab_TdeCalScaleRect__ksymtab_TdeOsiGetAlphaThresholdValue__ksymtab_TdeOsiQuickCopy__ksymtab_TdeOsiSetVideoHandlePriority__ksymtab_TdeOsiGetJobNum__ksymtab_TdeOsiSetDeflickerLevel__ksymtab_TdeOsiGetFiltParam__ksymtab_TdeOsiEnableRegionDeflicker__ksymtab_TdeOsiCancelJob__ksymtab_TdeOsiSetAlphaThresholdState__ksymtab_TdeOsiMbFillEx__ksymtab_TdeOsiSetAlphaThresholdValue__ksymtab_TdeOsiBitmapMaskRop__ksymtab_TdeOsiBlit__ksymtab_TdeOsiRegisterMemManage__ksymtab_TdeOsiMb2MbTdeOsiListReleaseHandleTDEOsiListSubJobTDE_FreePhysicBuffTdeOsiListFreeSerialCmdTdeOsiListDestroyJobTdeOsiListDoFreePhyBuffWithLockTDE_AllocPhysicBuff__func__.18430__func__.18450__func__.15911__func__.17805__func__.18734__func__.18631__func__.18506__func__.17861__func__.17986__func__.18549__func__.17791__func__.18234__func__.18002__func__.15854__func__.18358__func__.18272__func__.17925__func__.18059__func__.18705__func__.18022__func__.18166s_u32TdeFifoDepths_tplhandles_normhandles_pstTDEOsiJobLists_pstTdeHandleLists_u32TDEPhyBuffs_u32TDEBuffRefs_s32HandleNums_TdeBeginJobWqs_TdeBlockJobWqs_stTdeWaitAll__key.17834__key.17835__key.17836__key.18351__func__.10989__func__.10870__func__.11076__func__.11004__func__.10927g_struMemBlockg_u32MemPoolVrtAddrg_u32MemPoolSizeg_u32MemPoolPhyAddr__func__.13538__func__.13378__func__.13319__func__.13343s_stTplLib__module_depends__mod_vermagic5TDE_DEBUG_PRT_SFCATTRDebugPrtTplNodesTdeOsiMbOutBlitTdeHalNodeSetClutOptTdeOsiListTermfree_irqTdeHalFillAddrByTypewgetphyTdeOsiListSubmitJobTdeOsiListGetPhyBuffmisc_deregisterTdeHalGetAlphaThresholdStateparam_ops_uintwprintmeminfoTdeOsiMbBlitTdeCalScaleRectTdeHalNodeSetSrcMbCbCrTdeOsiListWaitForDoneTdeOsiMb2MbTdeOsiCancelJob__this_moduleTdeOsiSetMbOutCbCrS2AddrTypesnprintftde_osr_enableirqTdeOsiOpenTdeTplIsTemplateExist__arm_ioremapTdeHalNodeSetHFObjTypeTdeHalNodeEnableAlphaRopTdeOsiCheckOverlapfinish_wait__iounmapg_u32TdeNdCurProcNumTDEOsiListIsTPLTypeHandled<:TdeOsiLstIsBusyTdeHalReleaseTdeOsiOsd2MbTdeHalNodeSetSrc1TdeHalNodeSetTgtTdeHalInitTdeHalNodeMakeNdTdeOsiListResetunmap_mmbcleanup_moduleg_u32TdeTmpBufHTdeOsiBeginVideoJobprepare_to_waitTdeHalSubJobmemcpyTdeHalCtlResetkfreeTdeOsiListPutPhyBuffenable_irqTdeHalNodeSetSrc1ExTdeHalNodeSetResizeDebugPrtTplLibInfo__wake_upfreeUnitTdeTplDestroyLibTdeOsiGetJobNumTdeOsiIsBusydelete_mmbTdeOsiQuickFillTdeOsiEndJobTdeHalNodeSetVFObjTypeTdeHalSetFiltParamTdeOsiSolidDrawTdeHalGetAlphaThresholdinit_modulewgetvrtTdeOsiGetAlphaThresholdValuecreate_proc_entryTdeOsiGetAlphaThresholdStateTdeOsiCloseTdeHalCtlIsIdleTdeOsiListIsCompletedschedule_timeoutscheduleg_astModulesTDE_TPL_MAKE_KEYINFOTdeHalFreeMmzOfFiltParamg_pFuncMallocCbTdeOsiListInitTdeHalNodeSetExpAlphaTdeOsiSetVideoHandlePriorityTDeHalNodeSetCscTdeOsiQuickBitblitTdeHalOpenTdeOsiWaitAllDoneremap_mmbTdeHalNodeSetColorizeTdeHalNodeSetS1AddrTypeTdeHalNodeSetIsHasAlphakmem_cache_alloctde_printcmdTdeOsiGetPatternOptCategorytde_get_procentryTdeOsiQuickFlickerTdeOsiSetAlphaThresholdStatetde_osr_hsrtde_write_procTdeOsiListGetJobNumInFifoOrgVfCoefTdeHalNodeSetTarAddrTypeTdeOsiListSqUpdateProcTdeOsiBlitTdeHalNodeSetS2AddrTypeTdeTplInitTemplateTdeOsiListGetPhyBuffExtde_taskletTdeOsiListIntProcTdeOsiMbFill__aeabi_idivflush_mmb_byaddrmallocUnitrequest_threaded_irqwfreeTdeOsiListWaitAllDoneg_pstnodecmdTdeHalCtlIntStatstde_ioctlstrstrTdeOsiBitmapMaskBlendTdeOsiQuickResizeTdeHalGetFiltParamTdeHalNodeInitChildNdwmemtermnew_mmbTdeOsiListFlushJobTdeOsiGetDeflickerLevelTdeOsiResetwgetfreenumTdeOsiDoubleSrcPatternFillTdeOsiSingleSrcPatternFilltde_osr_disableirqTdeHalSetDeflicerLevelTdeHalNodeSetFlickerpanicTdeHalCtlIsIdleSafelywmeminitTdeOsiListCreateTpltde_fopstde_openTdeTplAddToLibprintkTdeOsiPatternFillTdeOsiSetMbOutCbCrTarAddrTypeTdeHalNodeSetClippingTDE_DEBUG_PRT_MBATTRTdeHalGetDeflicerLevelTdeOsiSetAlphaThresholdValueTdeTplIsTplLibFullg_pFuncFreeCbTdeHalNodeSetSrc2tde_ree): ad_procproc_mkdirTdeHalNodeSetMbModeTdeOsiGetFiltParamTdeOsiBeginJobTdeHalSetClockmemsetTdeOsiWaitForDoneTdeOsiPatternBlit__memzeromisc_registerparam_ops_charp__aeabi_uidivTDEOsiListTplPrepare__init_waitqueue_headTdeOsiListPutPhyBuffExgs_u32TdeProcEnTdeHalNodeSetAlphaBordertde_releaseTdeHalSetAlphaThresholdStateTdeHalNodeSetBaseOperateTdeTplCreateTemplateTdeHalCtlFifoIntStatsTdeOsiCheckDoubleSrcPatternOptTdeOsiListGetBuffTypeTdeOsiListSetVideoHandlePrioritygs_u32TdeTraceEnTdeOsiBeginJobExTdeHalFillLastNodeNextInfoOrgHfCoefg_u8TdeNdCmdCurProcNumbTdeHalSwVersionTdeHalNodeSetBlendTdeOsiListCreateTaskByTplg_u32TdeTmpBufStrideremap_mmb_cachedTdeTplInitLibremove_proc_entryTdeOsiSetFiltParamTdeHalNodeSetGlobalAlphaTdeOsiMemRequestTdeHalUpdateHwAddrTdeTplDeinitLibschedule_workTdeTplSearchAndUpdate__aeabi_uidivmodTdeOsiMbFillExTdeOsiRegisterMemManageTdeHalNodeGetNdSizeTdeHalNodeAddChildTdeHalFillHFilterAddrByTypeTdeHalLoadFiltParamMemoryBlockInitTdeOsiCheckSingleSrcPatternOptTdeOsiListAddNodeTdeOsiGetJobNumInFifoTdeOsiListGetJobNumTdeHalSetAlphaThresholdg_pszTdeMmzNameTdeHalNodeSetColorConvertTdeHalResumeInitg_pstTdeHwNodeTdeOsiEnableRegionDeflickerTdeHalNodeSetColorKeyTdeHalFillVFilterAddrByTypeDebugPrtTplInfoautoremove_wake_functionTdeOsiListBeginJobg_u32TdeTmpBufWTdeHalNodeInitNdg_u32TdeMallocCntTdeOsiQuickCopy__copy_to_userTdeOsiSetDeflickerLevelTdeHalNodeSetSrcMbYTdeHalNodeSetRopTdeHalSystemInitTdeTplDelFromLibTdeHalNodeSetBlendRvs__copy_from_usertde_osr_freevmemwmallocTdeHalAllocMmzForFiltParamTDE_TPL_GET_INDEXkmalloc_cachesTdeOsiBitmapMaskRopTdeOsiListFreePendingJobTdeOsiListFlushNodedisable_irqTdeOsiListCancelJob+,<+@,h+l,<+ , ~+,+,,+0,T5+4,4++,,+,,D+T,X`f*: +"+#,",#`+"+$,",$` +"+%,",% `0+"4+&8,"<,&D`T+"X+'\,"`,'h`x+"|+(,",(`+"+),",)`+"+*,",*`+"++,",+`+" +,,",,`8+<,Tzh+-p,-t`+.,.$`(+,,+/,/`+/ ,/0`+"+#,",#`LPTX\`dhlp|+"+,,",,`+"++,",+`+"+*,",*`+"+) ,"$,),`L+"P+(T,"X,(``+"+',",'`+"+&,",&`+"+%,",%` +" +$$ ,"( ,$0 `L +/T ,/l ` +" +# ," ,# ` W +" +, ," ,, ` +"$ ++( ,", ,+4 `H +"L +*P ,"T ,*\ `p +"t +)x ,"| ,) ` +" +( ," ,( ` +" +' ," ,' ` +" +& ," ,& ` +" +% ," ,%$ `8 +"< +$@ ,"D ,$L `| +4 ,4 `  3 +7 ,7  +8 ,8 ( +9, ,90 @ +:D ,:H h l +p , +; ,;  + , +< ,<  + , += ,=  + , +> ,>  + , +? ,?   38w\3\D3n83`x, 30+lg?:3343D"Xh3+8,8 3|3T93X3$`3p3]3 H33-03L38,Th|(|@+D,l+p,+,: +,\`h+,+, +$,H+L,+,+,P+T+X,\,+,+,+,+,+,+,0+4,T+X, +$ +( +, +0 ,4 ,8 ,< ,H L +P ,T \!+`!,|!+!+!,!,!!+!,"+","+"+","," #+#,,#+0#+<#,@#,H#P#+T#+X#+\#+`#,d#,h#,l#,|#+#+#,#,#####+#+#+#,#,#,#$+$,$$+$,$+$,$$+$,|%+%,%+%,%%+%,%+%,%&+&+&+ &,&,&,(&+0&,@&H&L&P&T&&&&&&&&&&&&&&&@'+D'+H',L',P'+X',d'h'+l',p'''+'+',','+(,((+(,( ((+(+(,(,(+(,((+(,((,)+0)+4)+8),<),@),L)P)+T),X)\)+`)+d)+h),l),p),)++h?:+++++d-+h-+l-+p-,t-,x-,--+-,--+-+-+-,-,-,-P.+T.+X.+\.,`.,d.,p.t.+x.,|..+.+.+.,.,.,..+/,/+/,1+1+1+1,1,1,11+2,22+ 2+2+2,2,2,,2T2+X2,3+3+3+3,3,3,33+3,33+3+3+3,3,3,3p4+t4+x4+|4,4,4,44+4,44+4+4+4,4,4,46+6+6+6,6,6,66+6,66+6+6+6,7,7,77+7+7+7,7,7,77+7,77+7+7+7,7,7,7$8+(8+,8,08,48+<8,H8L8+P8,T8X8888888888888880:+4:+8:,<:,@:+H:,T:X:+\:,`:d::+:+:,:,:+:,::+:,::0;+4;+8;,<;,@;+H;,T;X;+\;,`;d;<+ <+<,<,<+ <,,<0<+4<,8<<<<+<+<,<,<+<,<<+<,<<<+<,== ===== =$=(=,==+=,=|>+>,>\?+`?,? A+$A+(A+,A,0A,4A,@ADA+HA,LAPA+TA+XA+\A,`A,dA,tA+xA+|A+A,A,A,A+Ai*: +A+A,A,A,AA+A,C+C+ C,C,C+C,(C,C+0C,4C8CD+ D+D+D,D,D,(D,D+0D,4D8D++W>,W>(>+,>,<>+XD>,XP>\>+`>,p>+x>,>>+>,>+`>,`>4?+8?,H?+_P?,_\??+?,?+a?,a?D@+KH@,Kt@@+@,@+[@,[@@pA+*tA,*|AA5A5AaAAA)B+B,4BLB`BdBaB+B,B+[B,[BB+B,C+UC,UC(C+,C,O @P0  : Un@ZT%ZM* *J=b0A ,0 0-L .O0@P00Un@ZT,%ZM J 0 -LlO0*b"@S/ *O "@\ O 0@S@O 0@}@SO 0@S=1OQ -L 0 0 -L @0 -L00@P R0 0  R00000 -LP00@ -LR L R 0S @ S Q = QR \P  -LR P 0S @ S Q = Q P -L$MPP@〒R0@P < P4 } pt `D 8 4 ;040 US t  t0cX RX XZB30 P HVE !0 LZMU 8  !t0Rt 81/X9 p @V T? Pz3QP < p4 000  4\0 4 |@@0@ @VD 0H H!0  4(K@ 004\ 4  r0000 x-L00@@`PUxPU 0S `PV $PUx$ -L0P0@ 0P*)@ -L,M H 0@L SN QLxPUI@`K }?@㐁pP T p 0H S xP'  H\* L^'x R$PT0 PP`PPP< 80 4 0   ! :@LL H\$LP(KL0S@H Qm $ m0@$ @ -LMP` 0l`@da@a RtK[!Zf?X]Yq\\ c㳠ĂK 废澙Kp K e/p[KKpK:p #@`#`@, T 0〠 @\ 刐 %3!Epp[P[p0 ppK`w0 PKqp  㬓p K@p[o[倠X[张 縗KoK弐XK|[vp[ f[p'[PKpK哠vpKfK|K|0pWpu0K6Kp⇙d0 P ɠX 'K F [ \l %lp 5h@O x0Dp4K4K~D0 F KK~0H00S1  0SR0 P* 帐 ?0/2K$(Kqp[0@0p0K尅K]``KH 0 1Ͽ4 $:8 (03< ,>o@` W00P@ -L 0S  @ 0-L@@@P0S0P 0S0 -L@@@ 00@ x-L @@@`1PU @\  00 -LM`p@Q PP@PP@ : Q`  `$A/2K$$` 0 S 0 0 X 0A0P `Z0!$#R0S  0SR0 @ (K!00@ -LP 00@R2` @Q P PZU @Q Ppp嘀pQQ UP P \P PUPPPUQ`@@@P U@   -L  0  -L@`p@P@ -L -L@@@D`Q d0S @@`@`@`@` -L@ -L -L -L -L 0-LPP@d0S@@Q L P0TXaT X0 l\` dP00@ d0 p-L M@$ @P`0 R.!0 0@@df?c ?/s0r @Kp 0-LxMP@K$([@([@ @ @'[@z [@y [@p @l @h @d[ @&[@^0[ @] [@%[@ɠ)X0[ @X [R"@X["@X0[S#@X [@#W[ @W0[ @W [R!@%[@T @%[@N[ @L @$[@D @@0[*: @< @8 [ @8@ #[@#[@.0[ @, @( @$ @ @ @ R @K0 x-LPP@`d0S @@ R dPx 0-LMP@K$ 0@ | 0xtpl h$d(`,\0X4T8P  Ps RDP09/0PNPSkPpP0S0 0 @P`RP P1S HLQ5T !V%W (KPA @P<< Q W``` PQP$`@0 PK$ W $P1`P P T P @H@P@@@ -L$M8 `@PH1S (KP1S @< Rpp@H D 0RD R  0  !0KP X p0PqH^<: pP H\T@ %8 1QL@` ) 8*`R ! ꐠP%f1Q< *`R !0`1 `0 JP@T`Td0PT0 d@`XP!$<\=PÖ03L Ln@`P1$|<0Xb @\<Q @ WXO H 0ϑ0$0x @D` @&@<@1  !@Y -LDM@R@ p`P0S DP  R 0S P  0SPP@@H1S (K@P1S^ @H ^\@ 0R @0 00 @ 1 !@0KPL  p$@`V%@  `PD @00@P$厣| U|PTCJ @ D P T ?8 08  003S TiZ< PdJD@T  P 8 @T08  003Ss TJ< PdR< J 0P @8@ @ Tj 08  003S\ T- <0PdP C@< T8 P @ @@D TD3 nPP 0oS00 Wʃ1T4@U @1   !V Xn@P1$H R@@P1#LL8 P  P P@@ d2D @TD nPP ~@ R P0@T@0l0@ 0L0 8 P0 P@@):  @T1lPP P @@ @D gHX'L@L HX6@`@P`$3x xcXtL@$0@@ x@L@1 !@@ ?$ @P @ @ -L@`P HQ`P1SN V  P  R Q`( Q !`Pphh#PqR7H fXLQ@!1S   4description=TNK-2G Ethernet/TOE driverparm=max_connections:Maximum Concurrent TOE Connectionsparmtype=max_connections:intparm=buf_sz:DMA buffer sizeparmtype=buf_sz:intparm=tc:DMA threshold control valueparm<: type=tc:intparm=pause:Flow Control Pause Timeparmtype=pause:intparm=flow_ctrl:Flow control ability [on/off]parmtype=flow_ctrl:intparm=dma_rxsize:Number of descriptors in the RX listparmtype=dma_rxsize:intparm=dma_txsize:Number of descriptors in the TX listparmtype=dma_txsize:intparm=phyaddr:Physical device addressparmtype=phyaddr:intparm=debug:Message Level (0: no output, 16: all)parmtype=debug:intparm=watchdog:Transmit timeout in millisecondsparmtype=watchdog:intlicense=GPLparm=hitoe:0:Bypass 1:TOEparmtype=hitoe:intparm=tnk_threshold:min:100bytes, typical:10x1024bytes,default:10*1024bytesparmtype=tnk_threshold:intparm=tnk_tx_fifo:min:16, max:1024, default:32parmtype=tnk_tx_fifo:intdepends=vermagic=3.0.8 mod_unload ARMv7 <3>%s: must be stopped to change its MTU <3>%s: invalid MTU, max MTU is: %d <4>%s: can't change I/O address <6> %d [0x%x]: DES0=0x%x DES1=0x%x BUF1=0x%x BUF2=0x%x<6> <6>%s: removing driver include/linux/netdevice.h<6>netif_stop_queue() cannot be called before register_netdev() <3>%s: BUG! Tx Ring full when queue awake <4>%s: Speed (%d) is not 10 or 100! %x%s:%02x<3>%s: Could not attach to PHY <3>%s: Cannot attach to PHY (error: %d) <4>%s: generated random MAC address %pM <3>%s: Inconsistent Rx descriptor chain <3>%s line %d dirty point should be sethere is wrong. <3>%s dirty point should be set,here is wrong <3>%s dirty point has passed current point,line = %d <6>STMMAC driver: platform registration... <6> done! <6>Set system config register 0x200300ec with value 0x003f003f <3>%s: ERROR: memory allocation failedcannot get the I/O addr 0x%x <3>%s: ERROR: memory mapping failed <3>%s: ERROR: allocating the device <6> PMT module supported <6> Enhanced descriptor structure <3>%s: ERROR %i registering the device <3>No PHY device is associated with this MAC! <6> %s - (dev. name: %s - id: %d, IRQ #%d IO base addr: 0x%p) <3>%s: Failed to reset GMAC <6>%s: RESET COMPLETE! <6> ********************?: ****************************** <6>* TNK driver built on %s at %s Jan 24 201702:23:00BYPASSTOE<6>* TNK driver mode is %s <6>************************************************** <6>stmmac: Rx Checksum Offload Engine supported <6> TX Checksum insertion supported <3>%s:ERROR allocating the DMA Tx/Rx desc <3>%s: Rx init fails; skb is NULL <6>RX descriptor ring: <6>TX descriptor ring: <3>%s: DMA initialization failed <3>%s: ERROR: allocating initialising TNK proc interface (error: %d) <3>%s: ERROR: allocating initialising TOE engine (error: %d) <3>%s: ERROR: allocating initialising TOE connection manager (error: %d) <3>%s: ERROR: failed to initialise TNK components (error: %d) stmmaceth<3>%s: ERROR: allocating the IRQ %d (error: %d) <4> no valid MAC address for MAC %d;please, use ifconfig or nwhwconfig! <3>GMAC0 dev not yet initialised <3>GMAC0 priv not yet initialised phyirq<3>No PHY devices registered! <3>No STMMAC devices registered! <6>%s %s for %u GMAC%u stmmac %s: descriptor ring: GMAC%u cur=%u (%u) GMAC%u dirty=%u (%u) GMAC%u logic=%u GMAC%u dirty count=%u (of %u) GMAC%u out_of_order=%d %3d [0x%08x] / [0x%08X]: DES0=0x%08x DES1=0x%08x BUF1=0x%08x BUF2=0x%08x <= cur <= dirty <= logic <6>%s da=%x phy=%x sz=%d rxtxgmac%d intr_enable=%d gmac%d interrupts=%d gmac%d rx=%d gmac%d rxfill=%d polls_done=%d interrupts=%d cpu %d irq invokes=%d cpu %d softirq invokes=%d cpu %d other invokes=%d cpu %d polls=%d cpu %d xmits=%d max simultaneous rx=%d max simultaneous tx=%d stmmacphy/home/embedded_3521/kernel/linux.3521/build/linux-3.0.y/drivers/net/stmmac/stmmac_ethtool.c<6>stmmac: wakeup enable st_mac100st_gmacJun_2011<3>%s: %s: PHY is not registered <3>%s: interface is disabled: we cannot track link speed / duplex setting <3>Can not get mdio clk. STMMAC MII Bus%x<3>%s: Cannot register as MDIO bus active<6>%s: PHY ID %08x at %d IRQ %d (%s)%s <4>%s: No PHY fo*:und <6>MACADDR in get is %x:%x:%x:%x:%x:%x <6>MACADDR in set is %x:%x:%x:%x:%x:%x <6>Got MMC interrupt <6>Interrupt status: Rx 0x%08x, Tx 0x%08x, Csum 0x%08x <6>Interrupt masks: Rx 0x%08x, Tx 0x%08x, Csum 0x%08x <6>Reading counters to clear MMC interrupt <6>Done <6>%s: unexpected status %08x <6> DWMAC1000 regs (base addr = 0x%p) <6> Reg No. %d (offset 0x%x): 0x%08x <6> DWMAC1000 - user ID: 0x%x, Synopsys ID: 0x%x <6> DMA registers chan %d <3> Reg No. %d (offset 0x%x): 0x%08x <6> ---------------------------------------------- DWMAC 100 CSR (base addr = 0x%p) ---------------------------------------------- <6> control reg (offset 0x%x): 0x%08x <6> addr HI (offset 0x%x): 0x%08x <6> addr LO (offset 0x%x): 0x%08x <6> multicast hash HI (offset 0x%x): 0x%08x <6> multicast hash LO (offset 0x%x): 0x%08x <6> flow control (offset 0x%x): 0x%08x <6> VLAN1 tag (offset 0x%x): 0x%08x <6> VLAN2 tag (offset 0x%x): 0x%08x <6> MAC management counter registers <6> MMC crtl (offset 0x%x): 0x%08x <6> MMC High Interrupt (offset 0x%x): 0x%08x <6> MMC Low Interrupt (offset 0x%x): 0x%08x <6> MMC High Interrupt Mask (offset 0x%x): 0x%08x <6> MMC Low Interrupt Mask (offset 0x%x): 0x%08x <6> DWMAC100 <4>ndesc Error: Oversized Ethernet frame spanned multiple buffers /home/embedded_3521/kernel/linux.3521/build/linux-3.0.y/drivers/net/stmmac/tnkct.c<4>%s: Failed to drain TTX queue for connection %d (%d bytes unacknowledged/discarded) <3>%s: MAC header not set in outgoing skb %s: TTX max Retries exceeded on connection %d <3>%s: Failed to allocate memory for connection table <3>%s: Failed to register inetaddr notifier <3>%s: Failed to register inet6addr notifier <3>%s: Failed to allocate memory for deferred work item <3>%s: net_device pointer for connection %d is NULL, dropping packet <4>%s WARN recevied full packet that isn't FIN or RST tnkct: connection count=%d: max retries=%d: discards=%d: ttx_drain_fails=%d: tcp_ ):memory_pressure=%d: tcp_memory_allocated=%d: <4>%s: WARNING - reentrancy detected summarystatsctbypasstnk TNK Conn[%4d]: S-IP=%pI6 D-IP=%pI6 S-IP=%pI4 D-IP=%pI4 sport=%d dport=%d info=%s r_macaddr_u16: 0x%04x l_port: %u r_macaddr_l32: 0x%08x r_ipaddr: 0x%08x r_port: %u ttl: %u tos: %u rx_ack_num: 0x%08x next_tx_seq_num: 0x%08x next_rx_seq_num: 0x%08x dup_ack_cnt: %u rx_adv_wnd: %u timer_tx_retry: %u retry_count: %u tx_mss: %u adv_wnd_scale: %u flag_conn_enable: %u flag_mac_sel: %u flag_ipv6: %u flag_disable_nagle: %u flag_use_local_wnd: %u flag_use_local_scl: %u flag_full_pkt: %u tx_adv_wnd: %u cong_wnd: %u timer_timestamp: %u timer_active: %u timer_seq_num: %u timeout_value: %u sampled_ack_num: 0x%08x timer_rx_fast_retry: %u retry_seq_num: 0x%08x en_rtt_calc: %u ss_threshold: %u tx_timestamp: %u timer_rtt: %u timer_rtt_valid: %u last_retry_seq_num: 0x%08x r_ipv6_addr_31_0: %u r_ipv6_addr_63_32: %u r_ipv6_addr_95_64: %u r_ipv6_addr_127_96: %u r_ipv6_flow_label: %u tx_desc_sent: %u tx_desc_ackd: %u tx_bytes_sent: %u tx_bytes_ackd: %u tx_overflow: %u rx_pkts: %u rx_dropped: %u tx_dfetch_desc: %u tx_dfetch_data: %u tx_dfetch_own: %u tx_retry_desc: %u tx_retry_data: %u tx_ackd_read: %u tx_ackd_size: %u tx_ackd_write: %u rx_premature_eop: %u rx_bad_ethertype: %u rx_bad_dst_macaddr: %u rx_tcp_csum_err: %u rx_iphdr_csum_err: %u rx_non_tcp_prot: %u rx_bad_dst_ipaddr: %u rx_connection_err: %u rx_bad_seq_num: %u rx_busy_pkt_drop: %u rx_toe_err: %u tx_acked_count: %u tx_retry_count: %u rxed_byte_count: %u ttx_pipelined_bytes: %u tx_block_num: %u tx_max_data_size: %u sent %d received %d snd_nxt %10u / %d snd_una %10u / %d (%d in queue) rcv_nxt %10u / %d copied_seq %10u / %d (%d in queue) sk-rx-q %d tnk-rx-q %d tnk-tx-q %d wmem_queue %d sndbuf %d sock flags 0x%lX stat!<: e %d send-rate %d.%02dM recv-rate %d.%02dM total send-rate %d.%02dM total recv-rate %d.%02dM <3>%s: failed to create proc file %s <3>%s: failed to create proc file IRQ SoftIRQnormal Interpt%dnone%s cpu=%s sk=%p tnk=%-4.4s state %s => %s %s entry %d created %s begin /home/embedded_3521/kernel/linux.3521/build/linux-3.0.y/drivers/net/stmmac/tnktcp.c<4>%s used more than a full skb?? %s: sk %p chan %d %s: No write space on sk %p <3>%s: failed to allocate skb <4>%s: OOB flag was set %s aborting %s returning %d <3>%s failed to alloc skb for %d bytes of data %s seglen=%d, skb-len=%d, skb-headlen=%d nfrags=%d truesize=%d total=%d <3>%s failed to copy data <6>%s nfrag=%d headlen=%d truesize=%d <6>%s off=%d len=%d <4>%s WARN - packets out is %d %s: Got sk %p, skb %p <3>%s: skb->dev is NULL <3>%s: skb->dev priv data is uninitialised <6>%s:%d: sk struct is NULL. <6>%s:%d: seq is NULL. <6>%s:%d: iov is NULL. <6>%s:%d: length is too short. %s tnkinfo state = %d, sk=%p OPENPREPAREDESTABLISHEDACTIVATINGACTIVESTOPPINGSTOPPEDCLOSEDtnktnk_tcp_persist_timetnk_tcp_rtt_sample_intervaltnk_bypasstnk_thresholdtnk_poll_limittnk_rx_q_limitcontrol_dbgmax_mss/home/embedded_3521/kernel/linux.3521/build/linux-3.0.y/drivers/net/stmmac/tnklock.c%s ERROR can't unlock, nested unlock attempt %d tnkmem: skbs allocated: %d bytes allocated: %d skbs queued write: %d bytes queued write: %d skbs queued read: %d bytes queued read: %d skbs queued recycle: %d /home/embedded_3521/kernel/linux.3521/build/linux-3.0.y/drivers/net/stmmac/tnkhw.c<3>%s: Invalid gmac %d specified <6>r_macaddr_u16 %8x <6>l_port %8x <6>r_macaddr_l32 %8x <6>r_ipaddr %8x <6>r_port %8x <6>ttl %8x <6>tos %8x <6>rx_ack_num %8x <6>next_rx_seq_num %8x <6>next_tx_seq_num %8x <6>dup_ack_cnt %8x <6>rx_adv_wn"?: d %8x <6>timer_tx_retry %8x <6>retry_count %8x <6>tx_mss %8x <6>adv_wnd_scale %8x <6>flag_conn_enable %8x <6>flag_mac_sel %8x <6>flag_ipv6 %8x <6>flag_disable_nagle %8x <6>flag_use_local_wnd %8x <6>flag_use_local_scl %8x <6>flag_full_pkt %8x <6>tx_adv_wnd %8x <6>cong_wnd %8x <6>timer_timestamp %8x <6>timer_active %8x <6>timer_seq_num %8x <6>timeout_value %8x <6>sampled_ack_num %8x <6>timer_rx_fast_retry %8x <6>retry_seq_num %8x <6>en_rtt_calc %8x <6>ss_threshold %8x <6>tx_timestamp %8x <6>timer_rtt %8x <6>timer_rtt_valid %8x <6>last_retry_seq_num %8x <6>ipv6_addr_31_0 %8x <6>ipv6_addr_63_32 %8x <6>ipv6_addr_95_64 %8x <6>ipv6_addr_127_96 %8x <6>ipv6_flow_label %8x <3>%s: Got error, cindex = %u, add = %d, retry = %u <3>%s: TTX error 0x%08x (cid %d) <6>%s cindex %d, head %d, tail %d <6>TTX Descriptor (chan %u, ring index %u) ack_offset: %u reserved1: %u hw_own: %u buffer_size: %u reserved2: %u intr_on_completion: %u buffer_ptr: 0x%08X next_desc_ptr: 0x%08X <3>%s ERROR skb is not DMA mapped! <3>%s ERROR skb is already DMA mapped! <3>%s: DMA Mapping Error <4>%s: Rx init fails; skb is NULL <3>%s: Invalid/empty skb <3>%s: Failed to allocate memory for connection stats <3>%s:ERROR allocating DMA Rx skbuff pointers <3>%s:ERROR allocating DMA Rx skbuff DMA pointers <3>%s:ERROR allocating DMA Rx descriptors <3>%s: Failed to set initialise Rx DMA channel <3>%s: Failed to allocate memory for TX DMA info table <3>%s: Failed to allocate memory for TX skbuff table <3>%s: ERROR allocating DMA Tx descriptor list tnkhw: rx entry=%d rx sw-owns=%d rx free=%d: haswork=%d: polls=%d: <3>%s: ERROR: TX Callback not set <3>%s descriptor %d has invalid index %d <3>%s: Inconsistent Rx descriptor chain, no skb at index %d <4>%s: Failed to allocate new skb H#*:8X,`4d0l|x$($@< D L p\ D|\ @  ww!x(?B!!!!!!!" stmmacGNU=p|3^^⫞ GA.aeabi$7-A A $0: ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rel.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 C)8% 08|4 xG| C <O%%:X2-kg T8 ws p $} $ p/ %d*0EC o*   *>Su 8 0, HP 0xt  x)3 8(hF K P,b4o{, X L<  H   t  h  0 0"<"<"@ , 2 8  > D J._x e k qd w }( L X l p   P t  $  |,H      P H&&:      L `,|,$h * 0 6|I O pUL/ f l r4 xH ~` t       d4l4X p  @     8   <   , D 7 , ;, J8YLh` wp   4HX`d$l :x Q h|    $ 0' W8   " 6$ B R# a3 tF- s 5  5   $% I ^1 + >/ P  fP tDPP  D8 |T `    $ ( #, *0 04 38 C< I@   Q i x  0 @ |P ` p     p'3: 7 79 7T 7 l 7 8 $8H l8x9|9 |9 98) 9h t: 8;; P; J ;_ =| y X>t3 F$ > h   h > >x D?| ?D3 F p K p   C 8 K  0` x 3 F 0( 0 H7 H@K I$f (I,z TI, I@ h J$ ,J$ PJ J `` `@@ K Kd L4 LP L   XMh XM { xM M M$ M M4     30 F` K {   ( X   O O \R\i]}^X p_0  _a4bbPcD )   hh 8loU, DD X h _ e k w }    q  4 H d         4 L d  gdwH8 d  $@ *x 0 0        h"P h5 hE hd YbpC@     3 F ؈܈K $({4 @ ԋ؋)  (   8    || , 2 8 L lp$  *%:D \ >x DHhl ܜ<e! _   D Ģ        " 1$ @4    O X$Ȣ@)  n |D  L D     K k  xD ! @@," h" \ \ )\ " ܣP" " " " " 3# F# K4# " P8Pp@@PtP|P# # )h # # $ 3$ F8$ KT$ {p$ $ $ $ $ $ % 4% P% l% % ,% 2% 8% % & 0& >L& Dh& & & _& e& k& w' },' H' d' q' ' ' ' '  ( (( D( `( |( X\(+0: (  ( ȹйdйx) DHtH$l d* )  * ؽܽ D* O(+ fX+ I* 0* ** $`* r+ l+ x+ ~, , $, 4, D, P, 8<, t, , xh h       . = L[$j81T y`p .   P#    + 5GCWh$s{       !   tHhF 3p B@TY,Hg}8HHw@ @td E3$,*:AR^gzx Te| 8E('1HQ]l4Hi8xH F(PЧ8C$;`E8S4cD(u(D$,؋&|X9BPZr~x4|ta(h   :plH_H$pz` ds'7I@d^oz$  # 2 F fR _ r , x   X T t w      !%!/!D!thO!e!ܣ4z!!TfH!lH!! 8!\t!!"""2"E"P^"lpk"`w""H"Ԯ""Ī8"-?: """#L0#:#R#^#i#4##@T#####D$ $9!$@6$KF$T$r$$$  $$$ܦd$tD$$D<% %b$1%TG%R%Z%j%px%ܽ%%%%%|%X@%X% &Ф$'&d:&LD(O&8\&aXo&~&_&&l&&&4@&''"'3'E'P'm\'P0l'z''lP''4$,8$,>@$h$p$+t$$,$$$+2$,2$P%X%p%+?t%,?x%%+@%,@%%%&+A&,A &,&+B0&,B4&+C8&<&+D@&,DD&,CH&L&+EP&+FT&,EX&,F\&+G`&,Gd&h&+)l&,)p&+Ht&,Hx&+I&,I&&+J&,J&&+K&,K&X'Mh'M''M'M'(H(x(+L(,L(()+M,),M0)@)+ND),NH)\)+Od),Oh))+P),P)H*+L*,h*+)l*,)|*b*+Q*,Q*+R*,R**+S*,S**+T +,T+++U$+,U(+0+{<++VD+,VL+\+h++Wp+,Wt+|+++X+,X++++Y+,Y+++Z+,Z+++[+,[++u++\+,\, ,+?,,?,$,+],,,]0,+4,8,,H,+^P,,^T,`,d,h,l,p,t,x,,+,,-+)-,)(-h-!-!,.<.+a@.,aD.L.5: +bP.,bT.x.+|.,/+c/,c/ /+/,/+j/,j//+k/,k//!/+l/,l//!/+m/,m/ 0+n0,n0,0+o00,o80H0+pL0,pP00J0+q0,q1(1+r,1,r41X1Jl1+qt1,q11+r1,r1 2+r$2,r(242JT2+q\2,q22+r2,r22J2+q3,q03<3+sD3,sH3X3+t`3,td3t3+u|3,u33+u3,u33+t3,t33+s3,s33+s3,s33+t3,t34+u 4,u44+s 4,s$444+t<4,t@4P4+uX4,u\4d4h4|4+4,4+x4+x4,x4+y4,y4+z4,z4+{4,{4+|4,|4+}5+~5,~5,}5+$5@5+P5,\5,h5+p5,x5+|5,5+5,66(6<6P6d6x666+6,66+6,666677,7@7T7h7|77+7,77+7,778+8,x99+9,:+ :,::+:,0:tH:t`:t0;^H;^;;+;,;; <=+>,>+>,<>+@>,>>+>,>>+>,>>@+@,<@D@vh@+l@,@+@+@,@,LA+`A,AA+A,AAGB+NB,N BHB&PBlB+pB+tB,xB,|B+B,B+B,B+B,B+B,B\BB+B,C CvCv$C+(C,,CN,>N N+?$N,?(N4N+@8N,@,>$4+Q8,Q+A,Aċ+B̋,BЋԋ@+ED,EȌH|dЍR F$RPQX+B`,Bdl+Fp,Ft+B,B+B,B+B,B< +Q,Q̏DUHUT h+Ip,Ix+J,Jđ+K,K+L,L (+B0,B4<+M@,MDh+Np,Nt| <@+QD,QD+,PPtP+B+Q,B,Q~(,+R4,R8UȖHܖH+B,B+Q,Q<~`+Sh,Sx+T,TH+Bȗ,B̗+Qؗ9: ,Q~+B+Q,B ,Q4 \|+,+BĘ,BȘИ+Kؘ,K+I,I +U(,U0<+LH,LLT+J`,Jdl4+q8,qDĚ+Ț,+B,B+X,X +Q ,Q+,+[,[+\,\ ,+]4,]8DX`@hx+b|,b+E,E+c,c ++,,Ԝ+++,, T+5\,5 rDPpg+Q,QH+EP,EԟPdԠ 4DF\RQRء +B ,B$(+B0,B48+fH,fLT+g\,gdp+hx,h+i,i+j,jĢԢ+}آ,}+},}+~,~ C+,++ģ,ȣ,У~+,+ ,P+T,+,+,ܤ+,+,$DP+T,+,ȥ+̥,ԥ+إ,ܥ+,+,+,$+(,,8+<,@L+P,T`+d,h|+,+,L+P,+,+,@+D+/H,L,/+,Ш+Ԩ,+,h+t,|+,Ъ+Ԫ,+,ԫ+ث,$+(,Pt+x,+5,50rHXg+,ԭ8+<,D+H,L+/P,/+,+/,/+,+,+:: ,+,+,0+8,<L+P,+,+,+,t0+8,<+,+ı+ȱ,̱,б+,$+(,,4+8,<D+H,LT+X,\d+h,lt+x,|+,+,+,+,IJ+Ȳ,вز+ܲ,+,+, +,$+(,08+<,DL+P,X`+d,lt+x,+,+,+,ij+ȳ,̳Գ+س,ܳ+,+,+ ,+, (+,,08+<,DL+P,T\+`,hp+t,|+,+,+,+,ȴ+̴,дش+ܴ,+,+,+ ,0+8,ȵ$+, $+,,<X+,+,p+t,̸9+,+,+ , 4}X+d,ȹ̹  +(,,0+8,<D` x+|,d+, vv8+<,h+l, 08vPvXvļ+ȼ,̼ؼ+,+, L +Ƚ,̽ؽ+,+,!+D,D!!x;:!l!$t! +,+,+,+,$+,+,,Hh+l, M0+,+,v+/ ,/M+,M+,+, 4+8,+, +, +$,0<+D,PX+`,lt+|,+,+,+,+,+,+ ,,8+<,H\+d,hlp+t,+,+,+,0@ h!+,+,+,'+, +,$8H+/L+P,/T,'+,d'x+|,Q  +, +0+P,`,P+,d+,$+/(,/T+\,`d+ l, x+ , x| +,S S(0$0+f4,f8D+H,LX+g\,g`ptx(%!N `dh l&p%tx|$#-0./y |;hI67;8M9:L K T$ V( U, W0 y4 8 <  @ D H |L ;P hT IX [\ <: \` ld _h ]l cp nt bx a| m Z ^ ` d k e f g h i j r s y v t {  z x } q u w | ~                 Y   [P YX |  [ Y   [ Y( L T [        B B $B,04B<@DBLPTB\`dBlptB|BBB)BWB9YDPT dH T` 048@jDGHLP]T\dhO>6T< R(x|,=M),W, 4 ,,0JD,PTQh,tx,n=  :hi3521_pciv_fmw.ko9Y9Y9Y`ELF(_4( p-L0S p0 R(!R(,0  `P@(,0 `P`@P@( ,0 p -L -LX0S00@V 1! |x -LP00J0S Q 0 -L -L00 -L 2@ -L@M @00K@@@p`@`@ @ @  @ @00@P`@@ ``@@``@`@`@ XQ#pV_W; VoP  0 @pp ppX\p pXQ p0@  pP PppX\PPV_p ppW @P  @ @00@p`p@`@p`@pp@` p`@P@` X!R V_R0 0pVoS 0 ,1@84$K ( X!R 0 ,1 @8$K4QP (Q PP V_R @P  @ @00@p@p@`p`@P@` XQ V_R" pVoP x |0@` XQ x |0 @` PP V_R @`  @ @00@p@p@PpP@P@p p@PpP@P@pp@PpP@ P@p$p@P(pP@,PX!R)`VOVG 0pV_S ( $0 @DH``, 04``8<@` `L$P(T`,`X!R ($0@  DH``,@ @048``<@@@: L$P`(``T@,@VVO$K -LM00@2S R    K pp@p -L M@VO$P`p0S K@,  P 0S=S3 41 @ 0 @0S`00SH0 S 0%*0 @H 0 @   07P D0 @0 @ 05, -L(MQ@pRJK2 @C0 @J0S V_@P Rf \T R X0S000  S0000 < K0$0 0 0P\ P  0K$0KP0 !!<0S ```  0K$KP30E! 1 @z0 @!0 @u @z0 @J @k`0 @0 @!W!UV@OD 0-LMP@ @VP$JO K080 @mϠ0 @PPJX 0-LMP@90S&P# R 00@VϠk4%Jυ!  !P0 @0 @K0x0 @ @J80 @0 @Jt: -LMP`@,QJ @V_%0SH P $Kp`(⸠ $00 BQ000(0(0(00 @;0 @J 0|0 @j0 @J80 @C0 @ J -L M8KPQ@@`@p8@ &SJ R1 R= Ry` 00@V/5%dPPM XX  P !$K1 @T0 @J8 @   !P1!$0K8 (@ @#@   !P 0 @q 0 @0 @ 0 @!x0 @a 0 @80 @i 0 @` -L$M@``@4̐@KP\0@ 0 @H<PP@P@@ 8@@@@ ` -L MPP_Vpp@`0Sh @P6@d@@@@@X@\@`@ @@$@(@,@0@4@8@<@@@D@H@L@P@T@@@@@P%@   !81 @ 0 @ K0 @0  @0 @0  @|0 @0 @@@J80 @@@0 @@@Jp -L0`  `d0 00 0-L  0R0P@@" @`C@P 0L00 -L 0P`C -L0`  `d0 00 -L -L 0-LM 0RP S @@" @`PC@0A0K0 @@ @N0@ -L0 \0  00 -L @]@?` h0PS P P PV( V0F` `P h0  d\  V`Pd0p` hVdp`P0`Pd`` -L@ -L@@ P@@P@@GNU遫@U[briD,?-h6P : PcivFmwPutRegionPcivFmwGetRegionPCIV_FmwInitPcivFmwSrcPicFilterExPCIV_FirmWareStopPCIV_FirmWareStartPcivFirmWareCheckAttrPcivFmwSrcPicOsdCbPCIV_FirmWareSrcPicFreePcivFmwSrcPicSendPcivFmwSrcPicZoomCbPcivFmw_VpssQueryPcivFmwSrcPicZoomPcivFmwSrcPicMovePcivFirmWareSrcPreProcPcivFmw_VpssSendPCIV_FirmWareGetPreProcCfgPCIV_FirmWareSetPreProcCfgPCIV_FirmWareSetAttrPCIV_FirmWareSendPicPCIV_VdecTimerFuncPCIV_FirmWareFreePcivFirmWareVoPicFreePCIV_FirmWarePicVoShowPCIV_FirmWareMallocPCIV_FirmWareWindowVbCreatePCIV_FirmWareDestroyPCIV_FmwExitPCIV_FirmWareCreatedrop_err_timerefPCIV_PicQueueGetFreeversion=Hi3521_MPP_V1.0.2.0 Debuglicense=Proprietaryauthor=Hi3531 MPP GRPparm=drop_err_timeref:whether drop err timeref video frame. 1:yes,0:no.parmtype=drop_err_timeref:uintsrcversion=472D9CB2DE5A5209E106A8Fdepends=vermagic=3.0.8 mod_unload ARMv7 pcivfmwPCIV create proc error PCIV register module error [PCIVF] Version: [Hi3521_MPP_V1.0.2.0 Debug], Build Time:[Aug 31 2012, 13:02:11] -----PCIV FMW CHN INFO---------------------------------------------------------- %6s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s PciChnWidthHeightStride0GetCntSendCntRespCntLostCntNewDoOldUndoPoolId0%6d%8d%8d%8d%8d%8d%8d%8d%8d%8d%8d -----PCIV FMW CHN PREPROC INFO-------------------------------------------------- %6s%8s%8s%8s%8s%8s%8s FiltTHFiltVFiltCVFiltLbDFLField%6d%8d%8d%8d%8d%8d%8s -----PCIV CHN QUEUE INFO---------------------------------------------------------- %6s%8s%8s%8s%8s busynumfreenumstateTimer%6d%8d%8d%8d%8d -----PCIV CHN CALL DSU INFO---------------------------------------------------------- %6s%8s%10s%8s%8s%8s%10s%8s%8s%8s%10s%8s%8s%8s JobSucJobFailEndSucEndFailMoveSucMoveFailOsdSucOsdFailZoomSucZoomFailMoveCbOsdCbZoomCb%6d%8d%8d%8d%8d%8d%10d%8d%8d%8d%8d%10d%8d%8d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Con : dition: %s /home/pub/hi3521sdk.svn/mpp/component/pci/pciv_fmw/pciv_firmware.cHI_SUCCESS == s32Ret[Func]:%s [Line]:%d [Info]:Scale: %d; mixmode:%d, downscale:%d invalid chn id:%d Region number of channel %d is %d, now free the region! pcivfmw chn%d stop ok pciv chn%d not create pciv chn%d start ok pic w:%d, h:%d invalid pic stride0:%d,stride1:%d invalid Pixel format(%d) unsupported Buffer block is too smail(%d < %d) In Function PcivFmwSrcPicOsdCb: pstDsuTask is null, return! PcivFmwSrcPicOsd status is NOK, chn:%d - --> addr:0x%x pciv chn %d have stoped pciv chn %d pfSrcSendPic failed s32Ret == HI_SUCCESSpChn->pCurVdecNode != NULL(pcivChn >= 0) && (pcivChn < PCIVFMW_MAX_CHN_NUM)pciv channel doesn't exist, please create it! pciv channel has stoped! pciv chn:%d SrcPicInfo is NULL! pciv chn:%d duplicated frame! pciv chn:%d has no free share buf to receive pic! pciv chn:%d queue is full! [PcivChn:%d]enPixelFormat(%d) not support get VB for u32PicSize: %d from ddr:%s fail,for grp %d VPSS Query Get VB(%dByte) fail + --> addr:0x%x pfnDsuBeginJob failed ! pcivChn:%d create dsu task failed,errno:%x,will lost this frame pfnDsuEndJob failed ! pcivChn:%d ======line %d ====Get VB(%dByte) buffer for image out fail,chn: %d.======= create dsu task move failed,errno:0x%x, will lost this frame stRgnInfo.u32Num <= OVERLAYEX_MAX_NUMDSU task to add osd failed ! pcivChn:%d ======line %d ====Get VB(%dByte) fail for image after zoom the picture======= Pciv %d, TimeRef err, (%d,%d) Pciv channel %d support osd right now Pciv channel %d not support type:%d ==send====line %d.=====bsuc is failure.== PCIV_FirmWareSrcPicSend failed! pciv chn %d PcivFmwSrcPicSend failed! pciv chn %d. args invalid pciv chn%d set preproccfg ok pciv chn%d is running pcivChn:%d viu frame pic send failed pcivChn:%d virtual vou frame pic send failed pcivChn:%d no free node pcivChn:%d data type:%d error pcivChn:%d no vdec pic  :pcivChn %d send state error %#x Invalid Physical Address 0x%08x pcivfmw chn%d pfPicFreeFromVo() failed Pciv chn %d bind type error, type value: %d. Pciv chn %d send pic to vo failed, ret:0x%x VB_GetBlkBySize fail,size:%d! Video buffer pool has created windowCreate pool(Index=%d, Cnt=%d, Size=%d) fail pciv chn%d is running,you should stop first pciv chn%d destroy ok HI_SUCCESS == CALL_VPSS_UnRegister(HI_ID_PCIV)pciv chn%d have already created attr of pciv chn%d is invalid pciv chn%d create pic queue failed pciv chn%d create ok topbottomboth ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/hi3521sdk.svn/mpp/component/pci/pciv_fmw/pciv_pic_queue.cHI_NULL != plist$,PCIV_FirmWareGetPreProcCfgPCIV_FirmWareSetPreProcCfgPCIV_FirmWareRegisterFuncPCIV_FirmWareSrcPicFreePCIV_FirmWarePicVoShowPCIV_FirmWareFreePCIV_FirmWareMallocPCIV_FirmWareWindowVbDestroyPCIV_FirmWareWindowVbCreatePCIV_FirmWareStopPCIV_FirmWareStartPCIV_FirmWareSetAttrPCIV_FirmWareDestroyPCIV_FirmWareCreate0hi3521_pciv_fmwA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo.rodata.str1.4.rel__param__ksymtab_strings.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4F :  `)F$% X 8Ft4 xClG$Z$GpV hHd  pJy2KP[ [AX\4 @\$ P]l]p]/]^dG |t  %X\(\7lJ[$k pt    <   ( 0 8 @ H P X `         !  '8 - 3 9 ? E K Q W0 ]` ch ip ox u {  :          X  %%( , ؟%0 4 4   %  H    % x ` %%l     %%8P > %D@Xx %^p v |  % %   @  d 4  %lppP     %p  4  & , %,)0)2 8d > %**D J0 P %--%|..Vh \X %//%00b %11h o v | %444 L %66p %77 %H8L8  %;;: %<<\ d < %>>  %?? %DALAt 0 P   %pC%       $4  3D B\ Qp ` o ~      , D X t  # 2 A P _ n }, H `  p  %PP%.-% L j%XX" " 6 LH  %h/hV%`}`%%@@,%Qm%(0(,% %%00 6%/ > R b (D%m  %H H P h %8; 8%(Z (tCk   < % {  % % %% #  ! %:   T ,    4l + < $J [ Hu  >4 D $    t  pE0   / G dD_ m } *  6   0) 1    C`$ 7D: .LU LA(i lz     L8D  tC8   D?h" :E,D8Zk<`xD D =$EL/;,1-LVe$aPcivFmwSrcPicFieldDrop.LANCHOR0$dPCIV_FmwNotifyPCIV_FmwQueryStatePCIV_GetVerMagicPCIV_FmwModExit.LC0PCIV_FmwModInit.LC1.LANCHOR2.LC2.LANCHOR3.LC8.LC9.LC3.LC4.LC5.LC6.LC7.LC10.LC11.LC12.LC13.LC14.LC15.LC16.LC17.LC18.LC19.LC20.LC21.LC22.LC23.LC24.LC25.LC26.LC27.LC28.LC29.LC30.LC31.LC32.LC33.LC34.LC35.LC36.LC37.LC38.LC39.LC40.LC41.LC42.LC43.LC44.LC45.LC46.LC47.LC48.LC49.LC50.LC51.LC52.LANCHOR1PcivFmwSrcPicFilterEx.LC53.LC54.LC57.LC56.LC55.LC59.LC58.LC62.LC60.LC61.LC63PcivFmwSrcPicOsdCb.LC65.LC64PcivFmwSrcPicMoveCb.LC66PcivFmwSrcPicSend.LC67.LC68.LC70.LC69PcivFmwSrcPicZoomCb.LC71.LC75.LC78.LC76.LC79.LC74.LC73.LC72.LC77PcivFmwSrcPicZoom.LC81.LC82.LC83.LC80.LC84PcivFmwSrcPicMove?:.LC88.LC85.LC86.LC89.LC87.LC92.LC90.LC91.LC94.LC95.LC93.LC97.LC96.LC98.LC100.LC101.LC99.LC102.LC103.LC104.LC105.LC106.LC107.LC108.LC109.LC111.LC112.LC110.LC114.LC113.LC115.LC119.LC117.LC118.LC116C.358.18144__func__.17206__func__.17189__func__.18027__func__.17091__func__.16820__func__.16807__func__.16693__func__.17392__func__.17062__func__.17144__func__.17228__func__.17821__func__.17307__func__.17449__func__.17622__func__.17927__func__.16796__func__.16773__func__.16723__func__.17746__func__.17696__func__.16915__func__.17028__func__.16935__func__.16887__func__.16842__func__.16668__func__.18085__func__.16636__param_str_drop_err_timeref__ksymtab_PCIV_FirmWareStart__kstrtab_PCIV_FirmWareStart__ksymtab_PCIV_FirmWareCreate__kstrtab_PCIV_FirmWareCreate__ksymtab_PCIV_FirmWareMalloc__kstrtab_PCIV_FirmWareMalloc__ksymtab_PCIV_FirmWareStop__kstrtab_PCIV_FirmWareStop__mod_version2262__mod_license2261__mod_author2260__mod_drop_err_timeref2255__mod_drop_err_timereftype2254__ksymtab_PCIV_FirmWareWindowVbDestroy__kstrtab_PCIV_FirmWareWindowVbDestroy__ksymtab_PCIV_FirmWareWindowVbCreate__kstrtab_PCIV_FirmWareWindowVbCreate__ksymtab_PCIV_FirmWareDestroy__kstrtab_PCIV_FirmWareDestroy__ksymtab_PCIV_FirmWareSetPreProcCfg__kstrtab_PCIV_FirmWareSetPreProcCfg__ksymtab_PCIV_FirmWareFree__kstrtab_PCIV_FirmWareFrees_stPcivFmwModules_stExportFuncss_u32PcivFmwStatedrop_err_timeref__param_drop_err_timeref__ksymtab_PCIV_FirmWareRegisterFunc__kstrtab_PCIV_FirmWareRegisterFuncg_stFwmPcivChng_stPcivFmwCallBackg_timerVdecSendg_stVbPool__ksymtab_PCIV_FirmWareGetPreProcCfg__kstrtab_PCIV_FirmWareGetPreProcCfg__ksymtab_PCIV_FirmWareSrcPicFree__kstrtab_PCIV_FirmWareSrcPicFree__kstrtab_PCIV_FirmWarePicVoShow__kstrtab_PCIV_FirmWareSetAttr__ksymtab_PCIV_FirmWareSetAttr__ksymtab_PCIV_FirmWarePicVoShow__func__.9411__mod_srcversion23__module_depends__mod_vermagic5PCIV_FirmWareRegisterFuncPCIV_FmwInitPcivFmw_VpssQueryparam_ops_uintPCIV_VdecTimerF*: uncPCIV_FirmWareStartCMPI_RegisterMod__this_modulePcivFmwPutRegionPcivFmw_VpssResetCallBackVB_UserAddPCIV_FirmWareDestroyPCIV_PicQueueGetFreecleanup_modulememcpykfreeCMPI_RemoveProcinit_moduleVB_UserSubPCIV_CreatPicQueueCMPI_CreateProcg_astModulesVB_GetBlkByPoolIdPCIV_FirmWareViuSendPicPCIV_PicQueueGetFreeNumVB_CreatePoolVB_GetBlkBySizePcivFmw_VpssSendVB_Phy2HandlePCIV_FirmWareFreeadd_timermod_timerPCIV_FirmWareSrcPicSendPCIV_FirmWareSendPicCMPI_UnRegisterModpanicprintkPCIV_PicQueueGetBusyPcivFirmWareVoPicFreePCIV_FirmWareSetPreProcCfgPCIV_FirmWareCreatePCIV_FmwProcShowPcivFmwGetRegion__memzeroVB_InquireOneUserCntHI_LOGPCIV_FirmWarePicVoShowjiffiesPCIV_PicQueuePutBusyinit_timer_keyVB_Handle2KernPCIV_FirmWareStopPCIV_FmwExitPCIV_FirmWareSrcPicFreeseq_printfPCIV_PicQueuePutFreeVB_Handle2PoolIdPCIV_FirmWareWindowVbDestroyPCIV_PicQueueGetBusyNumPCIV_PicQueueQueryBusyPCIV_FirmWareWindowVbCreatePCIV_DestroyPicQueuedel_timerPCIV_FirmWareSetAttrPCIV_FirmWareMallocPcivFirmWareCheckAttrPCIV_FirmWareGetPreProcCfg__kmallocVB_DestroyPoolVB_Handle2Phys+ , X+,+ , ++,,+,}+,}++ ,,+,(+,+ 0,4, @+!D+"H,!L,"X+#\+$`,#d,$p+%t,%|}+&,&}$+&,,&}+','+ }+(+,(,+),)+*++,*,++,,,+-,-+.,., }H+/L,/}+/,/}+0,0+ }+1+ ,1,+2,2+3 +4$,3(,40+58,5<, D}+6,6}+6,6}+7,7}+8+,8, +9$,9(+:,+;0,:4,;<+<D,<H+=P,=T+>\,>`+?): h,?l+@t,@x+A,A+B,B+C,C+D,D+E,E}+F,Fd}x+F,F}+\,\l+Gp+Ht,Gx,H+I,Ij+\,\ +G +H ,G ,H +I ,I$ j( < +@ ,` +\d ,\ +h ,h +N ,N x +v ,v + , +K ,K( e8 rp x r +I ,I +b ,b +P ,P +G +H ,G ,H +I ,I j +G +H ,G ,H +I ,I j +G +H ,G ,H +I ,I j +G +H ,G ,H +I$ ,I, j0  +R ,R t +S ,S t  + , +  , 4 +R8 ,RD tT +VX ,V\ tx +R| ,R t +W ,W t O +R ,R t +X ,X t,+ 4, X+R\,Rhtx+[|,[t+R,Rt+\,\t+R,Rt+X,Xtlptx|+R,Rt+a,at+R,Rt(+b,,b4tP+RT,R`tt+cx,ct+R,Rt+d,dt+ , O4Y\+R`,Rltp+hx,htY+R,Rt+i,it+ , Y0+ 4, <+D,p+Rt,Rt+m,mtY+G+H,G,H+I,Ij+ , P+NT,N|QY~+R,Rt+q,q t8+R<,RHtX+r\,r`tl+Gp+Ht,Gx,H+s,sj+G+H,G,H+t,tj+ , YH+RL,R<:Xth+ql,qptY@+GD+HH,GL,HX+x\,xdjh+Gl+Hp,Gt,H+I,Ij+R,Rt+X,X t<+ D, _ +\$,\`apy+R,R t$+{0,{8tp+Rt,Rt+|,|t+N,N+R,Rt+},}t+R,R$t4+~<,~Ht\+R`,Rltx+,t+R,Rt+,t+R,Rt+,t+R,R t0+4,8tD+GH+HL,GP,H\+I`,Ihjl+ , +\,\ a<+R@,RLtT\+`,lt|U8y@+wH,wQ+R,Rt+,t+R,Rt+,tY0+R4,R@tP+T,Xtx+R,Rt+,t+\,\@ qT + X , U U !+G!+H!,G!,H$!+I(!,I0!jT!U!O "a"(""+l",l"Q#UD#+gL#,g $Q`$+Rh$,Rt$t$+$,$t$O$Y$a%+R%,R %t,%4%+8%,D%tT%U\%%%y%+w&,w&+R&,R&t&+','t$'+R,',R8'tH'+L',P'tl'Y'+R',R't'+','t'+R',R't'+(,(t (Y4(Y`(+Rh(,Rt(t(+(,(t(+R(,R(t(+(,(t(Y)+G)+H ),G),H)+ ),()j,)@)+ D), x)+|),)+R),R)t)+),)t,*+R0*,R<*tD*+T*,d*t*+R*,R*t*+*,*t&: *4++R8+,RD+tT++XX+,X\+t|++ +, +q,O8,g,+R,,R,t,+,,,t-+R-,R-t -+$-,(-t@-+RD-,RP-t\-+`-,d-t-+R-,R-t-+-,-t-+-,-k-.+ ., D.+RH.,RT.td.+Xh.,Xp.t|..+ ., /+R/,R/t,/+0/,4/tP/+RT/,R`/tl/+p/,t/t/+R/,R/t/+X/,X/t//+ 0, 00000000+R0,R0t0+X0,X0t1+R1,R1t$1+a(1,a,1tH1+RL1,RX1th1+l1,p1t11+ 1, 2S(2U82QD2wl2+Rp2,R|2t2+X2,X2t2g3g3+R 3,R,3t<3+@3,D3t\3+R`3,Rl3t|3+3,3t3+R3,R3t3+3,3t3+R3,R3t4+4, 4t4,4+N04,N44+v84,vX4+K`4,K4+ 4, 4gD5g5l5+R5,R5t5+5,5t5l6+R 6,R,6t46+<6,D6tT6e\6+d6,h6kp6+x6,|6k66c66Y6+R6,R6t6+6,6t77+ 7, P7+NX7,Nh7cp7s7+v7,v7+m7,m8f8+R8,R(8t08+88,@8tH8t8+ x8, 8+R8,R8t8+9,9t9+R 9,R,9t89+@9,H9t\9mp9r9c99+\9,\|:r:c::+\:,\T;+RX;,Rd;tt;+Xx;,X;t;;+N;,N<] <4<+R8<,RL<t\<+`<,h<t<a<<+R<,R<<+N<,N<,=+N0=,N=+=,=`=+R=,R=t=+3:=,>tD>x>+R|>,R>t>+>,>t>>+ >, > ?+R$?,R0?t@?+D?,H?td?+Rh?,Rt?t?+X?,X?t?+R?,R?t?+?,?t??+?,@+\ @,\@+ @, H@zP@R`@h@zp@R|@@@+G@+H@,GA,H A+IA,IAjA+G A+H$A,G(A,H4A+8A,@AjDAHAlA+ tA, ABZ8B+R@@@8 "1@@@ !1@@@@ -L@,` @6pF(PDS a1/ 0 @&R 0/1 A @0`GP@EpGQ( E 6q3/  @0vʊ -LPP@`3@@? 2/ Pz0S X 1(`@Q p7/P/ 2/ Pb0S @T 1@@@(p@0S 1/P( 1`Pp00 0 \. 4@TE P' 0@ S 0SP Rh0*Z h\ \ \Ph h0\ \P h0R:p`Y8 R(K @4@@8 L6@@@ V6@@@@x -LMQ00@ R9 Ƞ !R+ 1 1S pP*h 0  K@@ -6@@@ .6@@@` .6@@@8 .6@@@ .6@ -LM00@ R! !R; 11S- p R*h2"0S 0 0\Q0 S K@@ 6@@@` 6@@@8 6@@@ 6@ -L M00@@T (Q' 11S pP *h0 K @@@` ,4@@@8 ,4@@@@@@ ,4@ -L M00@@T (Q' 11S pP *h: 0 K @@@` 4@@@8 4@@@@@@ 4@ -LM00@ R !R 1S pP* K @@@` 3@@@8 3@@@ 3@ -LM00@Q (Q 11S! p P* K @ @@` ?@@@8 ?@@@ ?@ p-L M00@ RU \ P@0LU 0S<@ T *Q PU 0S6@ T:KpP:@QU 0S @ T*QU 0S``P*c Pp61:@@` ?@``P*P:@ T: @ -LM P 00@Q 0S!*Q 00 K @ @@@8 2>@@@ %3@  p-L M`PO @0 R ! 0 R R!) !0S 40@R P@04PPPP @P0 @QQKpP @@8 2@@@@@@ 1@ p-L MPP@c0S%  R@`0P 0@S@@@fP !!  @Kpc  @@@ 7@, -L,@ @ 0-:LM@@@0S  R QU c6PcK0@@` .2@@@8 12PP@P@@ /2@@@@8 0-L@@@  @ 01@PP @@a  @>Q1PQ10 @0 -L00@ -LM@0SB QA$T) 0PDQp0  *` V:V P  V 0P @T 0PD Rp8`V@`T00S (K @0P @@< 2@@@@@@ 2@`H -L@@0S Q  Jp  @J @J -LDMSL X0 pP P4 U  @000@P@ @L h`TPH V<`K @U PTP  L PPT P  P P0S`@H 0LL D0 P8<L( , Q( D $P``L D0H`@ (H`L$D  @` h` HpdP$0D$0$ph`p00 0 dP$0$`@LD0p`@p hp 0 0  LL XdPT0S  ``@PcPPP^8 0S` 0,PP0& PQ040XPP@H!0 @(K\ 0PP 0PU: @T H0S/ JT #: V5  1H LH 0 @pPL0T @L0 @H @J -L M@P 00@0S 0 PK@@8 1@@@ r?@@@@d -LML xK  @ @ @ @@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ 0 @8  @P  h @0 @  @  @  @0 @  @  !@0 @(! @@! @X! p!@ @0 @  @$  < @ @T 0 @l  @  @0 @  @  @  @0 @! @,! D!@0 @\! @t! @0S ^  1S0  0S@ @0@S@P  @  @ @ 0 @ 8<  0S @x R  @ Y@ xK R  @@LT x`K: @ PR x@K @ R @LT @ㄐ P(YP I  @  @X @`@@@P0U@`  @@\@@X`  @ P R@p@  @  0S@@@X` @ Y P@@` @@ @`@ P @P @ @ @U0@@0 @ P @0 @(Kt -LM@@TX@Ts SgR[ ` qW< P9 \6 P(\ @Td @Q0:P8XY @QP@ @0P8``@`@@8 5PP@P@@ 5@ -L M00@p`Q  R 0AT P VZ$ (Z0 d PRd PR 0 p W\X:P!0 @J(K\P5:P \* nhP PP`^ 0 @p 0B0SA1 2  0@  0$$P P880SP0S^PP0 RK0PS!YJ`1SF ICY  !! Ld" @ 10@ $ $P0 P80 8 !\  @0pp@p 0 @P@@ ~4@@@@! @0  @!0  @@@` E>PP@P@@8 O4@@@@@@ M4@ -LM @0S `Vp 0aV P PU" (P U0 d @Rsd @PRn 0 P Q9:\! @J$K Q5w: Qs*lh @\ LP82 0@8  0$0$@0@!!Q !  @L d" @ 1 X0@ $ $@0 @808 ! !@@ g3PP@P!@@| R3@@@@@@T Q3@0 @P@@ 3pp@p -LMQPo00@ R` PS` 01SF ^: :\ !0 @$K @ R 8 RT < B8 R< 5p @( p @,,@@q0p0q00P! 0 @!0  @@@ U2PP@P@@` ?@@@@@@8 S2@@@ u2``@` -L M00@@0S Qp K@@8 1>@@@ 3@@@@ 0-LM20LQP=  20LQ[ A" LQ LQ  @MOOK0 "!DQ : H QO LQ00@P  R; U*ATO P L KP\\@ B$@LQS $L Q: LQ@Q BQ@00@Q @P*^ @@!R a/@@@@!R P   @@ @0S p P*!R p  @tP9 Q6 @0S  0@P0@a00@@ (R*0S 1S p\*@L00@ (R *0S 1S 0p^q:@@  @3@@@Pa/ Q$00@\<00@PT00@^l 00@R00@Q00@\v00@Pl00@^b 00@RX00@QN00@\D,00@P:D00@^0\!00@R&t00@Q̠01@ @P$ @!8S*q Q: @@@Jp^p : XP X@\ˌ@(Q(!R+!^P \ˌQ R+ ^yhP hoP\ˌPe8Q8[ R+ Q^Gf 00S P  @P Q$@P Q<@P 8QT@P PQl@P hQ@P Q@P Q@P Q@P Q@P Q@P Q@P Q,@P (QD@P @Q\@P XQt@P pQ @@h@ 11. @@ @ @@J @@@J p  @ J H @@@J00 @@0 0KPP5 PP 0PP U:P P ! @@Jm 0K(PP  0K@PP  0KXPP  0KpP}P  0KPtP  0KPkP  @@@J/ 0KPZP  0KPQP  0KPHP  0KP?P  0KFP6P y 0KP-P p 0KRP$P g 0KPP ^ 0K^PP U @ @@J4 @  @@J0 @@@J @@@J : @@J0 @@@J0 0 @@@J0 @@@J  @ @@@J -LM0P0 40 p R @P@ @0h`TPP VP00(, `⌐ 00 R( `$`8 < 吀夐I $PL`0pP`G hp0d Q6Z $0$pL`0p 0 dp R"$0$p`Lph0 8 d$ L$h`p 8 0d P``@c\- 0S= 0p"p^0`VJ4Hpp@P0 @(KQ 0pP 0p W: @T U JPp @ @J @J@@ }5@@@@ -L,Q @1S -L00@ -L@@@P 00@  -L@@0 00 -L00@ -L<0DQ@, , DQ L Q0,S+ Q! P,U`Vpp@ P$@```0`S 00@@  @ @a -LM@@@P` 0R.  UW pWS p@0 ! 0p  x3W#X \  0P 5 0% S!(Kpp@ :P ?@K 0 0@@0 4 < 8 \ ^ 0 H  Q $p O -LLM`l@KP V l (K p ? Up1 p#03P' WL`K.` V RF  R  VR `` R =R`V=Q @p0 p0 p L`K p0 p0P LK Fp0 @p0P  @ X0\?@p0 p0 P`@ @ R`1p0P `p0  p0P `-V p0 !p0P@@c@p0 p0 -LM@@@@0 @p   0"%@ @p@ @P@ P(P`@T&-U0 @`0S @1Q  @P Q@1 @ (P`@T !@1@  -U @@8@ l0 K< <K03/ 0 @(K -LM@@@`V5 0 Rh PSZ: P` p0e S)`!00@P0` 00 @4 0 0`f4` V/UW!Pp pP! 0(Ka00@ 0 0 @4 0 0`f4` VWUp2P @  @@ @0@@@@ @@ @0@ -- LM,Q @1P K0 0 p-L : MPP@ @  @,1 @H0P! @P: L` `@ @$`( D~PE`H@@` `P@ Kp0 @ @H0 @ @@8  -L -LM 0P  K -L  @ -LMT@@@@``@0@0@@ @p`@'0 0@&.8 "0 @ps㲈o@؃s`ᾡ8pcF `㔑d#0x2pu @㬘`( hgHp@T4`\xpp@`0< &|`@めDŽ@8`X'`@ @00@  @ぞ@pp@㼧@`g `!0gsi䇄s`@p0@t l@'  rn@ivep@,`a尠*"0la  070`DŽ $9phLɄ@`Py`@00@ @`H1`@,&$P0 0Z `ʄg(*@ D<:PP  @&`P   @PP   @ @P   @ @(KL8(  (  GNUfO\k]R&@{Yk<Mcp^+p}UF4$O` :2uA  CMPI_UnRegisterModCMPI_RegisterModlogbuflenVB_IsBlkValidVB_InquirePoolBusyBlkCntVB_InquirePoolUserCntVB_InquireBlkCntVB_InquireOneUserCntVB_InquireUserCntVB_Handle2KernVB_Handle2PhysVB_Handle2BlkIdVB_Handle2PoolIdVB_Phy2HandleVB_GetPoolInfoVbDestroyPoolVbDoVbExitVB_DestroyPoolVbSearchCommPoolBySizeVB_CreatePoolxVB_AddBlkToPoolVB_UserSubVB_UserAddVB_PutBlkVB_GetBlkByPoolIdVB_GetBlkBySizeVB_CreatePoolExtLogWriteCMPI_LogInitversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparm=logbuflen:The lenght of log Buffer.The range is [2,128](KB).parmtype=logbuflen:intsrcversion=533BB7E5866E52F63B9ACCBdepends=vermagic=3.0.8 mod_unload ARMv7 g_aModNameg_astModulesCMPI_UnRegisterModCMPI_RegisterModCMPI_ExitModulesCMPI_InitModulesCMPI_QueryModulesCMPI_StopModulesCMPI_DevExitCMPI_DevInitCMPI_UnRegisterDeviceCMPI_RegisterDeviceCMPI_UserCopyCMPI_CreateProcCMPI_RemoveProcVB_ExitVB_InitVB_InquirePoolBusyBlkCntVB_InquirePoolUserCntVB_InquirePoolVB_IsBlkValidVB_InquireBlkCntVB_InquireOneUserCntVB_InquireUserCntVB_AddBlkToPoolVB_CreatePoolExtVB_UserSubVB_UserAddVB_Handle2PhysVB_Handle2KernVB_Handle2BlkIdVB_Handle2PoolIdVB_Phy2HandleVB_PutBlkVB_GetPoolInfoVB_GetBlkBySizeVB_GetBlkByPoolIdVB_DestroyPoolVB_CreatePoolCMPI_LogExitCMPI_LogInitHI_LOGHI_ChkLogLevelCMPI_MmzFreeCMPI_MmzMallocUnload hi3511 module... OK! MOD [%s] is busy! adecaencaiaovivochnlvencrcvdavpssh264ejpegempeg4evdech264djpegdvbcmpipcivpcivfmwvcmpfbhdmivoieCMPI_ProcInit failed! CMPI_DevInit failed! VB_Init failed! Log_Init failed! load hi3511 module... OK! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/m :kp/comm/cmpi_mod.cenModId < MAX_MPP_MODULESmod [%d] unregister OK! HI_NULL != pstModulepstModule->enModId < MAX_MPP_MODULESHI_NULL != pstModule->pstOwnerHI_NULL != pstModule->pfnInitHI_NULL != pstModule->pfnExitHI_NULL != pstModule->pfnVerCheckerCan't register module after being initialized! the Module[%u] already registered! MOD [%s] eixt OK! MOD [%s] init failed! MOD [%s] version doesn't match! <6>Error: UMAP device driver registed more than once. <6>Hisilicon UMAP device driver interface: v3.00 <6>Device %s register failure umapVB not initialized! null point! Pool ID [%u] is great than max pool Id [%u]! pool id [%u] does not existed! VB not initialized! pool id [%u] is illegal! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/comm/video_buf.cpstBlk->u32BlkSize > 00 != pstBlk->s32SumCntthere is no this block(0x%x)! PhysAddr = %x, PoolPhysAddr = %x, PoolSize = %u *pu32Cnt <= pstPool->u32BlkCntu32Uid < VB_MAX_USERpool [%u] doesn't have blocks! s_apstPools[i] != HI_NULLHI_NULL != s_apstPoolsHI_NULL != s_apstPools[VB_H2POOLID(Handle)]HI_NULL != s_apstBlks[VB_H2POOLID(Handle)]VB_H2BLKID(Handle) < s_apstPools[VB_H2POOLID(Handle)]->u32BlkCntu32BlkId < pstPool->u32BlkCntHI_NULL != pstInfou32PoolId < s_stVbConf.u32MaxPoolCntPool %u is already destroyed ! HI_NULL != pstPoolHI_NULL != pstPool->pstBlkdestroyed pool %u! vb already exited! list_empty(&s_stCommPools)vb exited! vbVB exit OK! VB register device failed! VB init OK! HI_TRUE == pstN->bIsCommPoolno fit common pool! null point ! pu32Poolid NULL! mmzname:%s! [File]:/home/pub/platform_h3/mpp/code/mkp/comm/video_buf.c [Line]:289 [Info]:failed to malloc memory!(pstPool=%p,pstBlk=%p, BlkCnt=%d, Size=%d) [size = %u, cnt = %u]vb alloc new mmb from mmz:%s failed! [size = %u, cnt = %u]vb alloc mmz buffer failed! [File]:/home/pub/platform_h3/mpp: /code/mkp/comm/video_buf.c [Line]:396 [Info]:too many pools! created pool %u! HI_NULL != pu32PoolId [VB] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:46] -----VB PUB CONFIG------------------------------------------------------------- Max Count of Pools: %10u -----COMMON POOL CONFIG-------------------------------------------------------- PoolId%8u Size Count anony -----%6s-------------------------------------------------------------------- PoolId PhysAddr VirtAddr IsComm BlkSz BlkCnt Free MinFree %6u 0x%8x 0x%8x%10u%10u%10u%10u(%u)%10u BLK%s%4u%6uSum u32Size > 0try to put a same free buffer block! 0 != pstPool->u32FreeBlkCntPool %u is dead ! try to sub user for a free buffer! ModId(%d) is not using this block(0x%x)! 0Blk [%u] in Pool[%u]:is subed! 0 == pstBlk->as32UserCnt[i]try to increase counter for a free buffer! try to put a free buffer block! no free buffer in pool %u! Blk [%u] in Pool[%u]:is allocated! illegal argument! invlid pool ID [%u]! try to destroy a NOT existed pool! try to destroy a kernel pool! Someone is using vb now, please make sure to release vb block first! no buffer block! invalid pool id[%u]! pool id[%u] is not existed! invalid handle! bad argument! VB is initialized! please configrate VB first! VB_Init again! no memory! vb init ok! ioctl cmd does NOT exit! pstVbRegInfo NULL! [File]:/home/pub/platform_h3/mpp/code/mkp/comm/video_buf.c [Line]:1347 [Info]:failed to malloc memory! [File]:/home/pub/platform_h3/mpp/code/mkp/comm/video_buf.c [Line]:1400 [Info]:too many pools! NULL == s_apstBlks[i] VIU VOU DSU VENC VDEC VDA H264E JPEGE MPEGE H264D JPEGD MPEGD VPSS GRP MPI PCIV AI AENC RClogmppallwait<6>string is unkown! <6>invalid value! <6>%s not found in array! -----LOG BUFFER STATE---------------------------------------------------------- MaxLen <:ReadPos WritePos ButtPos %3d(KB) %7d %8d %7d -----CURRENT LOG LEVEL--------------------------------------------------------- %s : %d SIO0 MCLK :%6x ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/comm/cmpi_log.cs_stLogBuf.u32WritePos <= s_stLogBuf.u32MaxLens_stLogBuf.u32ReadPos <= s_stLogBuf.u32MaxLen<%d>[%6s] [%6s]: Log message is too long!! [Func]:%s [Line]:%d [Info]:Log register device failed. Alloc memory for log buffer failed. ($ PWhi3521_baseA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.t): ext.rel.exit.text.rel.init.text.rel.fixup.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel__param.rel__ex_table.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4a T1)a4% 88a4 GfC Nf$e$fha  sThHo  {jk28n( T8 l@ |x4$ X8XpX/ X߇&   4# (54:<?DDHILNPSTX\]dclihotu{|*:   4P  t!'T-,3,9@?X< E T c(  ` y`  x x 1BB& = X< s  M +^p" h ,h G X SX H hH X X @ #|5    # P ;P | Y  p     p p L L ,|  D (  5hBO` \` l vl { 58#(?::h]|iDIN4 Xd?SLc{ou,`H $ptptptdh\`X0xlpp|  hP) ( l!DB\!d!X8""-p#(3  8  t '((9 L)P)?4     H P T  \ l d  # )@ /H 5L ;P AT L2P2Gh M\ S 44Y _ e4 k q w <9@9}P D<H<| h?l?  %: AA@BDBh<X 0P L PP`xT4 4 D +` :x I X g v       ,  8 H d tL  '  6  E  T c r     4      5 U M  _  q  2  ( ( u   !  3  M  g  F    $   .  I  d H  H    O       ,# 8 - 8 E   ]  } h hh  `   A0:0  E  0 Y 0 @ q @ P P TvT$U U{ UDdUUL# VXX X:$5DP?< t[IlNSX]iTc`\hop{, ,ul_p_$a, ,  8  0 0 p ( ( c 2}C\kwh   ,8  0a 8 8 @ &@ c?#R c!  s($@9!40@GHa8VtdjtH<$~3: 4 l?0!`]*=Ngx_p(ATH`X L ",?QW _f tDT4P|@p_PP!0a.5 DMt\k@xx h$P `->HWftvP2Tt,$a.LANCHOR0$dCOMM_ModExit.LC0.LC1COMM_ModInit.LC2.LC3.LC4.LC5.LC6.LC7.LC8.LC9.LC10.LC12.LC11.LC13.LC15.LC14.LC16.LC17.LC18.LC19.LC20.LC21.LC22.LC24.LC23.LC25.LC26.LC27.LC28.LC29.LC30.LC31.LC35.LC32.LC33.LANCHOR1.LC34.LC43.LC42.LC40.LC39.LC41.LC36.LC38.LC37.LC44.LC45.LC46__func__.16611__func__.16581__param_str_logbuflen__ksymtab_g_astModules__kstrtab_g_astModules__ksymtab_CMPI_UnRegisterMod__kstrtab_CMPI_UnRegisterMod__mod_version395__mod_license394__mod_author393__mod_logbuflen388__mod_logbuflentype387__ksymtab_CMPI_ExitModules__kstrtab_CMPI_ExitModules__ksymtab_CMPI_InitModules__kstrtab_CMPI_InitModules__kstrtab_g_aModName__kstrtab_CMPI_RegisterMod__kstrtab_CMPI_QueryModules__kstrtab_CMPI_StopModules__param_logbuflenlogbuflen__ksymtab_CMPI_StopModuless_bIsInited__ksy&: mtab_g_aModName__ksymtab_CMPI_QueryModules__ksymtab_CMPI_RegisterMod__kstrtab_CMPI_DevExit__kstrtab_CMPI_DevInit__kstrtab_CMPI_UnRegisterDevice__kstrtab_CMPI_RegisterDevice__kstrtab_CMPI_UserCopy__ksymtab_CMPI_UserCopy__ksymtab_CMPI_RegisterDevice__ksymtab_CMPI_DevExit__ksymtab_CMPI_DevInitg_bDevInitg_bCreateNodeg_DevNode__ksymtab_CMPI_UnRegisterDeviceCMPI_ProcWriteCMPI_ProcOpen__kstrtab_CMPI_CreateProc__kstrtab_CMPI_RemoveProc__ksymtab_CMPI_CreateProcmpp_proc_opss_pumap_procs_proc_items__ksymtab_CMPI_RemoveProcOpenCloseVbDestroyPoolVbDoVbExit.LANCHOR2VbProcShowIoctlDoIoctlVbSearchCommPoolBySizeVbCreatePool.LC47.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC56.LC55.LC57.LC58.LC59.LC60.LC61.LC62.LC63.LC65.LC64.LC66.LC69.LC71.LC72.LC68.LC70.LC67.LC73.LC74.LC75.LC76.LC92.LC89.LC86.LC85.LC91.LC82.LC87.LC77.LC80.LC81.LC78.LC88.LC83.LC84.LC90.LC79.LC95.LC94.LC93.LC96__func__.24144__func__.24109__func__.24079__func__.24014__func__.23977__func__.23940__func__.23562__func__.23530__func__.23503__func__.23478__func__.23448__func__.23334__func__.23139__func__.24255__func__.23181__func__.23267__func__.23126C.374.24493__func__.23871__func__.23682__func__.23599__func__.23359__func__.23201__func__.23318__func__.23810__ksymtab_VB_Handle2Phys__kstrtab_VB_Handle2Phys__ksymtab_VB_GetBlkByPoolId__kstrtab_VB_GetBlkByPoolId__ksymtab_VB_GetPoolInfo__kstrtab_VB_GetPoolInfo__ksymtab_VB_CreatePool__kstrtab_VB_CreatePool__ksymtab_VB_Exit__kstrtab_VB_Exit__ksymtab_VB_InquirePool__kstrtab_VB_InquirePool__ksymtab_VB_Handle2BlkId__kstrtab_VB_Handle2BlkId__ksymtab_VB_InquireUserCnt__kstrtab_VB_InquireUserCnt__ksymtab_VB_Init__kstrtab_VB_Init__ksymtab_VB_AddBlkToPool__kstrtab_VB_AddBlkToPool__ksymtab_VB_DestroyPool__kstrtab_VB_DestroyPool__ksymtab_VB_InquirePoolBusyBlkCnt__kstrtab_VB_InquirePoolBusyBlkCnt__ksymtab_VB_GetBlkBySize__kstrtab_VB_GetBlkBySize__ksymtab_VB_CreatePoolExt__kstrtab_VB_CreatePoolExt__ksymtab_VB_Ha&: ndle2PoolId__kstrtab_VB_Handle2PoolId__ksymtab_VB_UserAdd__kstrtab_VB_UserAdd__ksymtab_VB_InquireBlkCnt__kstrtab_VB_InquireBlkCnts_apstPoolss_stVbConfs_apstBlkss_stSemas_stCommPoolss_stDevices_bIsConf__ksymtab_VB_Phy2Handle__kstrtab_VB_Phy2Handle__ksymtab_VB_InquirePoolUserCnt__kstrtab_VB_InquirePoolUserCnts_stFileOp__ksymtab_VB_InquireOneUserCnt__kstrtab_VB_InquireOneUserCnt__ksymtab_VB_Handle2Kern__kstrtab_VB_Handle2Kern__kstrtab_VB_IsBlkValid__kstrtab_VB_UserSub__kstrtab_VB_PutBlk__ksymtab_VB_IsBlkValid__ksymtab_VB_PutBlk__ksymtab_VB_UserSubReadLogProcWriteLogProcRead__func__.27856__func__.28143__ksymtab_CMPI_LogInit__kstrtab_CMPI_LogInit__ksymtab_CMPI_LogExit__kstrtab_CMPI_LogExit__kstrtab_HI_LOG__kstrtab_HI_ChkLogLevels_as32LogLevels_bWaitDatas_stLogFileOp__ksymtab_HI_LOGs_u32States_stLogBufs_stLogDevice__key.28146__ksymtab_HI_ChkLogLevel__kstrtab_CMPI_MmzFree__kstrtab_CMPI_MmzMalloc__ksymtab_CMPI_MmzFree__ksymtab_CMPI_MmzMalloc__mod_srcversion23__module_depends__mod_vermagic5misc_deregisterVB_InquirePoolUserCntCMPI_RegisterMod__this_modulesnprintfCMPI_StopModulessimple_strtol__arm_ioremapVB_UserAddfinish_wait__iounmapg_stVbSpinLockupcleanup_moduleprepare_to_waitmemcpyCMPI_MmzMallocCMPI_UserCopykfreeseq_lseekVB_PutBlk__wake_upvsnprintfCMPI_RemoveProcinit_modulehil_mmb_freeVB_UserSubcreate_proc_entryCMPI_CreateProcschedule_timeoutscheduleg_astModulesVB_GetBlkByPoolIdLogWritehil_mmb_getby_physkmem_cache_allocVB_InquirePoolBusyBlkCntVB_InquireBlkCntmodule_putCMPI_LogInitVB_CreatePoolVB_GetBlkBySizeCMPI_LogExitCMPI_ExitModulesg_aModNameVB_Phy2HandledownCMPI_InitModulesCMPI_ProcInitstrncpy_cond_reschedVB_GetPoolIdCMPI_UnRegisterModCMPI_QueryModulespanicVB_InitprintkVB_IsBlkValidproc_mkdirVB_ExitHI_ChkLogLevelmemsetCMPI_DevInit__memzeromisc_registerVB_InquireOneUserCnt__aeabi_uidivHI_LOG__init_waitqueue_headVB_CreatePoolExthil_mmb_allocCMPI_MmzFreestrcmpVB_InquirePoolseq_readVB_Handle2K3:ernVB_GetPoolInfoCMPI_DevExitCMPI_ProcExitremove_proc_entryseq_printfVB_Handle2PoolIdVB_InquireUserCntsingle_releaseautoremove_wake_function__copy_to_userparam_ops_intsingle_openCMPI_UnRegisterDevice__copy_from_user__kmallocVB_DestroyPoolkmalloc_cachesVB_Handle2BlkIdVB_AddBlkToPoolVB_Handle2PhysCMPI_RegisterDevice+ , + , +,M+ , I+3,3M+4+5+6,4 ,5,6+7,7$@|+ , +8,8M+9,9M+4+5,4,5+: ,:@+4+5 ,4$,50+;4,;<@@+4D+5H,4L,5X+<\,<d@h+4l+5p,4t,5+=,=@+4+5,4,5+>,>@+4+5,4,5+?,?@+ , ,04+B@,BHMd0l+Bx,BM0+B,BM+ , <+CD,CTM000 +D(,D4M<\+n`,n+n,n+o,oB+p,pB+n,n \+n`,nJ+q,qB0 d  I( c@ _ + , Y + , + D , I R8 +@ ,L Rh Y|  + , % + , + , ;d a + , + , M, +0 ,4 ML +P ,T Mp +t ,x M + ,<+@,DM+,M+,M+++,,,+,@ +$,(MH+L,PM\+`+d+h,l,p,x+|,@+,+,M+ ,$M@+D,HMX+\+`,d0:,p+t,|@+,h+l,tM+,M+,M+,M++,,+,@(+,,|+,M++,,+,@++,,+,@+,X+\+`,d,p+t,|@++,,+,@++,,+,@++,,+,@++,,+,@ 4+8,++,,+,@++,,+,@ +$+(,,,8+<,D@H+L+P,T,`+d,l@p+,+,M++,,+,@ +$+(,,,8+<,D@H+L+P,T,`+d,l@p+,+,M++,,+,@ +$+(,,,8+<,D@H+L+P,T,`+d,l@p+,+,M++,,+,@++, ,,+0,8@<+@+D,H,T+X,`@dx+|,+,M++,,+,@ ++,,$+(,0@4+8+<,@,L+P,X@\p+t,hL++,,+,@+,M+,h+l,pM+,M++,,+,@++,%: ,+,@('+,+,MQ+ +$,(,4+8,@@D+H+L,P,\+`,h@l+,8+,+,$M8@+H,LMT+X+\,`,l+p,x@|b+,!+,M+, 8 ( +, +0 ,4 ,@ +D ,L @P +T +X ,\ ,h +l ,t @x +| + , , + , @  + , + ,  + , j + + ,!,!&!I !+$!,D!MX!+\!,`!Mx!+|!,!!+!,"Rx"+|","M"+"+",","+","@"+"+",","+","@"""+",H#+L#,P#Mh#+l#,p#M#+#,#M#+f#,f#-$d $I4$+8$,@$x$$$Ip%I%I(&I`&;d&+h&,&8' '+$',('M|'+','M''Q''G'I(+(,(M<(+@(,L(M`(+d(,l(Mx((+(,(M(((+(,(+)+),),)+), )@$)+()+,),0),<)+@),H)@L)p)+x))+),),)Z)+),)Z)+),)Z)+),)Z)+),)Z)+),)Z)+),*Z *+*,*Z *+$*,(*Z4*+8*,<*ZH*+L*,P*Z\*+`*,d*Zp*+t*,x*Z*+*,*Z*+*,*Z*+*,*Z*?:+*,*Z*+*,*Z*+*,*Z*++,+Z+++,+Z$++(+,,+Z4++8+,<+ZL++P+,T+Z`++d+,l+Zx++|+,+Z+++,+Z+++,+Z+++,+Z+++,+Z+++,+Z ,+,,,Z ,+$,,,,Z8,+<,,D,ZT,+X,,\,Zh,+l,,t,Z,+,,,Z,+,,,Z,+,,,Z,+,,,Z,+,,,Z,+,,,Z -+-,-Z -+$-,,-Z8-+<-,D-ZP-+T-,\-Zl-+p-,t-Z-+-,-Z-+-,-Z-+-,-Z-+-,-Z-+-,-Z-+-,.Z.+.,.Z(.+,.,4.Z@.+D.,L.ZT.+X.,\.Z.+.,.+.,.Z.+.,.Z/+/,H/Z`/+d/,h/Zx/+/,/Z/+/,/Z/+/,/Z/+/,0Z0+ 0,(0ZH0+L0,P0ZX0+`0,d0Z0+0,0Z0+0,0Z0+1,1ZL1+P1,T1Zx1+ |1, 1Z1+1,1Z1+1,1Z1+1,1Z1+2,2Z 2+$2,02+82,<2ZL2`2+d2,3+ 3, 3M3+3+3,3,3+3,3@4+4+4, 4,4+ 4, $4@(4+,4+04,44,@4+D4,L4@P4+T4+X4,\4,h4+l4,t4@x4+|4+4,4,4+4,4@44+4,5+5,5M5L6+6,6M<7I7+7+7,7,7+7,7@7+7+7,7,7+8,8@8*: +8, 8M08+48+88,<8,H8+L8,T8@d8+h8,t8Mx8+|8+8,8,8+8,8@8+8,8M8+8,8M8+8+8,8,9+9,9@9+9+9, 9,,9+09,89@<9`9+d9,:+:,$:M`:L:+:+:,:,:+:,:@:+;+;,;,;+;, ;@0;+4;,@;MD;+H;+L;,P;,\;+`;,h;@x;+|;,;M;+;,;M;+;,;M;+;+;,;,;+;,;@;+;+;,<, <+<,<@<+ <+$<,(<,4<+8<,@<@D<X<+\<,=+=, =M\=L=I>+>,>M,>I>+>+>,>,>+>,>@>+>+>,>,>+>,>@>+?+?,?,?+?, ?@0?+4?,|5 9$hlX6\H?LX \PjTW Hpbt&`!di*V2ESg(\,Ahe.3O[HL/87<  ?: $K U0C4@DP$T014(4,MF8Q<@Dtx|`  T ,4]h  "!?:mmz.ko9Y9Y9Y~ELF(D4( -L @ 0 -L@`p@P@ -L -L0PH0S3/ -LP@p` P@e 2/00@0S e3/!! -L00@ -L@ -L4M00@80 8 Y,I8 W 0 P`4 ( p$  0,E4@0C@4 8@( 0T@D"0  ( $p@0.΃`0p,p#6 Ơp0L(pP@@'U,8Y,I0pW @e '54pˠ @,ˠ`.%e$Šp`P @ (K -L x-LPP@@`\,L 80S0C R(T :0S0C,Q,A@,xS b @x 0-L@PP PP@Q,A  80SPC^PN $\U, R,BP0 0-LPP@@Q,A  80SPC^PN \U, R,BP0 0-L@PP <,04P$P4P0@ -LM@P6 P8`V`F0!, @2 0@, 00Kp(0 ,@ .#50 $0 BpP`@W  @ p-L MPPG ``@($\= @@@1P*\  ?D1,@N^ $ (P*\P)*,@T,@D8 8 , C< ,00@($P@ ,5 B0 0@!LK:p@($P@ ,5 B0 0($@@ ,5 B0 0@ -LPP@`p@T,@D @V 0S ,P,@@\@W@ R\P -L,0@ 0! @ @0 @$(PP@!( dT`XPSZ\p0 0#03+ @1\ -LM@SPp` < 0 @@@ K -LMX@Pp`P 0PP K -L$MAP|p0@(KR@΁*@ @ T",@D< UH 8 @`D  0S 0,@T,@D% U`W P PYY@00K< 00PVD 8@  R@P8H\ @P@ @P <8@YD  <(0PPP   8PP@ R 8\PL 0R*00y00@!XP @1 -LM@SPp` 4 0 @@J@ K -L ML@Pp`P : 0 0P K -L@P`P" 00@Pp pP L  `$P,(8 0@@00< DH,8  @p -L@P`P 00@Pp pP M ,8 `@$P(0< H,8  @p4 -LM K K0A"S$<@8@@@@@@@@@@@@@@@@@@@@@@@@@@@@@<@8 K -L0M$K@(PK`$(@P( ] @P@ n @P< g @P8 ` @P4 Y @P0 < @Pp, J @ 0``@P @ < 8}$4z(0w@t(0D$*A00P (0$@@# L 0$K @0@P @ <M 8J$4G0(@~ p-LAMR@`"G_K ?0  003S T [Kp P @@ -L@0/00@ 0S 3/ -L0@STCT0STC T0TP@@@ 0-L@XT!2 @ 0@T X0\\P0 -L Mhp`@TTP% \\TPE' (0@ R!P0S\PAPP@T T \\ @TPB@h@ K@@ x-L00@@P 0P P ? P  ` `` P h0x0:@@ xl -LMh`pPS@P 0S L0S"ROP L 0P0\(K ʠ,Q0"8 Q0 0 Y 040 R0?S400  4 4  0prp08pp  0p4 w 0L0P p0L @0@ 00@\@  X 04@84 00@p -LMhpP@`U4mS% rS cSI dSptp3UX UpWPK  0 ?  03\?  @ p(K0t03U`X0SK` -? 03P X0 C ^E(''&|(|(|(|(|(|(|&P&%TEp  P r P0K@P  [P] 0p R 0(pQ@pd @ @ @03/ @0S 3/p !p* P, P(U3\\   @ @03/p!otSpK` -?U(0003S# R'P1pV @ pNpLhP 0SN L RP0SBCLP\L0S_pñU1 ? p  0p3W Xp$ 0c_pPPP 0X_pPPP( h0p 0 H0 @0P[ @Pu 1 1P ` 1 1p_  \00T T X0 hwPy pL^P0Sʈ_pP: PPhbPd ` p_( h pH0  p0P @P 1 1P p@p@@ p  [ =?΀  ~p 4 !  1 p4 w000   PQ _WPP!@P PU UP0S C\P p PpW;P Pp\0P0*\@p @@ p@ p@ p@ @p @ p@@@1 p l@p\ @4@p\@@ pH  @0@p\P @@p\P0L @l@g pD@ pH  @0   -L M 0? h 0H ^R0F STCBT0 STC> T0T^9 \"T00@1T$:00@\  o00nP K0<@@l@@D@@@@8 -LP -L -L0P -L0P -LP -LM00P  K p-L M@@@0P,`C`@ .Š B 00PS@Kp -L@: -L@i @P00@<00$0 -L@GNU_o| @u %]lW<)sI_do_mmb_allochil_mmz_create_v2hil_mmz_createmmz anonyget_mmbinfo_safemmz_userdev_openioctl_mmb_user_remapmmz_userdev_ioctlioctl_mmb_allocioctl_mmb_alloc_v2ioctl_mmb_freeioctl_mmb_user_unmapmmz_userdev_ioctl_mmmz_userdev_ioctl_rmmz_flush_dcache_mmbmmz_userdev_mmapauthor=liu jiandonglicense=GPLparm=mmz:mmz=name,0,start,size,type,eqsize:[others]parmtype=mmz:stringparmtype=anony:intdepends=vermagic=3.0.8 mod_unload ARMv7 +---ZONE: PHYS(0x%08lX, 0x%08lX), GFP=%lu, nBYTES=%luKB, NAME="%s" |-MMB: phys(0x%08lX, 0x%08lX), kvirt=0x%p, flags=0x%08lX, length=%luKB, name="%s" ---MMZ_USE_INFO: total size=%dKB(%dMB),used=%dKB(%dMB + %dKB),remain=%dKB(%dMB + %dKB),zone_number=%d,block_number=%d <4>hil_mmb_get: amazing, mmb<%s> is released! <4> MB Lost: phys(0x%08lX, 0x%08lX), kvirt=0x%p, flags=0x%08lX, length=%luKB, name="%s" <3>%d mmbs not free, mmz<%s> can not be deregistered! <4>MMZ force removed: PHYS(0x%08lX, 0x%08lX), GFP=%lu, nBYTES=%luKB, NAME="%s" media-mem<3>ERROR: Conflict MMZ: <3>PHYS(0x%08lX, 0x%08lX), GFP=%lu, nBYTES=%luKB, NAME="%s" <3>MMZ conflict to kernel memory (0x%08lX, 0x%08lX) <3>MMZ new: PHYS(0x%08lX, 0x%08lX), GFP=%lu, nBYTES=%luKB, NAME="%s" <3>MMZ exist: PHYS(0x%08lX, 0x%08lX), GFP=%lu, nBYTES=%luKB, NAME="%s" <3>Add new MMZ failed! anonymous<4>hil_mmb_free: amazing, mmb<%s> is released before, but still used! <4>hil_mmb_free: free mmb<%s> delayed for which ref-count is %d! <4>hil_mmb_free: free mmb<%s> delayed for which is kernel-mapped to 0x%p with map_ref %d! <4>hil_mmb_put: amazing, mmb<%s> is released! non-cachedcached<3>mmb<%s> already kernel-ma:pped %s, can not be re-mapped as %s./home/pub/platform_h3/drv/common/mmz/media-mem.c<3>ERROR: media-mem allocator bad in %s! (%s, %d)<3>%s: 'name' can not be zero!<3>MMZ: your parameter num is not correct! null<4>Add MMZ failed: PHYS(0x%08lX, 0x%08lX), GFP=%lu, nBYTES=%luKB, NAME="%s" :,<6>Hisilicon Media Memory Zone Manager <3>MMZ: your parameter string is too long! mmz_userdev_ioctl: copy_from_user error. <3>mmz_userdev:%s: mmb(0x%08lX) not found! /home/pub/platform_h3/drv/common/mmz/mmz-userdev.c<3>MMB LEAK(pid=%d): 0x%08lX, %lu bytes, '%s' <4>mmz_userdev_release: mmb<0x%08lX> mapped to userspace 0x%p will be force unmaped! alloc mmz_userdev_info failed! non-cachedcachedmmb<%s> already mapped %s, can not be remap to %s. do_mmap_pgoff(file, 0, %lu, 0x%08lX, 0x%08lX, 0x%08lX) return 0x%08lX _IOC_SIZE(cmd)=%d, arg==0x%08lX mmz_userdev_ioctl: copy_from_user error. hil_mmb_alloc(%s, %lu, 0x%08lX, %lu, %s) failed! alloc mmb_info failed! <4>mmz_userdev:%s: mmb<%s> is delayed_free, can not free again! mmb<%s> is still used! <4>mmb(0x%08lX) have'nt been user-mapped yet! mmb<%s> has invalid refer: map_ref = %d, mmb_ref = %d. invalid ioctl cmd = %08X mmz_userdev_ioctl: copy_to_user error. mmb<%s> mmb_ref is %d! %s->%d,error! _IOC_SIZE(cmd)=%d, arg==0x%08lx <4> mmz_userdev_ioctl: copy_from_user error. dirty_phys_addr=0x%08lx <4>dirty_virt_start addr was not consistent with dirty_phys_start addr! <4> dirty area overflow! do not call mmap() yourself! I'm confused, mmb(0x%08lX) not found?! I'm confused, mmb(0x%08lX) have been mapped yet?! map address 0x%08lX in kernel range! mmz_userdevDHP$hil_mmb_getby_phys_2hil_mmb_getby_kvirthil_mmb_getby_physhil_mmb_freehil_mmb_unmaphil_mmb_flush_dcache_byaddrhil_mmb_map2kern_cachedhil_mmb_map2kernhil_mmb_alloc_v2hil_mmb_allochil_mmz_destroyhil_mmz_createflush_mmb_byaddrunmap_mmbremap_mmb_cachedremap_mmbdelete_mmbnew_mmb:| mmzA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo.rodata.str1.4.rel__param__ksymtab_strings.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment40/ jP)d/% {h804 8|xC0$Z$0V | h<1Ld }( p2y203 >  }0>#?  (~pA$ ~,B : ,Bp,B/[B,CH ^   44,)`6@H N X ]D b g j ggg(,w g|H  g 4 @ \    d gDL| g      gl p p g  g      g  g8 <  <  "1, 74 gg(,g=g(,ggIh ggtxOxg8UH,m  s y   ` tgXh < g     4 D H :   #P g858R)gXoXI    4 T h gPPsg 9 _WgHHg((< gghh9gSg pyhg gg``gg@@g$<g0T0r4ptX 6X ] \@w b |( D g4    g$"("(" 7$ gd##T 1 y p IT 0  (      X  g,`,s T m  g\.gX X l  + : I X g v     8 g$hg `.  : - BgxTxghg|gggppg ggg| |  ! g !,t2DLQ$_ls,4<h`.$ @4    ( . 3 `? L p X j p |   .$   .    ,`    /0( p48 F W j q      h   , @   .$/ K ] ` n y  ,d      $ammz_seq_start.LANCHOR0mmz_seq_nextmmz_seq_stop.LANCHOR1mmz_proc_open.LANCHOR2.LC0.LC1.LC2$dmmz_seq_show.LC3.LC4.LC5media_mem_exit.LC6.LC7.LC8.LC9.LC10.LC11.LC12.LC13.LC14_mmb_free.LC15.LC17.LC16.LC18_mmb_map2kern.LC20.LC19.LC21_find_fixed_region.LC22__mmb_alloc_v2.LC23.LC24__mmb_alloc.LC25T.371media_mem_parse_cmdline : .LC29.LC30.LC27.LC28.LC26media_mem_init.LC31mmz_write_proc.LC33.LC32mmz_seq_ops__func__.20747__func__.20428__func__.20396__param_str_mmz__param_string_mmzsetup_zones__param_str_anony__ksymtab_hil_mmb_getby_phys__kstrtab_hil_mmb_getby_phys__ksymtab_hil_mmb_unmap__kstrtab_hil_mmb_unmap__mod_author1203__mod_license1202__mod_mmz1154__mod_mmztype1153__mod_anonytype126__ksymtab_hil_mmb_map2kern_cached__kstrtab_hil_mmb_map2kern_cached__ksymtab_hil_mmb_flush_dcache_byaddr__kstrtab_hil_mmb_flush_dcache_byaddr__ksymtab_hil_mmb_map2kern__kstrtab_hil_mmb_map2kern__ksymtab_hil_mmb_free__kstrtab_hil_mmb_free__ksymtab_hil_mmb_alloc_v2__kstrtab_hil_mmb_alloc_v2__ksymtab_hil_mmz_destroy__kstrtab_hil_mmz_destroymmz_info_phys_startmmz_lockmmz_listmmz_proc_ops__param_mmz__param_anonyanony__ksymtab_hil_mmz_create__kstrtab_hil_mmz_createcounter.20325__ksymtab_hil_mmb_getby_phys_2__kstrtab_hil_mmb_getby_phys_2__ksymtab_hil_mmb_alloc__kstrtab_hil_mmb_alloc__ksymtab_hil_mmb_getby_kvirt__kstrtab_hil_mmb_getby_kvirtget_mmbinfo_safe_usrdev_mmb_freemmz_userdev_releasemmz_userdev_openioctl_mmb_user_remapmmz_userdev_ioctl__func__.23860__func__.23762__func__.23930__func__.24108__func__.23779__func__.23810__func__.23885__func__.24001__func__.24058__func__.24076__func__.23730__func__.24248mmz_userdevmmz_userdev_fops__kstrtab_flush_mmb_byaddr__kstrtab_unmap_mmb__kstrtab_remap_mmb_cached__kstrtab_remap_mmb__kstrtab_delete_mmb__kstrtab_new_mmb__ksymtab_remap_mmb__ksymtab_unmap_mmb__ksymtab_remap_mmb_cached__ksymtab_flush_mmb_byaddr__ksymtab_delete_mmb__ksymtab_new_mmb__module_depends__mod_vermagic5mmb_numbermisc_deregisterouter_cachehil_mmb_alloc_v2hil_mmz_create_v2hil_mmz_find__this_modulehil_mmb_alloc_in_v2mmz_userdev_mmap__arm_ioremapmmz_flush_dcache_all__iounmapupmmz_read_procunmap_mmbcleanup_modulehil_mmb_map2kernhil_mmb_getby_phys_2memcpyremap_pfn_rangekfreecpu_cachedelete_mmbinit_modulehil_mmb_freehil_mmb_putcreate_proc_entry__ :bughigh_memorydo_munmaphil_mmb_getby_physremap_mmbkmem_cache_allocdo_mmap_pgoffflush_mmb_byaddrmmz_userdev_exitdown_writeup_writehil_mmb_gethil_mmz_createdownstrlcpynew_mmbhil_mmz_destroyhil_mmb_unmaphil_mmz_registerhil_mmz_unregisterprintkhil_mmb_getby_kvirt__memzeromisc_register__aeabi_uidivblock_numberhil_mmb_allocparam_ops_stringstrcmpget_mmz_info_phys_starthil_mmb_map2kern_cachedseq_readstrsepremap_mmb_cachedhil_mmb_flush_dcache_byaddrremove_proc_entrymmz_userdev_initseq_printfsimple_strtoulhil_mmb_alloc_inzone_numberseq_open__copy_to_userparam_ops_int__copy_from_userkmalloc_caches+ , +','+,8+ <, X+\,`Vx+ |, :+,R0+8,tR+,R ,@+ D, T: + , :+ , :(H:ht+|,A: +,HAl+p,tA|+ , :+.,.`l+&p,&tA+','A+(,(A+&,&A+),)A+*,*0A4++8,+<ADHX+ \, l:+ , +.,.I  \ &h +'l ,' + , :  +2 ,2 A  +3, ,34 AH \ +4` ,4d Al  :  +7 ,7 A  :H p  +' ,' + ,  P  += +> ,= ,> +? ,? A :   :, 8  E E+E,E-@+ D, |+ , It+.|,.I+Z,Z2C;EET+GX,G+H,HA:(:T:+ , + (, I+.,.I+Z,Z 24C<+ @, |;+G,G +H,HA(T:|:+Z,Z42HCX;t+&x,&+V,VA+Z,Z2C ;,+&4,&\+Vd,VlAtS  $(,04X+ `, t+_x,_|M+`,`M+`,`M+`,`M+`,`M+`,`M+` ,`$M8+a@,aTh;?+b,bA=+a,a 94;d+ch,clACYC +i,iA +j$,j(A@+'D,'P+T,++,,A+,A +(*4&+,A+& +(,,-0+8,<AP+ZT,Zl2+,A+,Al 8!6.O.0.K.0.".0.*/G+ , 54+#<,#TA\@p+$x,$|P+, +f,fA +$$,$(,0+g4,gH^LQX\l+p,tD80<X>\PKT O$H"L(*,h=l`9d@#DG0B4x1| N4 (p<t  LH X  LD )!*:hi3521_viu.ko9Y9Y9Yt ELF(4( -L00@ " "`"""h"""p -L rs S   S c  -LP P3 0(@0 0(@,@ 0,@@$00@$00(P@(@,@P P@ ,P0@$P$0  (Pp,@`0p(`,`pP` P,`@0` @P@P`$`0@ $ -L -L -L -LP00@   -L@2S0"00 -L 3@ -L M P@&?20@P@0@ @0 @Kt0 @  @080 @0 @J -L,MpQ @@@1 cV @RUC \@ $Q=  R: 0K 00 @003/ 0S`d$HL偠h4 H< PL$0 `P4<$dĄh|(1 | @Ϡ0 @01/@ 0 @ @B@  @@@t @ 0 t0 @l0C@0  @@80 @0  @@}80 0-LM@0S@@@/^?0υ<00@?0C/2K040 @ @JL x-Lh`@PPx x -L P& |2 @0 @  0 $! 8$P P1 @0 @ J@ =?PU' @$P* PP' <1 @ `<0 @P0$1 SSPP@$P P0 @<0p0 @<0 @Bp@ @< 0@J@ ADp -LM`pP: \ PPW~ @@@ P  Q @ CP4 ^_O$K ?4Z,@$PB P? 1 @0 @ 0$  ! @$P 0 @00@@5 @PPJPt0 @P0 @ PPJ<0 @PP @PPJpD -L@M`@@1 3 Rl QTFPKPP"4 pTpRTLP W%K QU |1 @K0 @BPPJ81 @Y 0 @0 @g @PPJ0 @R0 @PPJx0 @`PP @PPJ80 @B0 @PPJ -LDM@`P P KPP@ P+q Q) P P 3PUS P 1V p3 @K0 @BPPJO ?4^&@$PM PJ 2 @0 @0  $t @$P& 82 @B0 @PPJ2 @v00@@5 @Jl1 @0 @ JWVL1 @RPP0 @PPJuXKPP <pVpQV 0 @`: @PPJZP W0 a!Op0 @Y 0 @@40 @gPP @PPJ0pD -LMP00@@`! #RP PM 1 3 Q1V y?WX`P  0s rs r S0CQ4 @T0 @`J&$U%(!R 3 @ @BJl3 @0 @J K$3 @ @BJ2 @! @0ʠJ2 @0 @J{ @2 @40 @J1 @ 0 @prc 1 @F0  @PJX1 @  @Jz1 @= @0PJf0 @[ 0 @PHJT0 @+0 @JA40 @M 0 @ 0-LM@PP K0@0 @000@@5 @J 0-LM@PP PU K00 @00@@5 @J40 @$ @J 0-LM@PP PU K00 @00@@5 @J40 @ @: J 0-LM@PP PU K00 @00@@5 @J40 @ @J 0-LM@PP PU K00 @00@@5 @J40 @ @J( -LM`pP] PPW @@@ P  Q @ CP4 ^_O$K ?4Z-@$PC P@ 1 @0 @ 0$$ @$P 0 @00@@5 @PPJPt0 @P0 @ PPJ<0 @_P @PPJpD8 -L MP`P] PV @@@ P q Q =@ CP2 O K ?X.@$PD PA 1 @0 @0 0 $!, P00@$P 0 @00@@5 @Jx0 @0 @ J<0 @ @JpDH -L MP`P,U{ @@@ P%q 3S# -@ CP\s1 @0 @``J KO =?X&@$P: ) P& <1 @0 @0  $ @$P 0 @0 @ JP0 @ @JIτ`XpD -L M@`PTr P KPP@ P q 3S -P SP OpP_  =?X& @$P) P& h1 @0 @0  $  @$P 0 @0 @ J0 @j @J `Iυ @!< 0CD!pDl p-L M 0P@S9 S 0 @bc` @`Kp(  p` X P( #0(P` (0 -LMP  P K40 @4 @J -LPP@` 0@S E Cp \A  R9W \A  XR /X pX  XR$pW X p W X LЄH 0LH 0Z Z  XRR  X Xp W p WR     0h -Lpp@ 0SP`@ x` ԂX@PP  -L MP@P :  KP@``@ P q 3S -` cP NOOp l1 @0 @! =?X& @$P) P& 0 @0 @0$1 @$P L@80 @@0 @ @@J~pD -L MP@P  KP@``@ P q 3S! -` cP NOOp t1  @g0 @! =?X& @$P) P& 0 @0 @0$1 @$P L@80 @@0 @ @@J}pD -L MP@PU` P KP``@ Pq 3S -` cP@O =?X& @$P9 P6 1 @0 @0  $ @$P 0 @ @JH80 @0 @ J}pD -L MPQ@a P KPP``@ Pq 3S -` cP  @$O =?X6 @$P9 P6 1 @0 @ :0  $ 0 @ @J@$P H80 @0 @ JspD -L$M@`P Px P  p㜀@㨠`P0P@Pp (KP -L$M@`Pl Px< P |H Lpl@xD`@Pt<0Pp@Pp (Kh -L$M@`PT Px$ P 4` dp$@0\`XP,T0P(@Pp (K -L\Mp@@@@`@`@ @ @00@@@Ŕ5@%P`0sO @ @ @00@@``@`@@ @``@`@ P+ P`Pp p8\ `L XPH 0`0 p `@L`Hp\0 pP QPp@` @ @00@`@`@@``@ `@``@HT` @ P L@KL `X@ @H0@ P `V AT4 ^1 0S. $0 PSHP i SR  @ (#R ^3,#R Q(0#R \4#R P8#R 0S<#R ^@#R QD#R \H#R PL#R 0SP#R ^T#R QX#R \\#R P@ @ @00@@@@@ @@@ #R 0Sx$#R ^m(#R Qb,#R PW0#R \L4#R 0SA8#R ^6<#R Q+@#R P D#R \H#R 0S L#R ^P#R QT#R PX#R \\#R 0S@ @ @00@@@@@ @@@ #R ^$#R Q(#R P,#R 0S0#R \{4#R ^p8#R Qe<#R PZ@#R 0SOD#R \DH#R ^9L#R Q.P#R P#T#R 0SX#R \ \#R ^(K                 ~ s h ] R &              :         U J  ?  4  )               -L -LOMpQH # R PT H!@@@ 3SP1 & @bV 0S P  R X X XQKXX KH<K00@< 40 0K H13 T !T 2T 4 @0 @K 4DTu JpD T 9X0DT `DTTT TH  TB T') DT@ # DTb $D T T9 T2  T+) HTB &H T: )90HT*) DT# d%D T (90DT~|0:zxusqom h igd90DT ) DTMYV-) HT H T  DT;GEC0DT )4 DT,97" HT )4 HT 1H T)'%DT /) DT ,90DT  9T )T )T 9T90LT L T LT  p-L M@@1 SU< Q 00@ P@A00; 1!rs `V  R0`` KpS  !S`ca P` ` <0 @o0  @ -LUMpp@1@@ Z L1S, dK@!D DQ@d  PH `L Pa  T X \! @PSPa Qt \ OPL1@PS(K\0D!H000000L\PTX!00000d0 P9@P Y @2S`1 N 0SK ` RG QD @1( P@!, PJ@6 @ @(  @0, 5 @0 @L1x5 @0 @L1p@,5 @ @  @dX K8l4K ( , 03/0S S4 p l l14 l! 4l# 0 l4  dX OK @1X `10K*:  08/P@!0@@x Q0 H 1d x0 D < @ X T P L 8 ` ` @!^`xx `d KPxx 0OK P&R!pp@o P1P. il `Ɣ; @@`@`0 @fooKh @q4Kⴁl 2/4Ɣq 封   ZHf1 1P Re@on PPu@o Pƚ\f@ !R `P X P_ @ h: @ @x  @`f:f5Ɨ: @@`@vj`0 @f!9 @0  @'`P X P @X9 @ @Ln` @`fo> ```@ĢZ5 0S2 Q/ P, K X  X YK 14KSS `1d1 d  ! `! l 9/X1S\ S41 p( 4 8! fKo `C``@ĢZ 0S Q  R P  K X  X YKl0d0K`a 9/X1S S0 p 0081 <1  T 0! P 0 H X 0oKD1 4K `06/P  Q ` `@Q a 0S10  R !  `4Q oK8g1 @ 0 @`PPPJ0 @ @PPJ{X Pe ah0 @QP @!PPPJaP^_O\>XP?O -L0 @J@ -LMQ@``JqVp@ @L Q00PNPB 0 R0PZCY4  V4 YP A ' Y 0@0 P-  V  Y 0C P Z  V@@ c1@(KT -LMQP0 s `P>@@@0r"2 $ WD:W2 WY  @ \A rPc @"W @  L U X 040 04 !P 0B((K1 @"0 @ ! g40 2W400 @#n`0 @ !`40 40\0 @ @``J@@ 72@@@@d -L -L -L -L -L@ # -L -L -L -L -L -L -L -L -L0P@ -L -L -L -L -L -L -L 3:-L -L -L -L -L -LP -L -L -L 0R P -L -L0P -L -LPPP00J -L00@ -L -L -L -L -L -L M@@@P`l0S$Kp(p  R p,p $4 0P X&P@ P] P44`K(pK( 0 3/P)l@`K0( 0<0  @@@ 14@@@@ -L -L 0-LM@P0  0  ( $ P$00$0 P P (KK0 -L$M@P`DKpP @ 8\p@ 080 0p ^(p 4` p,` 0p 4 K,K $ K -L0R0@P0% @X ` 0`$@p@  -L00@ 0#   -L -L -L -L -L -L -L -L -L -LM0Kp0P`@pp0p  Vp 0 :R    pV0:!p    !V0* pV 0:R  pV0 :!p!V0*@@@40 @RϠ0  @$K -LMP8 8 0S0<0 80K< 0`@s`000 PR0  @  >>>ǃ K @@ @]1@ -LMϠP ,? B!0P S S S @'< K@'<@'<@'<@@ (*: .1@ 0-L8M@0SSSPPS00Q$H H  H HH H !H HH H $ \     Ā $ ( N( A ( (( (  $08 8 80Āc U      Ā$$$(, N,A, , (, ,$4Đ, < < <4A S4 8     04($<@0 N00 L000 00 0(Ā8$D@ @ @084 4LP $0 $$ $$ $04,TX 4 A40B040 44 4 ,$<Đ\D D D0<4K0 -L M@ 0 2K -L M@ 0KK K0K020 KK K0K02K -L M@"  02K -LE -LB1 -L@101 -L -L0 -L4 -L01 -L M@  $!(0 1K(,! K0,1K -L M@ $! (10 [ ,! 1[0K -L<! -L@8A -L8 -L@01@0A -L M@"  02K -L M@"  02K 0-LM@PT/ T K0$ $00$0 $$ $$ $06& ( ( ( (05(0 (( (6,0 ,  , ,, ,06&P   050  &  0 00   6 0    06 0-LMP@0A B   01)?: 0A B  01K0 -L@1081 1 B0 L81 -L M@%  05K -L M@50   05K -L M@   00K -L M@   00K -L M@   00K -L M@   00K -L M@t@8 AK080K -L M@t@4 AK040K -L M@t@0 AK000K -L M@t@( AK0(0K -L M@t@$ AK0$0K -L M@t@  AK0 0K -L M@t@ AK00K -L M@t@ AK00K -L M@t@ AK00K x-L@`P         x 0-LM@P0  "     0    00K0 -L MR@@   00K -L M@   00K -L! 0-LM@PT TD60  DƀK0@&  0@6@@ 4@@@@ -L@   -L*<:            0-LM@PT TL60  LƀK0H&  0H6@@ 3@@@@ 0-LM@PT TD60  DƀK0@&  0@6@@ 3@@@@8 0-LM @0BS'PP  @  t   K0  @@ G4@P -L -LM@T00 T0#30 K  @@ 2@@@@h -LM@T00 T 0 K# @@ u?@@@@ -LM00@0ǓQ \UTULU ``@@\@ ^0 P Ppp@p㈡@X@`0` ZP@ H` pD$(< 8\$RF 0SC Ȁ0P Q̐H pDp Ԡ< 8  ``@@\@ ^0 P4 :c Ppp@p㈡@X@`0` ZP@ H` pD$(< 8`$R 0S ̀0ȐQP p``@Hp ԠD <  Q``@ Q``@`p@^@ W0 P8 pp@ Ppp@p㈡@X@H Z`P@<8` D0`  p$(1S= S@ S@ S@@1S1pp@0a0@\@` 1堁夡S!h d \ P H D X  @< V @8 1S} @0 1So @T 2Sb @2SR ``@2SF @ 0 @Yh@d`@\ XPHD< 8$0p(,T48`0<@3S@ S@ S@ S@@3Spp@ Spp@ S @pp@pÔ0c0@\@` 밃3h Să#P d @X H D \  S @@V@ V@@3S@<  S @@< 4S@8  S @@8 4S  @0  S @@0 4S``@ S``@ S@``@`4S00@T0  S@@T 0@Yh@d`@\ XPHD< $,80Tp(048`<@Z2S@2Spp@㰢0b0@Z@` 2”S㸂"h d X P H D \  @< V@8 2S@0 3S@T 3S@ 3S``@3S5: @ 0@Yh@d`@\ XPHD< 8$0p(,T48`0<@QV@ !R00@\0 ,@@^x @ l !<$1R48h p0 @ 4 xd (t 0L @ !R@` 刁@ 0X\@pt@l L @4hd` 倀(,$2Q@ R @\ $00@8^x @ h x (R,044 d L0 p x@ t 0l @ | R@` 倀 @X\ 0@t4@,hd Llp@ `倀($,Q@ Q@ Q@ Q@ 0Q0@@0#R00@\0  R@\  0R0@@\ <3@PSx @ p #LÔ4R8@3 D @4 d t l0 L x h H@ R00@0  R@@ #R@`  R@@` 嘃@ 0X\@dt@p l L@4h `$,(g$Q@("R @\ 4@H^x @ l "D”0R<2@h p @0 4 xd ,t 8L 00@0 "R`@` 吂@ 0X\@tp@l L @4hd` 倀(,$ 0S S@ S@ S@@ 0Spp@㠠0`0@Z @ ` 0圀S尠h d \ X H D P @< V@8 0S@0 0S@T 0S@0S@6: ``@1S4@ 0 Yh@@`d@p X\HP<D$0 8,T(408`<@@Tdh@ 0 @0@  4 *      @@^@ ^@^@ ^@^@ ^@^@9 ^@3^@/ ^@)@@^@` ^@Z^@ ^@^@ ^@^@ ^@|^@x ^@r^@. ^@(^@ ^@^@ ^@^@P ^@J@@4@@w^@| ^@v@@@@@@@@@@h@@@@@@m@@:@@@@0@S\ Spp@Z `S`@pp@pSQ@ Q@ Q@ Q @@Q@ Q@ Q@ Q @@Q@ Q@ Q@ Q @@S@ S@ S@@ 1@S Spp@ `S`@pp@pP3S X3\#S`00@ S00@ S00@ S@00 0d@0 <ÖhP p3tSx# S00@ S00@ 7:S@00PQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3S p3tSx# S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3S p3tSx# S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3S] p3tSx#| S00@z S00@v S@00pPQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3S p3t#Sx S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3S p3tSx# S00@ S00@ S@00 PQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3S p3tSx#~ S00@| S00@x S@00rPQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3S p3tSx#4 S00@2 S00@. S@00(PQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3Sk p3tSx# S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3S= p3tS8:x# S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@00 0@d 0 <Öh3S p3tSx#F S00@D S00@@ S@00:PQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3S p3tSx# S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3S} p3tSx# S00@ S00@ S@00PQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3SO p3tSx#x S00@v S00@r S@00lPQ X3\S`#00@ S00@ S00@ S@0 0 0@dÖ 0 <h3S p3tSx# S00@ S00@ S@000R0@@` w S @@S``@ S@``@`R@ Z R@@ RR  @\ . R@@\ &R@  R@@ R  @\  R@@\ S@@uS@@T hS@@0 Z0V0@ @ 8 LS@@< ? S @@SS``@J S@``@`CS@@7S@@T *S@@0 0V0@ @ 8 S@@< Spp@ `S`@pp@p0R0@@` 0R0@@` aR@ V 9: R@@ NR  @\ * 0R0@@\ " S @@S``@ S@``@`S@@S@@ T S@@0 |0V0@ @ 8 nS@@< a00@ 0@d 0 <Öh3S p3tSx#00@ S00@ S00@ S@0 0 0@|Ö 0 <@@)``@1``@@``@(@``@@@@?``@V@``@P``@ @``@``@@ ``@@,``@8@@@+``@l``@)``@@:``@`Q``@ Q``@`Q``@ Q``@`Q``@! Q``@`Q``@ Q``@`Q``@Y Q``@`TQ``@ Q``@`Q``@ Q``@`Q``@Z Q``@`UQ``@ Q``@`Q``@ Q``@`Q``@ Q``@`Q``@ Q``@`Q``@ Q``@`Q``@ Q``@`Q``@e Q``@``00@ 0@| 0 <Ö00@ 0@| 0 <Ö00@ 0@|Ö 0 <00@ 0@| 0 <Ö00@ 0@|Ö 0 <00@ 0@|Ö 0 <k00@ 0@|Ö 0 <s00@ 0@| 0 <Ö!00@  0|@0 <Ö00@ 0@|Ö 0 <:: 00@ 0@| 0 <Ö00@ 0@|Ö 0 <00@ 0@|Ö 0 <00@ 0@|Ö 0 <00@ 0@| 0 <Öpp@pp@3pp@pp@}pp@Rpp@Upp@pp@pp@hpp@pp@pp@pp@pp@pp@ -LM P !P8  @@ @b1@ KpP -LM00@2S K R Q   :Q@@$ 9@0K3/ 0-LMP@1$DT K040 @0 @$ -LM00@2S R Q   Q Q @@ r9@ 0K3/P KT0 @X  @@@ w9@< -LM00@2S \ Q   Q Q @@d J9@0K3/ K00 @/ @L -LM0P@`SK pp@R$t 4R   0 0 @ 0  @P0  @0 @  @0\ -LMP R 00@P  KT0 @ @J  0 @t -L M@0S    !K00 @ˠ0  @ p-L M@@@aP; :0$Ė` @04c00 @00@ Q@0Ą4 KpJ. -L Mp @,QlPY0 0S P 4Q@P!(KP)@ ,4#0 @`0  @@H0 @0  @@ -LM 0@0p`P@,`P@ pK -L -L@@@B03(00,00000400011411811<11822<22@22D22@33D33H33L3 -LM4PK@`pTpt 0$ 4 0 (0 KT Tpt 4 0 ( $ t0p( 00 4 $0 0-LM @1P$DT3 1 S( PR . @0QK0QS SQ\ q3\@@ ^<@ -LM @PT 000K2S s S `\p  PU@   -LM@@@$DT S ”\Ô\\ K”\ Ô|3\0 0S202@@ ::@ -L$M@QP` Rq P8  8(K @$< @ 0S 8`p1PN <!\` `` p@`V` & ^ RR   b4 偑a4<: 0 h j 0ÀNJ 㒀n)Ġတ!$   0S1P``|0 @ @  J8 80 @ @J8 o -LtMPP@@SP$d 2S4 08pK0 P 8\ 4^)P& 80S Q (K"Rs0W0,K p !Q ZĢ020q03꜀K  -L`P@pP 0 0 x-L0@`PS 0 @PDx0$P 0x0 0@PDx -LTM@@p1P$dP Q xu U 0Ue Kl K5EP[P ERU 0 @0 @P!d`V Pp [80 @0 @P$ -L@P00 -LM@@@UU K` 0e5p5Z @0p@pPJ. e80 @ @8 0-LM@@@ PP$4S ,6 @l$Ĕ0 @$$T(PP@Q 5 @l(ĕ0 @( ($,PP@P h5 @l,ĕ0 @,0,40PP@Q 5 @l0ĕ0 @0 0$4PP@P 4 @l4ĕ0 @4044=:8PP@Q <4 @l8ĕ0 @8 8$<PP@P 3 @l<ĕ0 @<0<4@PP@Q t3 @l@ĕ0 @@ @$DPP@P 3 @lDĕ0 @D0D4HPP@Q 2 @lHĕ 0 @H H$LPP@P H2 @lLĕ 0 @L0L4PPP@Q 1 @lPĕ 0 @P P$TPP@P 1 @lTĕ 0 @T0T4XPP@Q 1 @lXĕ 0 @X X$\PP@P 0 @l\ĕ0 @\0\4`@@@Q T0 @l`Ĕ0 @` `$ K0H p -L@@@5SZJ -L MP@P  K``@ PNOOq$4S - =?X @(P# P 0 @S`0 @$@(P H @40 @O0 @@J` p -LP`p@P 00@q$dF?  -L@P@A$4p -L M``@P0S X P (Q 41 @0 @@@@J(K㈠ @Pa$p  R0 @G@ 0 @!@@@J+>:~ U`0 0 !U0 0!@@ 7PP@Px -LMPP@P` PP>pP00@q$4S  R !TQ 0 K0 @k0 @J0 @0 @@J80 @0 @J -L@P@A$4  p-L M@`PP@Q$T 0Sp0 @?0 @J KpP`@ p-L M@`PP@Q$T0Sp0 @0 @J Kp\P`@ p-L MP@`P 0P  @a$$Q Kp|0 @m0 @H00J80 @u0 @G00J x-L@`PP x`PP@a$20 Ðpl  030x -LMPP@ PPz"@0Q Q[ 1S P> Qb`V_0S\p`P-A$D^l 4K 4` ( 0` ,` τTPU P7΄lPHh  ! $K R \ l1 @.0 @``J$1 @g`0  @` 0 @80 @0 @``J`|0 @E0 @G``J80 @$?: 0 @``J -L MPP@P PP+`P@1$4 R/ pqTQ; P×\  P# K1 @0  @@0 @0 @``J0 @f`0 @``J<0 @0 @@``J -LMPP@P PP0`Ppp@ !$tP3S e1PÓ\ P qP#$K0 @0  @@ 80 @oΠ0 @``J -L MPP@ PP?r@0q PU( QE ! RS `PP$P\ P/P*0 P!0 0 K\1 @~0  @ 1 @w0 @PPJP0 @0 @ PPAPPJ0 @0 @!PPAPPJ<0 @0 @`APPJ( -LMPp@P $KP@@ 1$dV! Q  P_p`TÇ|0 @F@0 @@@J80 @ 0 @@@J@ -L@p@PP ``@$W $4-xSSSHS P T !P Ta$Q   -L@P P@?:@A$4P@P  -LM`@P400@P$t RF 00 00PQ 00 00P2 $ P"@0SS PU -$4x`SSSLSHS` R` !(K 1 @|0  @00 00Q$ P0 @g0 @@@J0 @nE@0 @G@@J<0 @v0 @P@@@JT -LLM@`PN PP@$t0ST `@Kh@ \ P P(KP P@ h``0H 0P2! P P|0 @0 @GPPJ80 @TP0 @PPJh -LM@pP`P $KP>  P4X, P,@$ p, \"0,0pCr p Pt002 ! P `80 @0 @G``J -L M`@P> PP(@$t0S$  P0d4R; S Q6 $0 " 1 B00 $ K0 @&0  @0 @0 @ PPJ<0 @:TP0 @APPJ -LMpP@P (K@1A*: $dP P01 R|S Qw P@Y>0  0R 0SH$ QE1 @ˠ0  @P, $4ᐁ"0  0p 0 01 @Ϡ0 @@@J0 @0 C@00  @ H@@J$ o|0 @C@0 @A@@J^80 @0 @ @@JM  p-L M`@PPV) "00@P 0Sp Kp0 @50 @PPJ L0 @;40 @1 @PPJ p-L M`@PPV3 "00@P 0S  Kp0 @RP0 @PPJx0 @0 @PPJ40 @ @PPJ -LPp`@P P@` Pb0Q  -LM@PPr``@0S(KX0BΆ `a R Pr `S Z[ R Qn `SQʄ0@m XPh  80 0 080 XPY 4 400 XPK $4  X? p ! 80 80P R \ `S R ^ 80 80P Pu80 B): 80P Pm80 80P P<0 @~0 @PHPPJS p-L M@PPb@a0SQ   Kp80 @5Π0 @PPJ -L$M0`K@pPW P PP@㉁0SuP (KQp   P@ @  0 0PQ 8@ 4 8K0PH@PpPX  0 0P98@ 4P 8K0P0@PpQ 4P P8@ 8K 0P000 0P8@ 4p 8K0P@Z p0 0P  x0 @/0 @AJ~40 @Ϡ @Jn -L$MpQ@ PP (KP ``@㊁0SsP Pa   P@ 0K@ 0 0PP8@ 4P 8K0PG@`pPX  0 0P88@ 4` 8K0P/@`pQ4` `8@ 8K 0P 000 0P8@ 4P 8K0P@PU  P0 p0P P~ P|x0 @RP0 @APPJk40 @} @PPJ[( -L M@P P p0P0K\0 @j @J@@ o2@@@@@ -LMpp@1P$DT 8`PM HQB #R> ,Ô\L,ÄP 5O/C<:PK PP@l@@@@@@ \6@h -LM`PP8 p@$D0  "!4pK@@4 0"ȟxX ^P 0 4 @?* 0SRd1 @up0 @p P60 @ͅ0 @P0 @0 @!0S 8(K@@8 ]>PP@P@@ 5@@@@ -LD&: MPP@`Y QG 00@l0S K0 R 4P ,` 4 p(K0p 4K08/( p XP 0(0,, 0 ,  0 0T0 @Π @J  0 @o -LMP@1$DT 8qnW  +P`W Q d2 @f 0 @$KP{Ô0L Hs3#p( K0(Pp8 #% P 1 @n0 @  / !03\p( K0(Qp  # p  ( p  @@8 *;@@@ 9;@@@@ p-L M`@@1$4S( P Q0 @ 0 @!Kp|0 @0 @00 @0  @ -L,M00@aP$DT Qa "RX 0S(Kpp@l8/8 0K0$d<  P@))0 QQSR Yㄓ 00@ R$ R$P3S XA X002  $10Q` 8袄„l 2/@j0P>"PH4 @0  @0 R R20 l`6/"@`bQE3::b䒄X 00X |3 @4”0 @03"@ 0b2S_*P25 \ < R4 00@pY <P㈓YQ00@ㄓ R$]0R_Sa00@0,3\$(3$Æ L2(# @ 0 @Yq 00@ R$41 @B0 @03+y3”1 " @%000@Q@Ϡ0 @܀82|S$#R0 @O0 @030300@$(#$Æ0 (3 @p0{  @0[<$(#Æ0$3( 0 @s x-L@`P P!x!x -L4M`pPJ P @ @p0 @PP=4 ~@ 2 @@ 0 @Y l 310@ R1 @@Þ@Î@  @0(K8,1 @@@Î塍  @00 @㑍0 @㴀0l0 2/0 @8 4 Î4 nP废4 8 @0Ӏ0   -L@@@ 0-LM @@PP @*@@@  0 @0@0S3P@ 0 @0@! @@@F0:K0,VIU_ModInitViuSetRegDelayTimeViuFillUserPicViuUserPicCreatScaleTaskViuIoctlVIU_InitViuGetLumaViuInitChnCtxViuCheckBindExtChnDisableViuGetRotateViuCheckRotateViuSetRotateViuCheckExtChnAttrViuFlashTriggerViuGetFlashConfigViuSetFlashConfigViuGetCSCAttrViuSetCSCAttrViuGetLDCAttrViuSetLDCAttrViuGetExtChnAttrViuSetExtChnAttrViuGetUserPicVbBlkViuPutFrmVbViuDisableUserPicRegionViuEnableUserPicRegionViuGetChnAttrViuQueryViuProcViOverlayViuProcCoverExViuCascadeDisableChnViuCascadeEnableChnViuCascadeDisableViuCascadeEnableViuDisableVbiViuEnableVbiViuGetVbiAttrViuSetVbiAttrViuEnableChnViuClearChnMinorAttrViuGetChnMinorAttrViuSetChnMinorAttrViuSetChnAttrViuGetChnBindViuChnUnBindViuChnBindViuSetUserPicViuDisableUserPicViuDisableChnViuStartNoIntDetViuEnableUserPicViuDevIoctlViuProcNoIntDetViuExtChnReceivePicViuProcDsuScaleViuSendPicViuLDCTaskCallBackViuProcRotateViuRotateTaskCallBackViuDsuScaleTaskCallBackViuProcChnPicViuProcLDCViuCoverExTaskCallBackViuOverlayTaskCallBackViuFillUsrPicCallbackViuUserPicScaleCallBackViuDeInitChnCtxVIU_Exitraw_isp_bypassg_bLowPowercsc_ct_modecsc_tv_enintdet_intervaldiscard_intint_timestop_int_levelmax_cas_gapmin_cas_gapint_gap_timedrop_err_framedetect_err_frameVI_UF_BUF_InitVI_UF_PutBusyVI_UF_PutFreeViuUserPutFrameViuGetVbViuUfGetDepthVI_UF_BUF_DeinitVI_UF_AllocNodeViuUfSetDepthViuPutVbViuUserGetFrameTimeOutViuUserGetFrameViuUfRlsBusyListViuUfRlsBusyViuUfReceivePicViuDrvIsAllChnDisabledVIU_DRV_LowPowerDisableChnClkVIU_DRV_LowPowerEnableChnClkVIU_DRV_LowPowerEnableDevClkVIU_DRV_SetDevExClkVIU_DRV_CheckDevExAttrVIU_DRV_CheckDevAttrViuDrvCheckChnScaleViuDrvUpdateSubChnAttrByChipViuDrvSetSubChnAttrVIU_DRV_SetDevClkVIU_DRV_CheckExtChnIdVIU_DRV_CheckChnIdVIU_DRV_CheckPhyChnIdVIU_DRV_CheckWayIdVIU_DRV_G%: CheckDevIdVIU_DRV_CheckBindAttrViuDrvProcPrepCdsParamVIU_DRV_CheckChnDestSizeVIU_DRV_CheckChnAttrVIU_DRV_SetChnIntfCfgVIU_DRV_SetDataLayoutVIU_DRV_SetDevEnVIU_HAL_SetAdChnIdEnVIU_HAL_GetChnRegVIU_HAL_SetScaleEnVIU_HAL_SetScaleOffsetVIU_HAL_SetScaleStepVIU_HAL_SetScaleHAttrVIU_HAL_SetChnScanModeVIU_HAL_SetChnCombineModeVIU_HAL_SetAdChnIdVIU_HAL_SetDataOffsetVIU_HAL_SetDataMaskViuDrvGetCasChnCtxViuSetModifyFalseViu_DRV_GetChnIntCntViuPutRegionViuGetRegionVIU_DRV_AdaptRegionRectVIU_DRV_RegistSendPicVIU_DRV_DisableCascadeChnViuDrvChnAutoDisableInterruptViuDrvChnAutoEnableInterruptViuDrvProcCapFrmViuDrvUpdateSubChnAttrViuProcCoverViuDrvFrmRateCtlVIU_DRV_InitVIU_DRV_DeInitPhyChnCtxVIU_DRV_InitPhyChnCtxVIU_DRV_EnableCascadeChnVIU_DRV_GetVbiAttrVIU_DRV_GetChnMinorAttrVIU_DRV_GetChnAttrVIU_DRV_GetChnBindVIU_DRV_EnableCascadeVIU_DRV_EnableVbiVIU_DRV_DisableVbiVIU_DRV_DisableCascadeVIU_DRV_SetVbiAttrVIU_DRV_EnableChnVIU_DRV_SetChnMinorAttrVIU_DRV_SetChnAttrVIU_DRV_SetChnUnBindVIU_DRV_SetChnBindVIU_DRV_GetDevAttrVIU_DRV_GetDevExAttrVIU_DRV_DisableDevVIU_DRV_EnableDevVIU_DRV_SetDevAttrVIU_DRV_SetDevExAttrVIU_DRV_PutVbBlkViuDrvProcSendFrmVIU_DRV_DisableChnInterruptVIU_DRV_DisableChnViuDrvGetFrmVbBlkViuDrvProcPrepFrmViu_DRV_ProcNoIntViuDrvChnProcessViuDrvSetCcIntErrViuDrvInterruptRouteversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparm=raw_isp_bypass:0: isp enable, 1: isp bypass, default.parmtype=raw_isp_bypass:intparmtype=g_bLowPower:uintparm=csc_ct_mode:1: apply new csc contrast adjust mode.parmtype=csc_ct_mode:intparm=csc_tv_en:1: csc coefficient matrix[16~235].parmtype=csc_tv_en:intparmtype=intdet_interval:uintparmtype=discard_int:uintparmtype=int_time:uintparmtype=stop_int_level:uintparmtype=max_cas_gap:uintparmtH%: ype=min_cas_gap:uintparmtype=int_gap_time:uintparmtype=drop_err_frame:uintparmtype=detect_err_frame:intsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 viunload viu.ko for %s...OK! Hi3521%s[Func]:%s [Line]:%d [Info]:VI register failed load viu.ko for %s...OK! u32DelayTime is %u, it must be larger than 10us warning: u32DelayTime is %u, it is too long! u32DelayTime is set to %u NULL point can't get vichn%d's context can't get DSU export function, it may be DSU module has not been inserted pfnDsuBeginJob failed ! vichn:%d Add DSU task failed ! vichn:%d pfnDsuEndJob failed ! vichn:%d MPP sys not init ! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/viu/viu.c!s32RetHI_SUCCESS == s32RetThe Chip is %x, it doesn't support GetLuma. malloc chn ctx for chn%d err ViuInitChnCtx for ViChn:%d pstChnCtx:%p Ext-chn %d is bound to Vi %d Chn, must disable ext-chn %d first. The Chip is %x, it doesn't support Rotate. Must call setChnAttr first before setting chn rotate attr. Rotate value can't be changed when chn is enabled : 0x%x. Invalid enRotate : 0x%x, must be in [ROTATE_NONE ~ ROTATE_BUTT) VIU_DRV_GetChnAttr error : 0x%x. Channel output pixformat error. Only sp420 can be supported when rotate is enable. Can't support rotate when field pic output. Parent Chn(%d) is not configed, must config parent chn first. Can't change BindChn when chn is enabled. Can't change stDestSize when chn is enabled. Parent chn can't be same as ext chn. vi chn %d stDestSize.u32Width(%d) item must be align at 2. vi chn %d stDestSize.u32Width(%d) must be smaller than %d. vi chn %d stDestSize.u32Height(%d) must be smaller than %d. vi chn %d stDestSize.u32Height(%d) must be align at 4, when capsel is both vi chn %d stDestSize.u32Height(%d) must be align at 2. vi chn %d , Srcfrmrate:%d or frmrate:%d value can't be less than -1. vi cI0:hn %d ,Src FrameRate(%d) and target FrameRate(%d) must be the default value(%d) at the same time vi chn %d , target frmrate:%d can't be larger than src frmrate:%d. invalid pixformat:%d of vi chn %d. Over the max(%d) ext chn num that can be bound to vi %d chn. The Chip is %x, it doesn't support Flash. The Chip is %x, it doesn't support CSC. The Chip is %x, it doesn't support LDC. Can't get ExtChnAttr, attr of ext-chn %d hasn't been configed invalid frame format vi chn %d UserPicRegion disable ok vi chn %d UserPicRegion enabled ok %6u%12u%12u%12u%12u %12u%12u%12u%12u [VIU] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time: [May 4 2014, 19:31:48] -----MODULE PARAM-------------------------------------------------------------- %16s%15s%15s%14sdetect_err_framedrop_err_framestop_int_levelmax_cas_gap %16d%15d%15d%13d -----USER PIC INFO------------------------------------------------------------- %8s%8s%8s%8s%8s%8s%8s%10s%8s UPicIDWidthHeightStrideFieldPixFormPoolIDPhyAddrbUpdate%8d%8d%8d%8d%8s%8s%8d%10x%8s -----VI CHN STATUS------------------------------------------------------------- %6s%10s%10s%10s%12s%12s%10s ViChnbEnUsrPFrmTimeFrmRateSendCntSwLostRotate0%d/10%dNONE90180N/A270%6u%10s%10u%10s%12u%12u%10s -----VI CHN CALL DSU STATUS 1------------------------------------------------- %6s%12s%12s%12s%12s %12s%12s%12s%12s UsrBgnNOkUsrCancelUsrEndOkUsrCbOkCvrBgnNOkCvrCancelCvrEndOkCvrCbOk -----VI CHN CALL DSU STATUS 2------------------------------------------------- OsdBgnNOkOsdCancelOsdEndOkOsdCbOkScaleNOkSclCancelSclEndOkSclCbOk -----VI CHN CALL DSU STATUS 3------------------------------------------------- RotateNOkRotCancelRotEndOkRotCbOkLDCNOkLDCCancelLDCEndOkLDCCbOkAdd DSU task failed ! Overlay:%d, vichn:%d Add DSU task failed ! CoverEx:%d, vichn:%d The Chip is %x, it doesn't support Cascade. The ChipJ3: is %x, it doesn't support to disable vbi. The Chip is %x, it doesn't support to enable vbi. The Chip is %x, it doesn't support to get vbi attribute. The Chip is %x, it doesn't support to set vbi attribute. vi chn %d hasn't been configed before enable! vi chn %d enabled ok The Chip is %x, it doesn't support to set minor attribute. The Chip is %x, it doesn't support to bind chn. bPub invalid, bPub %d enUsrPicMode invalid, enUsrPicMode %d pool id invalid:%d u32Field invalid, only support TOP/BOTTOM/INTERLACED/FRAME. enPixelFormat invalid, only support sp420/sp422 the width and the height must be in [32, 4096) the userpic size(%d, %d) must be even value userpic invalid, poolid:%d, phyaddr[0]:%x set user pic ok, pool:%d,addr:%p NULL != pstViChnvi chn %d disable ok VI(%d,%d) enable NoIntDet, ViChn:(%d), interval:%d please set user pic first ERR IOCTL CMD 0x%x ViChn(%d) Ctx is NULL can't get ext vichn%d's context Ext-chn %d's destsize is (%d, %d), over the minification (%d) of ext-chn. chn%d get dsu out blk failed, width: %d, height: %d. Something wrong, release dsu scale output VB %d ViuProcDsuScale error vi chn %d lost frame for time sequencing err ViChn%d's DSU Task finish status is NOK !pstDsuTask->enFnshStat: 0x%x vichn %d has been disable Only sp420 can be supported when rotate is enable. NULL != pstViSendFrmInfovichn:%d get a VB for userpic failed vichn:%d ViuFillUserPic failed Only sp420 can be supported when LDC is enable. can't get ldc working attr, maybe LDC is not supported. DSU ViuCoverExTaskCallBack NULL point ViuCoverExTaskCallBack VIChnID(%d) is invalid VI(%d) cover proc failed, lost frame DSU ViOverlayCallBack NULL point DSU ViOverlayCallBack VIChnID(%d) is invalid VI(%d) Overlay proc failed, lost frame NULL != pstDsuTaskViChn%d's DSU Task finish status is NOK ! ViuDeInitChnCtx for ViChn:%d pstChnCtx:%x [Func]:%s [Line]:%d [Info]:NULL point vichn%d try to release a frame of inK&: valid addr(0x%x) or poolid(%d) vichn%d try to release a invalid frame, this frame may has been released ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/viu/viu_uflist.cHI_SUCCESS == s32RetNULL != pstNodevi release free node;0x%p! 0 == VI_UF_QueryBusyNum(pstBuff)vi alloc node failed! UserFrameDepth(%d) is invalid vi chn%d kmalloc node failed! Vichn(%d) user get frame time out, u32MilliSec=%d busy list empty <6>user copy stFrameInfo for ViuUserGetFrame failed! vichn%d's user buf depth is 0 or there is no frame in it and time out invalid vi chn %d! vi chn%d 's frame depth is 0! vi chn%d no space to receive this frm! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/viu/viu_drv.c(ViDev >= 0) && (ViDev < VIU_MAX_DEV_NUM)NULL != pstPhyChnHI_TRUE == pstPhyChn->bBind[Func]:%s [Line]:%d [Info]:VIU: g_u32DelayTime is %u us. VIU: g_u32DelayTime is %u au32CompMask[0] = 0x%x is illegal for videv %d enWorkMode = 0x%x is illegal for videv %d Invalid input clock edge %d of vi dev %d Invalid input combine mode %d of vi dev %d Invalid input component mode %d of vi dev %d Invalid input vi mode %d of dev %d Invalid input vi enVsync %d of dev %d Invalid input vi enVsyncNeg %d of dev %d Invalid input vi enHsync %d of dev %d Invalid input vi enHsyncNeg %d of dev %d Invalid input vi enVsyncValid %d of dev %d Invalid input vi enVsyncValidNeg %d of dev %d Invalid input vi enFixCode %d of dev %d Invalid input vi enFieldPolar %d of dev %d Invalid input vi scan mode %d of dev %d Invalid input Work mode %d of vi dev %d Invalid input vi AdChnId[%d] value(%d) of dev %d Invalid input vi AdChnId[%d] value(%d) of dev %d. when 1MUX was select,it must be -1 or 0. Invalid input vi AdChnId[%d] value(%d) of dev %d. when 2MUX was select,it must be less than 2. VideL<:v%d's AdChnId[%d] value(%d) is conflict with AdChnId[%d] value(%d) Invalid input yuv seq %d of vi dev %d Invalid input yuv seq %d of vi dev %d ViDev %d can't be set to "VI_INPUT_MODE_BT656 && VI_COMP_MODE_DOUBLE" ViDev %d: Input enInputMode %d and enWorkMode %d didn't match Invalid Intf Mode %d of vi dev %d ViDev %d: Input enIntfMode %d and enWorkMode %d didn't match ViDev %d can't be set to "VI_MODE_BT1120_STANDARD The max scale multiple should be 16. MainChn(%dx%d),SubChn(%dx%d) vi s32PhyChn(%d) is not support sub channel Ext VIChnID(%d) is invalid VIChnID(%d) is invalid ViPhyChn(%d) is invalid ViWayId(%d) is invalid ViPortId(%d) is invalid chn %d and Dev %d didn't match Unknow Int Field type %d stDestSize.u32Width(%d) of vi chn %d can't be larger than %d vi chn %d stDestSize.u32Height(%d) can't be larger than 8192, when BOTH field! vi chn %d stDestSize.u32Height(%d) can't be larger than 4096, when single field! vi chn %d stDestSize.u32Height(%d) can't be larger than 4096, in progressive scan mode! vi chn %d dest size(%d, %d) can't be smaller than 32x32 vi chn %d dest size(%d, %d) must be even value vi chn %d destsize (%d,%d) must smaller than capture rect( %d, %d)! can't change the width or height of stCapRect when chn %d is enable invalid Args stCapRect.s32X/Y(%d, %d) of vi chn %d vi chn %d capture rect(%d, %d) must be larger than 32x32 vi chn %d stCapRect.s32X/Y(%d, %d) item must be even value vi chn %d capture rect(%d, %d) must be even value vi chn %d destsize has some invalid value! invalid stDestSize.u32Width :%d of vi chn %d.it must be half of or same as stCapRect.u32Width:%d invalid enCapSel:%d of vi chn %d invalid stDestSize.u32Height(%d) of vi chn %d.it must be half of stCapRect.u32Height(%d) when enCapSel is VI_CAPSEL_TOP or VI_CAPSEL_BOTTOM vi chn %d stCapRect.s32Y(%d) must be align at 4 vi chn %d stCapRect.s32Y(%d) must be align at 4, when CapSel is both filed vi chn %d stCapRect.u32Height(%d) muM): st be align at 4, when CapSel is both filed vi chn %d stDestSize.u32Height(%d) item must be align at 4, when capsel is both invalid stDestSize.u32Height(%d) of vi chn %d.it must be same as stCapRect.u32Height(%d) when enCapSel is VI_CAPSEL_BOTH vi chn %d is progressive, the enCapSel(%d) should be VI_CAPSEL_BOTH invalid stDestSize.u32Height :%d of vi chn %d.it must be same as stCapRect.u32Height:%d when enCapSel:%d invalid mirror:%d of vi chn %d invalid bFlip:%d of vi chn %d invalid bChromaResample:%d of vi chn %d invalid pixformat:%d of vi chn %d vi chn %d , Srcfrmrate:%d or frmrate:%d value can't be less than -1 vi chn %d ,Src FrameRate(%d) and target FrameRate(%d) must be the default value(%d) at the same time vi chn %d , target frmrate:%d can't be larger than src frmrate:%d NULL != pstPhyChnCtxHI_TRUE == pstPhyChnCtx->bBindioremap_nocache failed ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/viu/viu_hal.c0topbotfrmintlOddFrtOddEndEvenFrtEvenEndbottombothsp420sp422NYBT656BT601DCBT1120SN/ABT1120IInterld1Mux2Mux4MuxUYVYVYUYYUYVYVYUUVUVVUVUByPassISPRawYUVRGBCOMPSEPARSINGDOUBUPDOWN10STDNSTD -----VI DEV ATTR--------------------------------------------------------------- %4s%8s%5s%9s%9s%6s%4s%4s%4s%4s%6s%8s%6s%5s DevIntfMWkMComMsk0ComMsk1ScanMAD0AD1AD2AD3SeqDPathDTypeDRevPI%4d%8s%5s%9x%9x%6s%4d%4d%4d%4d%6s%8s%6s%5s -----VI HIGH DEV ATTR--------------------------------------------------------------- %4s%8s%5s%9s%9s%6s%4s%4s%4s%4s%6s%6s%6s%5s%5s%5s%8s%6s%5s InputMCombMCompMClkMFixFldP%4d%8s%5s%9x%9x%6s%4d%4d%4d%4d%6s%6s%6s%5s%5s%5s%8s%6s%5s -----VI PHYCHN ATTR------------------------------------------------------------ %7s%5s%5s%6s%6s%6s%6s%7s%7s%5s%6s%7s%7s%7s PhyChnCapXCapYCapWCapHN*: DstWDstHCapSelMirrorFlipIntEnPixFomSrcRatDstRat%7d%5d%5d%6d%6d%6d%6d%7s%7s%5s%6s%7s%7d%7d -----VI PHYCHN MINOR ATTR------------------------------------------------------------ %7s%5s%5s%6s%6s%6s%6s%7s%7s%7s%7s%7s%7s MixCapDwScal%7d%5d%5d%6d%6d%6d%6d%7s%7s%7s%7s%7s%7s -----VI PHYCHN STATUS 1---------------------------------------------------------- %7s%5s%12s%8s%8s%8s%8s%7s%6s%7s%7s%8s IntCntVbFailLosIntTopLosBotLosBufCntIntTSendTFieldStride%7d%5d%12d%8d%8d%8d%8d%7d%6d%7d%7s%8d -----VI PHYCHN STATUS 2--------------------------------------------------------- %7s%8s%8s%8s%8s%8s%8s%8s%8s%8s%12s%10s MaxIntTIntGapTMaxGapTOverCntLIntCntThrCntAutoDisCasAutDTmgErrccErrNIntRat%7d%8d%8d%8d%8d%8d%8d%8d%8d%8d%12d%10d -----VI PHYCHN VBI ATTR--------------------------------------------------------- %7s%8s%8s%8s%8s%8s%8s VbiIdXLocalLenCasErrN%7d%8d%8d%8d%8s%8d%8d -----VI CASCADE CHN ATTR--------------------------------------------------------- %7s%7s%8s%8s%8s CasChn ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/common/viu/viu_drv_comm.c[Func]:%s [Line]:%d [Info]:can't get vichn%d's physical context mod region maybe has not been insmoded HI_FALSEHI_SUCCESS == s32RetVIU chn %d: After Adapt, X(%d)or W(%d) was not align at 2! VIU chn %d: After Adapt, Y(%d)or H(%d) was not align at 2! NULL point ViChn(%d): Disable cascade chn already! warning, vi phychn %d: too many interrupts have been detected, auto stop 10ms! vi phychn %d pstPhyChn is NULL! vi phychn %d is not enabled! ====chn %d attr============= CropW:%d CropH:%d DestW:%d DestH:%d chnCapSel:%d chnPixFrt:%d s32SrcFrameRat:%d s32FrameRate:%d NULL != pstViPhyChnNULL != pstSubPhyChnphyChn(%d) read unkown cascade img_id(%d) phyChn(%d) read cascade img_id(%d), but no match cascade chn was enabled VIUVIU failed request irq VIU_DRV_DeInitPhO?:yChnCtx for phyChn:%d pstPhyChnCtx:%x malloc vi Phychn ctx for Phychn%d err ViuInitPhyChnCtx for s32PhyChn:%d pstPhyChn:%p ViChn(%d): No Dev was enabled cascade mode ! s32PhyChn(%d) has not been enabled! ViChn is (%d), only chn 0/4/8/12 support the VBI. Attr of vi chn %d not configed vbi(%d) Attr of vi chn %d not configed Minor Attr of vi chn %d not configed vi chn %d is not main chn, please use main chn to get bind vi chn %d hasn't been binded ViDev(%d): only Dev0/2/4/6 support cascade ! ViDev(%d): Enable cascade already! not allowed to enable vi dev(%d) because it has not been configed ViDev(%d): cascade mode must be BT.1120 progressive! s32PhyChn %d hasn't been bind. if you want to enable cascade, you should keep the default bind attr! chn has't configed when enable %d ! vbi(%d) of vi chn %d has enable already vbi(%d) of vi chn %d has disable already ViDev(%d): Disable cascade already! ViDev(%d): cascade chn(%d) not disable! ! ViDev(%d): cascade phychn(%d) not disable! ! can't get phychn%d's context vi chn %d has't configed when enable! vi chn %d hasn't been bind! vi chn(%d):dev(%d) is not enabled vi chn %d have enable already vi chn(%d) main attr is not configed s32PhyChn %d is subChn, please use main chn to unbind Chn %d is unbinded Chn%d should be disabled first s32PhyChn %d is subChn, please use main chn to bind Chn%d should not be enabled ViDev %d has not been cfged phychn %d: bind attr is (dev %d, way %d), but it has been binded to (dev %d, way %d) phychn %d has binded success attr of vi dev %d not configed attrEx of vi dev %d not configed not allowed disable dev because dev(%d,%d) has unbinded chns not allowed enable dev because dev%d not configed can't set attr of vi dev(%d), because it has been enabled can't config attr of vi dev(%d) when enabled Flashed Frame vi phychn %d lost bottom field int! vi chn %d release this buf vi chn %d release next buf !! Disable ViChn:%d timeout P: 120ms!!! !s32Retvi chn %d don't capture the next frame because rate control s32PhyChn %d get vb fail,w:%d,h:%d ViPhyChn(%d) Ctx is NULL ViChn(%d) is not enable ViChn(%d) process when it has no hardware interrupt stop s32PhyChn %d in interrupt vichn(%d) CcInt Err! vichn(%d) CcInt Err is continuous, maybe The Timing is not match! vichn(%d) CcInt Err, maybe The Timing is not match! BT!!!!Warning!! chn %d Int(%s) was delayed. two int gap is %u. lastT=%llu, curT=%llu chn %d Int time is too long: %u s32PhyChn %d intstatus = 0x%x, IntRawStatus = 0x%x s32PhyChn %d VIU_DATATHROW_INT !!VIU_DATATHROW_INT! chn %d: two int gap is %lu, lasttime=%llu, curtime=%llu. s32PhyChn %d VIU_BUFOVF_INT s32PhyChn %d Other err 0x%x $$$$$$$ $0$<$H$X$h$d`m@'gOg HH ;U /b #q        y o d Y L @$33Q: hh \t Q G} <{ 2w (s n i c \ T LD:1''WyVoUfT]RSPKMBI 9E 1A  )< "6 1 * $    !  !    { t n g `R :YR L E ?9!3'-- {vqk#e(`-Z1U6P;K@EE%%!( , 0 3 7 ; ? C~G{JwNsRoVjZg_bbS: QQOSMU KW IY G[E]C_A~a!?|c#={e%;yg'9wi)7vk+5tm-3ro/1pp1&KfqfK&%JfqgL'#IeqhM("HeqhN)!FdqiO+ EcqjP,DcqjQ- CbqkR. BaqkS/ A`plT1 @`plU2 ?_pmV3>^pmW4<]pnX5;\onY7:\onZ89[oo[9+EW^WE+*DW^XE,)CV^XF,(CV^XG- 'BU^YH. &AU^YH/ %@U^YI0 %@T^ZJ1 $?T^ZJ2T: #>S]ZK3 "=S][L3!<R][L4 <R][M5;Q]\M6:P]\N79P]\O88O\\O8 -?KOK?- ->JOK?. ,>JOK@. +=JOK@/ +=IOL@0 *<IOLA0 *<IOLA1 );HOLB1 (;HNLB2 (:HNMC2 ':GNMC3 &9GNMC4 &9GNMD4!%8FNMD5!%7FNME5"$7FNME6##6ENNE6#!.9ACA9.! .9ACA:/! -9@CA:/"-8@CA:/"-8@CA:0#,8@CA;0#,7@CA;0#+7?CB;1$+7?CB;1$+6?CB<1% *6?CB<2% *6>CB<2& )5>CB<3& )5>CB=3& (5>CB=3' (4=CB=4' (4=BB=4( &.59;U: 95.& &.59;95/' &.49;95/' %.49;:5/' %-49;:5/' %-49;:5/( $-38;:60($-38;:60($,38;:60(#,38;:60)#,38;:60)",28::60)"+28::61)"+27::71*!+27::71* !+27::71* !*17::71*!BttB @ruD >quF<ovG:nwI9lxJ7kyL5izN3hzO1f{Q/e|R-c}T+b~U)`~W'_Y!&]Z"$\\$  "}&y)u-r1n5j9f=bA^EZIVMQQ89:;:y:q9i7b6Z3R0J-C* ;&4! ,%%uV: i]RF;0%|vnf)]5T?JJJJ$;X$-g% v%%%$#"!|qeY! K0>>BttB @ruD >quF<ovG:nwI9lxJ7kyL5izN3hzO1f{Q/e|R-c}T+b~U)`~W'_Y!&]Z"$\\$  "}&y)u-r1W:n5j9f=bA^EZIVMQQ89:;:y:q9i7b6Z3R0J-C* ;&4! ,%%ui]RF;0%|vnf)]5T?JJJJ$X:;X$-g% v%%%$#"!|qeY! K0>>hi3521_viuY: GNU'ASpRlZEFԸPA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4. `mx).H% p`8/ 4 8q(C0K(>T2@8Bgc `r8 sЃCo sX }$y s$|p/?ez 48 Z: H\p$* 4,CSH_ d i nDq }( , H \ n x n(  t   nn    n8 < < @ L |  nlp    nn n!\ n$0' -D 3 9 ?h E n\`n  K QX W ], c( i o u {4    h  n%%D n& &n&'n''p n((n)) n,(,n.. n(141n33 n444tnX5\5nD7H7 n99H n<<nX>d>n@@p n[:|AAn4B8BnBB  < P d t    ,   #$ )4 /< 5D ;L AT G\ Md S Y _ e k q w } ( P T @ X 4 H L < 0 x       , 8 D L      ' . 5 < CL JX Qd Xp _x f m t nQQ{ nVW n[[ n(^4^nl`x`nbbne e0 nTg`gd nii nLlXl nnnnq qn(s0s @ nuuX n$x0xnzzn}}n nnn   \:   \    nЋԋ@ n<HT nĐl nБԑ n# n04* n1E  L S Z aX nh nĥo  vT }p n\dnn    <  nXl x  nhpP    n8@ | nLPn| npnn   0"L 1X @d Op^m | (8HX!l0? N]l{ (<Pdt   />M\kz $ 0@Tdx ] : .=L[j,y< H`x    -  C _  w    0  <  H  X h( : L 1] B;u }  8  2 6 M k8 N j     %n  (  ,h   n n   6  J  ^ 0 p @ P ` p        n1 @ ,L `\ 8l 0x @ P h   @  h&3 C (_ *|d nX\ni }X n@DSD  0 nnX H x n n  n\n<  ( nt np^:t n b n  nn|o|~   0#@2T Adn n(P( ( npt_  dx *ti } n 4  nT np  n  '4 X    (  <   !p E X    ( 9 ? - 3 n  ] W\ Q nDH ni8! nX\nnuh! n c! nx|! no! nX\! n{! ntx " n`l" t" # # K4" t# # n`h($ ' % P% M,* & _: & $ G) )( / ) |% 5,) ;X) p$ $ #8( ( % A|) & h' ' n&&Sp* _* n* *n..n11n<4@4n,545n`5d5nt\tkz0Ddx.=L[(@ghvn n  n( 7n::_* n>>d* i+ *}\+ n??nhNlNnRRnRR nSSnXT\TnTTn,U nb:38> n:t> nn@DA> H> nptO> V> n`d]? nnd!h!dL? k? rD? nH$L$y? ? ? n`%d% @ 0A @@ X@ @ @ @ @ n++TA B A A A n.n   $ < %L 4\ Ct R a p    $ 8 H ` x    $ 3 B Q `( o@ ~T h         ( @ #T 2h A P _ n }   n`+ nnnDD#h|!n  ((!d\40 M70en94 eT &,Y4c: A0E(0 "H|0@lK\p^l4Đl8T4>+J<ETRo'0xDp8W$&8C<<Y\MV0?0 k(yC$ELK D2 OD\h*U1lXDR|(2H' F[tp|||dxxRB4,xDG3$ZI<s}H@4%<*lN0M `B )E<CRtgm4~,8,8| h(&=(I8@a- u80 P WP 8< D8 * p=K`D sHL x, <0  i* 8DA 8P d: \ s (  @ \T Bp ,  HE$!}`#!D 6! G! Z!r!d!`:P!! :@! ! !!|$ ""!"2"?"=HQ"b"<Pp","p "X"P>"`D" x" "pT" *#L$ #5#XlC#@xV#zi#}##4l#T### #\<#D  $"$H@<$lE<Q$\`e$ t$'$$64$$8B$@$|$%lQ'%p2%@I%Y% 0 n%TX%%h4L% %,% %ĥ% &xG"&8 :&(L&dk&}& & &+d&80 &,&p&`Y,'7't7'L'\Y'c'0 |'LW'P0''pM@'D0'(<(((W>(ԑO(Y(`g(@/0 (\ (HL(0(\(I@( ( )x<)l4)ZC)dY)74l)X8D)p20 ))H))<)e: (7L*&*?;*`W S*0s`*s* 0 **0x*,* q*S*K<*,+)#+>+x`HP+W+ d+p+w+( +X+d+T+,-++49,d5+,9,D M,0[_,d%(p,XI@, \<, 0 ,0,-,H\<,,l,X0 -)-7-K-dZ-Wn-H7h-l--PH<-- --,-8]<.!.7.M.xd.h@}..@....t.`.p.N/<$/P:/SQ/d/4x////t]Xt/\/[L/|p/XT0p0,-0CE0(MH]0k041|0V0I@08D`00 0bL0M181)1x* =1$0 U1Pk1P@|1, 1Q@1<1B1@XT11$11 2262K2^2l2\5z2TZL2( 2\2+2u`22(,2|34^D3"3`?3P3f: a3PJ<z38,3T3hd30 3J<3 @3`4 !4\<04K<H4\U4f440 4Q4t7,4\<4| 4C47,400 5 @50L&5h!85$*J5^5`o5J<55`gT555945@K<5\5d>d6D6tC06F6.a6+v6( 650 6\6Yl6n$66&6<X7E<*78:7L7h0 a7 o7[@77&,7|K<77777ԋ88H48450M8(g8~88-8\8D,4$a.LANCHOR0ViuOpenViuCloseVIU_Notify.LANCHOR1VIU_QueryStateVIU_GetVerMagicVIU_ModExit.LC0.LC1.LC2$dVIU_ModInit.LC3.LC4.LANCHOR2.LC5.LC6.LC9.LC8.LC7.LC12.LC14.LC13.LC11.LC15.LC10ViuIoctlViuDevIoctl.LC16ViuPoll.LC17.LC18.LC19.LC20.LC23.LC21.LC22.LC24.LC25.LC27.LC29.LC31.LC28.LC30.LC26.LC44.LC34.LC32.LC33.LC38.LC36.LC40.LC37.LC42.LC35.LC41.LC45.LC39.LC43.LC46.LC47.LC48.LC49.LC50ViuPutFrmVb.LC51.LC52.LC53.LC54.LC55.LC56.LC57.LC58.LC59.LC60.LC61.LC62.LC66.LC63.LC64.LC65.LC67.LC68.LC69.LC70.LC71.LC72.LC73.LC74.LC78.LC75.LC76.LC77.LC79.LC80.LC81.LC82.LC89.LC90.LC86.LC91.LC84.LC87.LC88.LC85.LC83.LC92.LC93.LC94.LC95.LC96.LC97.LC98.LC99.LC100.LC101.LC102.LC103.LC104.LC105.LC106.LC107.LC108.LC109.LC110.LC111.LC112.LC113.LC114.LC115.LC11g:6.LC117.LC118.LC119.LC120.LC121.LC122.LC123.LC124.LC125.LC126.LC127.LC128.LC129.LC130.LC138.LC139.LC132.LC137.LC136.LC135.LC131.LC134.LC133.LC140.LC141.LC142.LC143.LC144.LC145ViuExtChnReceivePic.LC147.LC150.LC146.LC149.LC148.LC151.LC152.LC153.LC154.LC156.LC157.LC158.LC159.LC155.LC162.LC160.LC161.LC165.LC164.LC163.LC167.LC166.LC168__func__.30428__func__.28450__func__.27546__func__.27333__func__.30268__func__.30313__func__.30072__func__.26886__func__.27951__func__.30044__func__.29974__func__.30009__func__.29691__func__.29960__func__.29942__func__.29924__func__.29906__func__.29888__func__.29862__func__.29832__func__.29805__func__.29760__func__.27412__func__.29230__func__.28100__func__.28068__func__.27742__func__.29156__func__.28569__func__.28741__func__.28425__func__.28398__func__.28371__func__.28343__func__.28313__func__.28283__func__.28251__func__.28218__func__.27885__func__.27846__func__.27811__func__.27773__func__.27708__func__.27671__func__.27637__func__.27602__func__.27177__func__.27136__func__.28018__func__.27061__func__.27093__func__.30195__func__.27020__func__.29655__func__.29298__func__.26932__func__.29520__func__.29437__func__.29396__func__.29243__func__.28829__func__.29578__func__.28672__func__.28503__func__.27493__func__.27271__func__.26911__func__.30361__param_str_raw_isp_bypass__param_str_g_bLowPower__param_str_csc_ct_mode__param_str_csc_tv_en__param_str_intdet_interval__param_str_discard_int__param_str_int_time__param_str_stop_int_level__param_str_max_cas_gap__param_str_min_cas_gap__param_str_int_gap_time__param_str_drop_err_frame__param_str_detect_err_frame__mod_version4952__mod_license4951__mod_author4950__mod_raw_isp_bypass126__mod_raw_isp_bypasstype125__mod_g_bLowPowertype121__mod_csc_ct_mode118__mod_csc_ct_modetype117__mod_csc_tv_en114__mod_csc_tv_entype113__mod_intdet_intervaltype110__mod_discard_inttype102__mod_int_timetype101__mod_stop_int_leveltyh:pe100__mod_max_cas_gaptype99__mod_min_cas_gaptype98__mod_int_gap_timetype97__mod_drop_err_frametype96__mod_detect_err_frametype95s_u32ViuStates_stModulestViFileOpintdet_interval__param_raw_isp_bypass__param_g_bLowPower__param_csc_ct_mode__param_csc_tv_en__param_intdet_interval__param_discard_int__param_int_time__param_stop_int_level__param_max_cas_gap__param_min_cas_gap__param_int_gap_time__param_drop_err_frame__param_detect_err_frames_stViuUserRefastViDevicestDsuTask.27545stDsuTask.27331stOpt.27332s_u32ChipVersions_stDsuInfo.29023s_stDsuInfo.28998s_stDsuInfo.28973stOpt.28568au32Framecount.26931u64Curpts.26929u64Prevpts.26930pstViChn.28827stViUserFrmInfo.28825s32Ret.28826stRgnInfo.28828stRgnInfo.27270ViuGetVbT.370ViuUfRlsBusy__func__.26603__func__.26568__func__.26540__func__.26852__func__.26654__func__.26505__func__.26615__func__.26522__func__.26462__func__.26637__func__.26769__func__.26715__func__.26669__func__.26697__func__.26879__key.26435__func__.27292__func__.28061__func__.28034__func__.27999__func__.27611__func__.27478__func__.27376__func__.27355__func__.27175__func__.27110__func__.26944__func__.26648__func__.26640__func__.26632__func__.26624__func__.26616__func__.27899C.377.27715__func__.27714__func__.27772__func__.27209__func__.26737__func__.26689__func__.14565__func__.14523__func__.15192__func__.15062__func__.15034__func__.15161__func__.14695__func__.14649__func__.14508__func__.14460__func__.14435s_au32CoefYHs_au32CoefCHViuDrvGetCasChnCtx.LC169.LC171.LC170.LC172.LC173.LC174.LC175.LC176.LC180.LC177.LC178.LC179.LC181.LC183.LC182.LC184.LC189.LC187.LC188.LC186.LC185.LC190.LC191.LC192.LC193.LC194.LC195.LC197.LC196.LC198.LC199.LC200.LC202.LC203.LC201.LC205.LC206.LC204.LC207.LC214.LC208.LC209.LC212.LC211.LC213.LC210.LC215.LC219.LC218.LC216.LC217__func__.26764__func__.28369__func__.29051__func__.28253__func__.28229__func__.28144__func__.28122__func__.27990__fi: unc__.28880__func__.28853__func__.28815__func__.28436__func__.28315__func__.28519__func__.28105__func__.28090__func__.28063__func__.27950__func__.27717__func__.27438__func__.27369__func__.27295__func__.27821__func__.27750__func__.27785__func__.27891__func__.27693__func__.27471__func__.27391__func__.27321__func__.27236__func__.27058__func__.26987__func__.27103__func__.27077__func__.27016__func__.26949__func__.26929__func__.28703__func__.27645__func__.27529__func__.26776__func__.28610__func__.29080__func__.28900__func__.26845__func__.28997s_stViIntCallBack__mod_srcversion23__module_depends__mod_vermagic5VIU_DRV_SetFlashConfigVIU_DRV_DisableChn_ByChipVIU_DRV_DisableChncoeff_lanc3_12tap_1dot4MViuDisableUserPicRegionfree_irqViuEnableUserPicRegionVIU_DRV_GetChnMinorAttr__udelayViuDisableVbiViuGetFlashConfigPRINT_PIXFORMATViuChnDsuInfoProcShow2VIU_HAL_GetIntMaskcoeff_lanc3_12tap_2MViuGetRotateViuDisableChnViuUserGetFrames_bDrvInitVIU_DRV_CheckDevIdVI_UF_PutBusyVIU_DRV_DisableCascadeChnVIU_DRV_LowPowerDisableDevClkVIU_DRV_Initparam_ops_uintViuDsuScaleTaskCallBackViuStartNoIntDetVIU_DRV_IsMainAndMinorAttrSameVIU_DRV_SetChnEnVIU_HAL_GetChnRegVIU_HAL_SetChnVsync_VbactViuPutRegionVIU_DRV_LowPowerEnableDevClkViuSetFlashConfigViuDrvFrmRateCtlCMPI_RegisterModVIU_DRV_LowPowerDisableChnClkViuCalcRegionAttachFieldVIU_DRV_IsSupportCSCViuDrvSetPowerDownCtrl__this_moduleVIU_DRV_SetDevClkVIU_HAL_SetDitherModePRINT_INPUTEMODEsnprintfcoeff_12Phase_RandomViuSetCSCAttrVI_UF_AllocNodeViuChnBindVIU_HAL_SetChnEnVIU_HAL_SetScaleCoefVIU_HAL_SetChnSyncVIU_HAL_SetChnTimingBlankViuDrvGetFrmVbBlkVIU_DRV_GetChnAttr__arm_ioremapVIU_DRV_SetChnMinorAttrVIU_DRV_LowPowerEnableChnClkVIU_HAL_GetOutPicMemInfoViuDrvUpdateMainChnAttrByChipVIU_HAL_SetDataOffsetViuSendPicVIU_DRV_SetDevAttrByChipPRINT_CAPSELVB_UserAddfinish_waitVIU_DRV_LowPowerInitVIU_HAL_SetScaleHAttrViuUserPicCreatScaleTask__iounmapcoeff_lanc3_6tap_2MVIU_DRV_IsSupportLDCVIU_DRV_Cj: heckWayAttrVIU_DRV_ProcShowByChipVIU_DRV_InitPhyChnCtxg_stViLockViuDrvChnAutoEnableInterruptVIU_DRV_IsSupportVbiVIU_DRV_RegistSendPicdetect_err_frameVIU_HAL_SetScaleStepVIU_HAL_SetDitherSizeVIU_DRV_DeInitPhyChnCtxupViuGetUserPicVbBlkVIU_HAL_SetChnVsync_VbbbViuUfPollcleanup_moduleVIU_DRV_SetRegNewerViuFlashTriggerVIU_DRV_SetScaleAttrprepare_to_waitmemcpyCMPI_UserCopyVIU_HAL_ResetScaleVIU_HAL_IsDevFieldInputcoeff_6Phase_RandomVIU_HAL_SetIntMaskVIU_HAL_GetStatusSizeVIU_DRV_CheckVbiAttrkfreeVIU_DRV_SetDevEnschedule_timeout_interruptibleVIU_HAL_SetPortWorkModeVIU_DRV_SetChnAttrVIU_DRV_GetFlashConfigVIU_DRV_CheckNotExtChnIdViuProcCoverViuDrvStartCapVIU_DRV_UnBindChnVIU_DRV_SetVbiLocationg_astUfInfoVIU_DRV_AdaptRegionRectcoeff_lanc3_6tap_6Mcoeff_lanc3_6tap_5M_EXTVIU_DRV_EnableDevdo_gettimeofdayViuProcCoverExVIU_DRV_SetVbiAttrByChipstop_int_levelVIU_DRV_EnableChnVIU_DRV_GetLDCStatusVIU_DRV_SetVbiAttr__wake_upVIU_DRV_CheckChnIdViuGetChnBindVIU_DRV_GET_MAIN_CHNVIU_DRV_InitWayCtxVIU_DRV_IsSupportMinorAttrVIU_HAL_SetChnCdsAttrint_timeg_stViTimerViuDrvUpdateSubChnAttrdrop_err_frameVIU_DRV_SetAdChnIdEnCMPI_RemoveProccoeff_lanc3_6tap_6M_EXTViuGetVbiAttrVIU_HAL_SetPortFixCodeViuFillUserPicinit_moduleVIU_DRV_IsHasDownScaleViuDrvProcCapFrmVB_UserSubVIU_DRV_CheckNotCasChnIdVIU_HAL_SetChnCombineModeVIU_HAL_SetDitherCoefVIU_DRV_IsMainChnCMPI_CreateProcVIU_HAL_ClrInterruptStatusViuSetChnAttrVIU_HAL_IsInCapTopViuSetMixCapStatVIU_DRV_GetDevAttrVIU_DRV_IsSupportMixCapVIU_DRV_InitDevCtxVIU_HAL_SetMasterProVIU_DRV_SetChnBindVIU_HAL_SetMasterOtdcsc_ct_modemax_cas_gapViu_DRV_GetChnIntCntVIU_DRV_EnableChnInterruptViuUfSetDepthscheduleschedule_timeoutg_astModulesVIU_HAL_BoardInitmsecs_to_jiffiesViuGetChnAttrVIU_DRV_GetIntStatusg_stViPhyChnSemVIU_DRV_GetLumaVIU_HAL_SetAdChnIdEnViuSetRotateVIU_DRV_CheckDevAttrViuCheckExtChnAttrViuFrmRateCtlVIU_DRV_ClearIntViu_DRV_ProcNoIntVIU_DRV_SetDevExAttrViuSetVbiAttrVIU_DRV_GetVbiAttrViuSetChnMinork:AttrVIU_DRV_SetVbiStartVIU_DRV_EnableCascadeChnViuProcNoIntDetVIU_HAL_SetAdChnIdkmem_cache_allocVIU_DRV_CheckDevExAttrg_stCDSAttr_TopPRINT_FIXCODEg_stViChnSemVIU_DRV_CheckBindAttrVIU_HAL_SetChnYUVInputSeqVIU_HAL_SetChnFlipEnViuDrvSetSubChnAttrg_u32DelayTimeViuGetCSCAttrVIU_DRV_SetBindChnClkVIU_DRV_Init_ByChipVIU_DRV_IsSupportLumaViuChnDsuInfoProcShows_pastViDrvPhyChnVI_UF_QueryFreeNumVIU_DRV_SetVbiSizeVIU_HAL_SetScaleOffsetViuGetLumaViuChnDsuInfoProcShow3VB_GetBlkBySizecoeff_lanc3_12tap_20ViuDrvUpdateChnAttrViuDrvReadVbiDataVIU_DRV_EnableChn_ByChipBlinear_Down2Viu_DRV_SetBlockFillVIU_DRV_SetWayAttrViuLDCTaskCallBackVIU_DRV_GetChnBindVIU_HAL_SetChnYCDestSizeVIU_HAL_GetIntIndicatorViuDrvGetChnFieldVIU_DRV_UpdateOtherAttrsByChipVIU_DRV_SetMasterVIU_UF_InitUfInfog_stCDSAttr_BottomViuDrvChnIntProcesscoeff_lanc3_8tap_13VIU_DRV_GetRawIntStatusViuOverlayTaskCallBackPRINT_BOOLEANRTL_Verify_RegWriteVIU_DRV_DisableChnInterruptrequest_threaded_irqViuChnUnBindadd_timercoeff_lanc3_12tap_1dot2MVIU_DRV_GetWayAttrViuUserPicScaleCallBackVIU_DRV_IsFrameFlashedVIU_HAL_SetChnCompModeViuDrvProcSendFrmViuCheckBindExtChnDisableViuUserPutFrameViuUserGetFrameTimeOutViuOverlayJobCallBackViuEnableUserPiccsc_tv_enVI_UF_GetBusycoeff_lanc3_6tap_2M_EXTVIU_DRV_DisableDevVIU_HAL_SetChnCropViuSetModifyFalseVIU_DRV_DisableCascadeVIU_HAL_SetChnFixcodes_astViDrvDevVIU_DRV_SetAntiFogAttrViuDrvIsOutPicFieldViuCoverExTaskCallBackPRINT_DATA_SEQVIU_DRV_IsSupportCasdVIU_HAL_CalcOffsetVIU_HAL_SetPortInputModecoeff_lanc3_6tap_3M_EXTVIU_DRV_SetCSCAttrViuDrvCheckChnScaleViuDrvChnAutoDisableInterruptVIU_DRV_IsSupportRelateChnVIU_HAL_SetPowerWorkModes_stUserPicCommViu_HAL_SetBlockFillVIU_DRV_UnRegistSendPicViuEnableChnCMPI_UnRegisterModcoeff_lanc3_12tap_1MpanicViuGetChnMinorAttrVIU_DRV_SetOutPicMemInfoViuEnableChnInterruptVIU_HAL_SetScaleAttrVIU_HAL_SetChnHsync_hfbVIU_DRV_GetIntIndicatorViuGetLDCAttrVIU_DRV_GET_MaxPhyChnOfDevViuCascadeDisablememcmpint_gap_timel: discard_intprintkg_astViDrvPhyChnCtxVIU_DRV_GetSrcPhyChnViuRotateTaskCallBackViuDrvUpdateMainChnAttrVIU_DRV_SetDataLayoutVIU_DRV_GET_MinPhyChnOfDevVIU_HAL_DisableDevAllVIU_DRV_DeInit_ByChipVB_IsBlkValidVIU_HAL_SetRegNewerPRINT_DATA_SEQ_EXViuDrvChnProcessVIU_HAL_SetChnFtcPolarPRINT_DATA_TYPEcoeff_lanc3_12tap_17ViuSetUserPicVIU_DRV_GetChnEnPRINT_COMBMODE__memzeroVIU_DRV_IsChnBindcoeff_lanc3_12tap_1dot6MVIU_DRV_IsCoverBeforeCrop__aeabi_uidivVIU_DRV_ReadVbiDataVI_DEBUG_PRINTViuDrvUpdateChnStatViuDeinitUsrPicInfoVIU_DRV_CheckChnDestSizeHI_LOGVIU_HAL_SetChnCdsEn__init_waitqueue_headraw_isp_bypassViuUfGetDepthVIU_DRV_CheckCasChnIdPRINT_FLDPOLARVIU_DRV_GetCSCAttrVIU_DRV_GetDefIntMaskVIU_DRV_EnableCascadeViuDrvProcPrepCdsParamViu_DRV_GetChnSrcFrmRateVIU_DRV_SetFlashEnViuFillUsrPicCallbackjiffiesViuGetExtChnAttrViuUfRlsBusyListVIU_DRV_EnableVbiByChipVIU_DRV_CheckWayIdVIU_HAL_DisableChnAllVIU_DRV_DisableVbiVIU_DRV_IsSupportBindVIU_HAL_SetChnScanModeVI_UF_QueryBusyNumVIU_ExtChn_ProcShowVIU_DRV_GetLDCAttrg_astViDrvDevCtxVIU_DRV_SetLDCAttrVIU_DRV_ProcShowVI_UF_GetFreePRINT_DATA_PATHVIU_DRV_CheckPhyChnIdPRINT_LOCALViuInitUsrPicInfoVIU_DRV_ClrInterruptStatusVIU_HAL_GetRawIntStatusVIU_HAL_SetChnInputModes_astViDrvWayViuSetExtChnAttrVIU_HAL_SetDataMaskVIU_HAL_SetChnCorrectEnVIU_HAL_SetOutPicMemInfoinit_timer_keyg_bLowPowerViuCascadeEnableVIU_HAL_SetScaleEnVIU_DRV_ClearChnMinorAttrVB_Handle2Kerncoeff_lanc3_6tap_4Mcoeff_lanc3_12tap_dot8MVIU_DRV_GetLumaByChips_astViDrvCasChncoeff_lanc3_6tap_5MViuProcViOverlayViuDrvGetAdNumViuProcShowPRINT_FIELDViuSetRegDelayTimeVI_UF_BUF_InitVIU_DRV_SetDevAttrVIU_DRV_GetDevByPhyChnseq_printfVIU_DRV_IsSupportFlashVIU_DRV_SetChnUnBinddown_interruptibleg_psViuAllRegViuGetUserPicPRINT_WORKMODEcoeff_lanc3_6tap_3MViuProcChnPicViuDrvInterruptRouteViuClearChnMinorAttrVB_Handle2PoolIdViuSetLDCAttrVIU_DRV_QueryViuCascadeEnableChnmin_cas_gapViuDrvUpdateSubChnAttrByChipVIU_DRV_PutVbBlkVIU_DRV_SetVbiEnVIUm:_HAL_SetChnVsync_VbfbVIU_HAL_SetPortClkModeVIU_DRV_CheckVbiIdVIU_DRV_CheckChnAttrcoeff_lanc3_8tap_12VIU_HAL_SetChnVsync_VbbVIU_DRV_GetDevExAttrVIU_DRV_CheckExtChnIdg_stCDSAttr_NORMPRINT_COMPMODEVIU_HAL_SetChnVsync_VfbViuGetRegionViuDisableExtChnautoremove_wake_functioncoeff_lanc3_12tap_3MViuCoverExJobCallBackVIU_HAL_SetPortCompModePRINT_CLKMODEVIU_InitVIU_HAL_GetChnEnVIU_HAL_SetPortEnViuCheckRotates_pastViChnVIU_DRV_DeInitViuDrvProcPrepFrmVIU_DRV_SetDitherVIU_DRV_SetDevExClkVI_UF_BUF_DeinitVIU_HAL_SetChnVsync_Vactdel_timerViuEnableVbi__copy_to_userparam_ops_intVIU_HAL_SetColorBarEnVIU_HAL_SetChnHsync_hbbViuDisableUserPicViuQueryVIU_HAL_GetIntStatusVIU_HAL_GetStatusSEAVCMPI_UnRegisterDeviceVIU_DRV_SetDevExAttrByChipViuDrvSetMainChnAttrg_stUFLockcoeff_lanc3_6tap_4M_EXTViuUfReceivePicPRINT_INTFMODEViuDisableChnInterruptVIU_DRV_IsSupportRotateVIU_DRV_IsDevFieldInputVIU_HAL_BoardDeInitVIU_HAL_SetChnMirrorEnViuDeInitChnCtxVIU_DRV_EnableVbicoeff_lanc3_10tap_15Blinear_Down4ViuCascadeDisableChnmsleepVIU_DRV_SetChnIntfCfgVIU_HAL_SetChnHsync_hactViuDrvIsAllChnDisabledVIU_ExitVIU_DRV_LowPowerExitkmalloc_cachesViuStopNoIntDetVB_Handle2PhysVIU_DRV_GetPhyChnByChnVIU_DRV_DisableDevByChipVIU_DRV_GetLDCWorkingAttrVIU_DRV_GetChnByDevWayCMPI_RegisterDeviceVIU_DRV_IsInCapTopVI_UF_PutFreeVIU_DRV_BindChn +,+ , +,+ , + ,,<+@,D`+d,pt+|,+,+,+, + , |+,D+L,X\+ h, p+,+!,!+, +"(,",@+D,P\+#d,#l+,+$,$+,+%,%  +$,D+ H, +h,h+,+n :,+!,!h +l ,x  +$ ,$  + ,  + ,  + , , +"4 ,"< P +T ,` l +#t ,#|    + , + , ++ ,+  + ,  +,$ ,,( 8 X t  + , +  ,  + ,|  Z + ,  +0 +1 ,0 ,1 +2 ,2  +0 +1 ,0 ,1 +3 ,3  +0 +1 ,0,1 +3,3+0 +1$,0(,14+38,3@D+0H+1L,0P,1\+3`,3hlC+,0+E4,EH6d+h,t+6,6&+E,E6+,(,+0,@+7D,7Hdt+x,+8,8+,+%,%+ ,0`+E,E6+, +6,6$LT+EX,El6+,+8,8+, L+P+ET,X,E 6(+,,8H+6L,6T`6+,+8,84+E8,EL6h+l,|+6,6+E,E6+, 8+<,H\+=`,=t+=,=6+, 0p+Et,E6+,+6,6$+E(,E<6P+T,`d+h,x+@|,@o: +,+8,8+, +%,%$(,D+H,{+,+C,C $+(,4<+DD,DL`+d,p|+E,E+,+F,F+,+G,G $+(,4D+HH,HP\x6+,$+(,4D+CH,CP\+E,E6+,+6,6(0+E4,EH6\+`,l|+H,H+,+,+@,@+, +8 ,8$H+L,Xh+Fl,Ft+,+G,G{$ +( ,4 < +DD ,DL ` +d ,p | +E ,E      + ,$!{!+!,!!+M!,M!!+!,!"+N",N "("+,",8"H"+OL",OP"p"+t",""+P",P""+",""+Q",Q"#+#,#$#+R(#,R0#T#+X#,d#x#+S|#,S##+#,##+T#,T#+#,# $+U$,U $<$+@$,L$X$+V\$,V`$|$+$,$$+W$,W$$+$,$$+X$,X$%+%,$%8%+Y<%,YD%`%+d%,p%t%+Z%,Z%%%%+%,%%+%,&+]&,] &&8&H&d&|&+&,&&+&,&+]&,]&&+&,&&+%&,%&&'('D'z\'+`',l'p<:p'+t','+]',]''+',''+%',%'''($(<(+@(,L(P(+T(,d(+dh(,dl((+(,((+%(,%(((())+ ),,)0)+4),D)+dH),dL)h)+l),x))+%),%)))))+),)*$*d*+Eh*,E|*6*+*,**+6*,6*** ++++E +,E4+6H++L+,X+\++`+,p++it+,i|+++++,+++8+,8++++,+,+%,,%,, ,$,@,P,d,+h,,t,,,,+E,,E-6-+ -,,-<-+6@-,6H-T-|----+E-,E-6-+-,--+-,-+i-,i..,.+0.,<.L.+8P.,8T.p.+t.,..+%.,%......+.,./$/H/+L/,X/h/+nl/,nt///+E/,E/6/+/,00+60,60(0P0X0+E\0,Ep0600+0,00+80,800+0,00+%0,%0(1,101L1d1x1+|1,1111*12+E 2,E426P2+T2,`2p2+6t2,6|2222+E2,E2622+2,33+83,8383+<3,H3T3+%X3,%\33333+4, 44+s4,s 4P4Kl4t44G4G444 5 $5+(5,45@5+%D5,%H5X5h5+l5,H67 D7T7+X7,7 77 q): 7+7,8(888h8+l8,x88+{8,{888+E8,E868+8,99+69,6$909X9`9+Ed9,Ex9699+9,99+89,899999:  :+$:,0:X:h::+:,::+~:,~:::+E:,E;6,;+0;,<;L;+6P;,6X;d;;;+E;,E;6;;+;,;;+8;,8;< <<,<D< \<h<+l<,x<<<<<=+E =,E =6<=+@=,L=\=+6`=,6h=t===+E=,E=6=+=,==+%=,%=> >+$>,0>@>+8D>,8H>X>\>`>>> >>+>,>>>?(?4?l?+Ep?,E?6?+?,??+6?,6??@@+@,$@0@+%4@,%8@H@+EL@,E`@6t@@+@,@@+8@,8@@@@@A(A+0A,pA|AAAA+A,(B4B`BxBB+B,BBC+C, C+CC,C+ C+ $C,(C, ,C4C+8C+~m$P%\.Иؘ+ #\(dpz*șԙ n(0H+L,l+t,+4,4-0`+d,p|+,e+,t$+ (, p+,ĝ+!Н,!+, +"$,"(@+D,P`+#d,#l+,+ , ̞ K4PG`Gx+,+,ĠȠ+!̠,!ܠ+, +$ ,$$@+D,P\+%`,%h+,+#,#̡+С,+%,%|+,+","<+@,LX+#`,#h+,+$,$̣+ԣ,<+@,+ , ,3L+P,\l+(p,(t+,+#,#إ+ܥ,,t+ , ,KGGԧ4+D,+,Ш+!,!+,$+$(,$,T+X,dx++|,+ĩ+ȩ,ԩ+,,,8+<,HP+ X, \p+t,+#,#+,̪Ԫ+-ܪ,-+, +%,,%8+,+","x&: īث+ܫ,+#,# +$,0@+$D,$H\`x+,Ȭ0+8,DX++\,+d+,+,,,ȭ+̭,ح+#,#+,dЮ+ ,,@++D,+Lp+t,+,,,įد+ܯ,+#,# ,+4,|+,Hh +0+1,0,1+3,3+ ,4\|+,+4,4Ȳ̲+ в, $@+D,Xt+x,+,ij+,+-$,-,@\+`,x+4,4+,+5ȴ,5дܴ+,(4+68,6@\l+ p, ̵8KH`GlG+,l+t,+!,!+,ȷط+$ܷ,$+ , PJx̸KܸGG(@t+S|,S+,$+!(,!,<+L,\+d,+ , Ⱥ+,+,,+%0,%<L+P,dt+#x,#+,̻+ܻ, +$,0@+$D,$H+,+","+,+7,7H+P,\l+$p,$t+,Ľ+"̽,"ؽ+0+1,0,1+8,8+0 +1,0,1 +$,,0+04+18,0<,1y3:H+L,TX\`dh+,,d|+,+,,,Ŀ+ , 0KGG8+H,+,+!,!+ ,(+$,,$0L+P,\l+;p,;t+,+-,-+,+#,# (+0,<D+ L, Pp+t,+%,%+ ,$+",,"4<+L,p+t,+$,$+,+<,<+0+1,0,1+,+,$4+=8,=<+@D+0H+1L,0P,1\,dhl+,8`+ d, K,G8GL`x+,0+8,HX+!\,!`|+,+$,$+,+@,@4+8,DP+,X,,\|+,+ , +,+#,#+, +-,- @+D,P`+%l,%x+,+"," +,@+D,P`+$d,$h+,+A,A++0+1,0,1,+,+B,B +0+1,0,1(+,,48<\+`,$<+@,L\+E`,Ed+,+,,,+,+#,#$+0(+1,,00,1<+F@,Fz0:HLd+h, +,$<+@,Tt+,+E,E+,+,,, 4+8,DP+#X,#\t|+,+,+K,K"+,,+0,<P+KT,K\d"l|+,+,+K,K"+,+,(+K,,K4<"DT+X,p+t,+K,K"+,+,+K,K ",+0,H+L,Xl+Kp,Kx"+,+,+K,K"+, +$,0D+KH,KPX"`p+t,+,+K,K"+,+,+K ,K(0"8H+L,d+h,t+K,K"+,+,+K,K" +$,<+@,L`+Kd,Klt"|+,+,+K,K"+,+,$8+K<,KDL"Tdptx|+ , +,0DXl  (t,~<DtH~PtT~`+ d, ltp~t:+0 +1$,0(,14+38,3@{%: D+0H+1L,0P,1\+3`,3hl+0p+1t,0x,1+3,3+0+1,0,1+3,3+,+,p+t+x,|,+,+,$+(,,<+L,X+,+,+, <T+X,d|+, +,+, +,(+,,4@h+,+,++,,+,+,,Xl+p,|+,+,,<+@,DLp+t+x,|,+,+,+,++,,+,+E,E,6@l+p,|+,+,+,+ ,8xNNNN0H+L,Xh+l,t|+, (4PXd$@HTpx08D`ht (+,+0,4,@+D,L\+`,lx+|,+,+,N 0+<,t"+,<\|+|?:,+,+,+, &(+,,8D+H,L\p+,@+L,l+,+,4+8,N+,+,(+,,<H+L,Pdp+,@NNNXNt+x+|,,+,+,+,N NlN++,,+,+,0+4,+, +  , $\+`,l|+,+,+,++,,+,t+$x,$8+$@,$+ , p+$,$+,+ , D+H,`+ d, +,+ , +$,$+'+( +)$,'(,(,,)4+*8,*@`+$d,$xB+ , +'+(,',(++,++$,$ + $, ,+?4,?\l+.p,.|+/,/+'+(,',(++,++'+(,',(+0,0+, + $, ,+?4,?hx+.|,.+3,3+ , +.,.+6,6l+.p,.|+7,7+.,. +:,:$@+.D,.Pp+;t,;+.,.  +< ,<8 +.< ,.H L +=\ ,=p +.t ,.  +> ,>  +. ,. }*: +? ,? +. ,.  +@ ,@, +.0 ,.< @ +AP ,Ad +.h ,.t  +B ,B  +. ,.  +C ,C +. ,.  +D ,D( +., ,.8 H +EP ,E` | +. ,.  +F ,F +. ,.  +G ,G +. ,.  +H ,H0 +.4 ,.@ D +IT ,Ih +.l ,.x | +J ,J +. ,.  +K ,K +. ,.  +L ,L +. ,., < +M@ ,MD ` +.d ,.p t +N ,N +. ,.  +O ,O |+.,.+;,;+.,.+: ,: H+.L,.X`+Rh,R|+.,.+B,B+.,.+A,A ,+.0,.<@+FT,Fl+.p,.|+E,E+.,.+S,S+.,.+N(,N+.,.+<,<+.,.+N,N+.,.+T,T8+.<,.HL+K\,Kp+.t,.+=,=+.,.+H,H+.,.+J,J+.,.(,+I<,IDl+.,.+W,W+. ,.,<+Z@,ZDX|+.,.+Z,Z+ , +.,.+6,6p+.t,.+7,7+.,.+a,a@+.D,.P`+dd,dhx+.,.+g,g +.$,.0@+jD,jHX+.,.+m,m8+.<,.H~): X+p\,pht+s,s,+.0,.<L+tP,tT`dhh+.l,.x+w,w+.,.+x,x+.,. +y(,yDX+.\,.hl+zp,z+.,.+{,{+.,.+|,|$+.(,.4D+}H,}T`d+$,$+.,.  + , l +.p ,.|  + ,  +. ,.  + , !+.!,.!$!+,!,4!H!+.L!,.X!`!+h!,!!+.!,.!!+!,!!+.",. ""+ ",,"D"+.H",.X"\"+`",""+.",.""+",""+.",.##+#,(#@#+.D#,.P#`#+d#,p##+.#,.##+#,##+.#,.##+#,$$+. $,.,$<$+@$,L$d$+.h$,.x$|$+$,$+.$,.$$+$,$+.$,.$$+%, %$%+.(%,.4%<%+D%,d%x%+.|%,.%%+%,%%+.%,.%%+%,&+.&,.&&+(&,<&+.@&,.L&`&+d&,p&&+.&,.&&+&,&&&&+$&,$('''x'''<'( (8(xH(X(h(<x(j((( (j )D)T)d)<x) )j)))+')+(),'),()+),))+')+(),'),()+),***4*|***<:* +\+ul+Ux+9+=+++$+,$P,+$T,,$,',,,,,,,V-$-`-l-|------.(.T.t...+?.,?..+..,...+3.,3../! /X/Rt/5//R/5/05080RT05d00R0001D1h111111 2582'h252'252'252'3,3l3333 4444<4L4`4|4444+$4,$4+?4,?444+.4,.4 5+35,35,505H5`5t5+ x5, 586+$6,$7 77!87+<7,7+7,7+7, 8+8,88+<8,h8+l8,8+8,8+8, 9+9,D9+H9,0:+4:,p:+t:,::::::::::::::::<+<,<$=(=+,=,H=X=h=x=========>>(>8>@>+D>,H>`>+d>,>>>>>+>+>+>,>,>,>+>,>4?+8?,X?+\?,x?+|?,?+?,?+?+?,?,?+?,???BBLCCCCCC D$DLDDE$E4`,><`H`+?P`,?T`+@X`,@\`,=``+Ah`,Ap`+Bx`,B`+C`,C`+D`,D`+E`,E`+F`,F`+G`+H`,G`,H`+I`,I`+J`,Ja+Ka,KaTa+Xa,`a+da+ha,pa,a+a,a+La,LbTb+Xb,`b+db+hb,pb,b+b,b+Lb,LcTc+Xc,`c+dc+hc,pc,c+c,c+Lc,LdTd+Xd,`d+dd+hd,pd,d+d,d+Ld,LeTe+Xe,`e+de+he,pe,e+e,e+Le,LfTf+Xf,`f+df+hf,pf,f+f,f+Lf,LgTg+Xg,`g+dg+hg,pg,g+g,g+Lg,LhTh+Xh,`h+dh+hh,ph,h+h,h+Lh,LiTi+Xi,`i+di+hi,*: pi,i+i,i+Li,LjTj+Xj,`j+dj+hj,pj,j+j,j+Lj,LkTk+Xk,`k+dk+hk,pk,k+k,k+Lk,LlTl+Xl,`l+dl+hl,pl,l+l,l+Ll,LmTm+Xm,`m+dm+hm,pm,m+m,m+Lm,LnTn+Xn,`n+dn+hn,pn,n+n,n+Ln,LoTo+Xo,`o+do+ho,po,o+o,o+Lo,Lp0p@p+MDp,MHpPp+NTp+>Xp,N\p,>`p+&dp,&hp+Olp,Otp+Pxp,Pp+Qp,Qp+Rp,Rp+Sp,Sp+Tp,Tp+Up,Up+Vp,Vp+Wp,Wp+Xp,Xp4q+8q,Dq+Hq,Tq+Xq,xq+Yq,Yqq+q,r+ r,r+r,H},[L},>?:P}+\T},\X}+]\},]d}+^h},^p}+_t},_|}+`},`}+a},a}+b},b}+c},c}+d},d}+e},e}+f},f}<~+gT~,g~~+g ,g@+g,gd+g|,g+g4,ghԁ+g,g +g,g؂D+g\,g+g,gH+ḡ,gl+g,g$+g<,gp܆+g,g(+g,gL+gd,g~Ȋ+gЊ,g+h,h +$,+i0+>4,i8,><+j@,jD,H+kP,kT+l\,l`+mh,mp+nt,n|$+(,4+8,D+H,p+x,+,+,++,,+,+ ,4+L<,Llp+o,o+p,p+>,>+@Ď,@̎+qԎ,q+r,r\+`,h+p,x+|,+,+,ď+̏,ԏ+s,s0+,+,+,̐+А,ܐ+,+,+s,sX+,+,ȑ+̑,+,+ ,+,0+s@,sԒ+ؒ,+,+,+ ,,+4,<+@,X+sh,s+,+,+,D+H,T+\,d+h,+s,sД$+(,0+8,@+D,l+p,|+,+,+s,sL+P,X+`,h+l,+,+,+,Ж+s,s t+x,+,+,+,̗+ԗ,ܗ+,+s,sH+,+%: ,+,+,+,+, +s0,spę+ș,Й+ؙ,+, +,+$,,+0,H+sX,s+,+,+ ,4+8,D+L,T+X,p+s,s+, +(,0+4,\+`,l+t,|+,+s,s<+@,H+P,X+\,+,+,+,+sН,sd+h,p+x,+,+,+Ğ,̞+О,+s,s8+,+,+,ԟ+؟,+,+,+s ,s`+,+,̠+Р,ܠ+,+,+,$+(,4+<,D+H,d+st,sȡ+̡,ء+ܡ,+ , + , +  , +t,t(+u,,u<+,+,+,Ģ+ Ȣ, ܢ+","+,+,+,$+(,@+vH,v+ģ,У+ԣ,+,+ , + ,  + , +  , (+ 0, 4+8,D+tL,tX+u\,ul+,+ , Ĥ+Ȥ,Ԥ+ؤ,+ , +,+,+ , + ,4+ 8, D+ L, P+!T,!h+"l,"x+ , +#,#+,+,+ , ĥ+ȥ,إ+ܥ,+ , +, +,+ ,0+v8,v+,Ц+ Ԧ, ܦ+t,t+u,uH+L,\+`,t+x,+ , +","+,̧+Ч,0:ܧ+,+,+v,vx+,+ , +t,tĨ+uȨ,uԨ}+ ,4+8,D+H,X+\,t+w|,w̩+,+ , +t,t+u,u(}p+t,+,+,+,Ȫ+wЪ,w 0+4,@+D,P+T,`+d,l+ t, x+ |, + , + , + , +,Ы+tԫ,t+u,u}+,L+P,\+ d, h+l,+,+ , +,+,Ĭ+Ȭ,ج+w,w8L+P,`+ d, p+tt,t+u,u}ܭ+,+,+,+,4+w<,w+,+,+ Ȯ, ̮+ Ю, + , +t,t+u,u\+`,p+t,+,+ , +","̯+Я,+,+,+,+v$,v+x,x+y,y+z+&,zİ,&а 0@P`pб+,+,+,(+,,@+D,P+T,h+l,x+|,+,+,̲+в,ܲ+,+,+,+ ,,+0,D+H,T+X,l+p,|+,+,+,+,̳+г,+,+, +,+ ,8L\+`,l+p,Ĵش(<P`+d,t+ x, + , 3:+,+,+,+ĵ,̵+ Ե, ص+ ܵ, +,+, +,+  , $+ (, 8+<,H+L,X+\,d+ l, p+ t, +,+,+ , + , +Ķ,Զ+ ض, + , +,+,(+,,8+<,H+L,l+{t,{+,+ķ,з+Է,+,+, +$,0+4,L+{T,{p+,+,+,+,+,+ ,+,4+{<,{X+,+,+,й+Թ,+,+,+,+{$,{@h+l,x+|,+,+,Ⱥ+̺,غ+ܺ,+,+{ ,{(P+T,`+d,p+t,+,+,+Ļ,л+Ի,+{,{8+<,H+L,X+\,+,+,+,+,Լ+{ܼ,{ +$,0+4,@+D,p+t,+,+,+,+{Ľ,{+ ,+,(+,,X+\,h+l,x+|,+,+{,{Ⱦ+,+,+,@+D,P+T,`+d,p+t,+{,{ؿ+ܿ,+,+,(+,,8+<,H+L,X+\,t+{|,{+,+,+,+, +$,0+4,@+D,\+{d,{+,+,+,+,+ ,&: +,(+,,D+{L,{h+,+,+,+,+,+,+,,+{4,{Px+|,+,+,+,+,+,+,+{,{8`+d,p+t,+,+ , +,+ , +,+,+ , +,+,+ , + ,4+ 8, D+ L, P+T,h+l,x+ , +,+ , + , +,+ , +#,#+ , +!,!+ , +,(+ 0, 4+8,H+ P, T+X,h+ p, t+x,+,+ , +,+ , +#,#+ , +!,!+ , +, + , +,,+ 4, 8+<,P+ T, \+ d, h+l,x+ , +,+ , +,+,+ , +,+ , + ,  +, + (, ,+0,@+D,L+ T, X+\,h+ p, t+#x,#+ , +!,!+ , +,+ , +,+ , +,+,+{ ,{<\+`,l+p,|+,+,+{,{+,+,+,+,+,+,+ ,(+,,4+8,@+D,L+P,X+\,d+h,p+t,|+,+,+,+,+,+,+,+,+,+,+&: ,+, +,+,$+(,0+4,@+D,P+T,d+h,t+x,+,+,+,+,+,+,+,+,+,(+,,<+@,L+P,`+d,p+t,+,+,+,+,+,+,+,+,+,$+(,8+<,H+L,X+\,l+{t,{+,+{,{+,+{,{+,,+{4,{PX+\,l+{t,{+,+{,{+,+{,{+,,+{4,{PX+\,t+{|,{+,+{,{+,+{,{+,,+{4,{PX+\,l+{t,{+,+{,{+,+{,{+,$+(,0+4,<+@,H+L,T+X,`+d,l+p,x+|,+,+,+,+,+,+,+}+~+,},~, +!,!(,@+ D, +}+~,},~+!,!H+,+ ,,<+@,DPd+ h, +}+~,},~+,+,+$,(0+}4+~8,}<,~H+L,TXl+ p, +}+~,},~+!,!+, +$,(4hHp+t,+,+,4+3:8,DL+T,lt+,+,+,+ ,x+|,+,+,+,+,$(+0,4+D,pex (8X+\,dp+x,|+,+,+,8X`p+t,4p+,LP+T,+}+~,},~+,x+,4X+}\+~`,}d,~p+t,|+,@+,+,+,+,+,XQ4@QLvp D+H,`~N+,+,$l+p,|+,M+,+$B,+4,<,Hcd+,+,+,+,  +$,,4@+D,\+`,l+,+,+,+,+ ,$+(,4H+L,T\l+p,+,+,+,+,+,$4+8,P+T,`t+x,+,+,+,+,+,(<+@,HP`+d,|+,0:+,+,+,+,(+,,D+H,Th+l,t|+,+,+,+, +,0+4,<DT+X,p+t,+,+,+,+, (,<+@,X\`l$+,+E,E(6D+H,Xh+l,t+E,E6+,+, $H,8+<,LtH|+,+,+ ,(+,,4T+,+,+}+~,} ,~,+!0,!8<xH+,+,+,4+8,DT+X,`|+,+,H+,H+ ,D+H,Td+h,lH+, +,,+0,4|H +,+, + ,$@+D,P`+d,hx H+,4+<,4+,+,+,+,+,,+0,<L+P,Xx+|,+,+,+,,H4@+D,+,+,+,+%: ,(+,,8H+L,Tl+p,|+,H+,\+`,lx+,+,+,+,d+,+,  +$,0@+D,Ll+p,|+,+,+,+,$+(,4@`|H+,+, + ,(@+D,P`+d,lxH+, (4@T +, H(4+<,\t +,O +$,0<+D,HX|+,+,+,+,+,$+(,4@\Hdt+,   >0+,+,+, + ,(4PHXt  >+,L7t0+,+,H + ,(+,+,+, +$,,D+H,Td+h,p|H+, ;Hx@+,+, A O4 @H +L ,X h +l ,t   + ,  + ,  + ,  + ,( @ +D ,P ` +?:d ,l x |   + ,  + ,  +$ ,, 8 +H ,` +d ,p | + ,    + ,  + ,( 8 +< ,D \ +` ,l | + ,  + ,  + ,    , X p  + ,  <+@,xI8H+, 0+4,@Ldt+x,+,+,$,H)X+\,xRKDR`KhKRK RT+X,dt+x,+,+, 7+ ,</`tRKR K(\KdRKR+, 0+ 4, <T+X,dp+t,| +,+,+}+~ ,}$,~0+4,<@T+X,~N+ , 0<ix+,+,t+x,+,+,+ ,P+T,`p+t,|+}+~,},~+,+}+~,},~+,+}+~,},~+,+ , +}$+~(,},,~8+<,DH+}L+~P,}T,~`+d,lpH+,?,D+H,Td+h,l*: t+,+,+}+~,},~(+,,48+}<+~@,}D,~P+T,\`xH+,"X+\,hx+|,,+,+, +,,+0,4<{dl+}p+~t,}x,~+,+}+~,},~+,+ , P Kh p  G G   Y !+!,$!0!+4!,8!H!+X!,d!|!+!,!!!+!,!!+", "$"p"M"X""+",""+","#@#M`#X###+}#+~$,}$,~$+$,$ $+}$$+~($,},$,~8$+<$,D$H$`$Hh$+l$,$+$,$$+!$,!$$+$,$%+"%," %%k%0%+4%,@%L%+#T%,#X%`%t%+x%,%+ %, %W& L&+P&,&&&+&,'<'+@',L'X'+&`',&d'''+','k(+ (,(,(+'0(,'8(T(+X(,(+(,(+(,)+),<)+@),L)X)+(`),(d)t)+x),)+),))+)),)))*+ *,* *+*$*,*,*++0*,+P*+,T*,,p**+*,**+-*,-**+*,++ +,+ ++((+,(4+d++l+,x++++++++,,+  ,, 8,T,$`,^l,+p,,,,+0,,0,,): ,+,,--+1$-,14-T-+X-,x-|-+2-,2--+-,--+3-,3--+-,,.<.+4D.,4l.|.\..+,$.(D,+0+4,8,<D++ ,$,(0<+@,DP+T,`+d+h,l,pL+,++,,+,++,,'  $',04'<q@DLPT\`dlpt|' C   ,H/L*X`?:hi3521_vfmw.ko9Y9Y9YJELF(4Q4( -L -L -L -L -L0 0 -L0! -L -L0S00 -L -LQ0 0 -L0! -L -L -L -L -L -L -L -L -LM00@0S K "  3/ K -L -L -L -L 0-LRP00 Q%0 0 M?@P  0 /O?OZ㲐㳀@ p᳐ pJz0Db 劏K< @2 `0r A H2 ` 42H0P @"` Rq |NJ@`Qs0qp``< pW `v002 080 ^^`XᲐX``H㲐H Q4 * <"R0 a04rSq|Nppp1WᾐDb00vJ⾀ <\ $1  `H" 0H"S w``pW `v 080 ^Dbvp!pW`ᾐ Rv0 ps0w0`pW! w @ -LPp0@(2#X4T(4,! hp&140厀00|3 (0q03$0`^ ,4S 000X, \ ^ 0R"4”\ 41R81@S 81S\ 81@S : 0Pf @(2SPӑP@`"2@`2("Q@b PX^$ R0Na0 P S  R0lP 0B dR` P PX@ d@dPdO 0@0Xt 4ē0\o ^mH lL  T" $0   r 3^[  W 0-LB@00@P F5!P0R0 -L@b0L0@Pp\b@ S U`RX` L T d@0 @\ E  @00@@d\0 @`00@`i \ 00@P @P`f\ 0 @0@ @d\0 @R00@P`f\ 00@, @Pe\ 0 @0@0@d\0 @400@Pe\ 00@8` @`i \ 0 @0@ @d\0 @$`00@`i \ 00@ P @P`f\ 0 @0@@d\0 @P00@P`f\ 00@㠐 @Pe\ 0 @0@@d\0 @ؐ00@Pe\ 00@` @`i \ 0 @0@@d\0 @`00@`i \ 00@P @P`f\ 0 @0@@d\RU@d@  d0 @\ l c00@\ 0d0@lL @H` ` ` @0: d08 4P @00@ @dXL TP @00@ @@d\ 0 @P0@PPe\0+  0 @0@@d\ 0 @0@T@d\0 @Q00@P@d\ 00@p @[!%ˠdP ́,UP@d@DP @10 0@HP\\ ^QPPNP@dD H00@0 @^QPN@dD0HP @`00@^ PNP@d\ 0 @0@`@d@PD J?%! 0 @0@lPe 0 @0@@d 0 @0@Pe 0 @0@@d$ 0 @0@Pe( 0 @0@@d, 0 @0@Pe4 0 @0@@d@  @00@Pe@`P> TL0d @?Y@8`V_V d @TL0@ d  @00@t6  @00@Pe @@dPP 0 @(K @@td  0 @0@ QVl `P@d0 @ P,`R@ U d @@x d 0 @0@ 0Sal `P@d0 @ P,`Q@U d @@?0<0L0 T0 X0 B꼒2d+ @b`B@R P@Add \*0 (@@} 0-L?P @QU 0S @00+@@0P2SHD SBT  -LP@pU` 00@0Sr 3/ %: P pU`Z PpU`J DP/P P PP  |`^  00  `Q, S` R  00 `S:,倀QN$ @B @ ; x-L00@`QU( Q "R@_P Px@x@x.0@0@x.@00@x x-L P@``PP `````x x-L@P@PaZPa0@P 0^ώ T 0@S !R T`1x0`1@x -L00@P 2S S S,̀.@00@ -L?P00@P Q 2SS&-@00@$-@00@%-@00@ -LM?P@PP@P ZpWr8 8 ``@00@l 1aQl 2 CRUS STP P~P*:v qP@\L H@@@ ܀@< #K 0ԃK< SR3 H @ Ѐ3;@!ހ P ZO 13+ /P P(Kl S P ZA G;(P Z#  "8 @`p0a\p<P '@bPZ  @(@R @ @"@00@"@00@"@00@"@00@ -L$Mpp@`N`@0 R  0 R  0 S@@H pP` !RP aV0P@SQ0 0@p-1S H.`V0\40SDKPa 80   1 R + A`P`V ꠮ (KDK, N1,`` 0-LM@@@P1S ,KP$PQK0P1 l2R x-LPP@`P BT T xP ,@xx,@00@x x-L@@@`P RU 1HTxUx "xy,@00@x x-L?P@`P00@1S Q ,@00@xPx x,@00@x,@00@x -L @N\ @P`p  x-L?P@`SPP@P` 0SBQR  0):@@P+@+ Q$.P PU@@@x00@1 @ aPL (U  σ@+@@+@00@@+@00@@+0@0@@+@00@@ -L@` @?T[PP@P_ 0S@@PK+@D Q=.p PWp @00@1@ aP'fW LT0.|p$ 0D+@00@p@Q+@pA+@00@pB+@00@p4 x-L?PP@@@1S  R  ``1`x#-@00@x(@00@x(@00@x -L M?PPI@@@1SV `V82SG  ` 1 pW  K(K `  @  p W \  p0S00p W(@00@(@00@(@00@(@00@S0P> Q 2U >P PS .0 .0 0-L@@@p>S0P. R 2U P PQ΄0΄0 x-L@@@Pp>S x``@@HR^P.-F  @@PPp΄x>x -LX -LMP`v8 ?V  @(Kpp@1S  R P \ 2S P @P !R 8` 00@0@ 8K4 P PP@(0S5 3/e .P` f,0S 3/PpP@Up li΄f`,0S"@["@,xpX -L  ?0@`@@ p@n>P^S ^@>S S@@΄됎@~>S S -L00@0S 3/@PP @ @  -L@P` PP" TppdWVP 2U P TpdpWP @ P`Pp `P UeX.` 2V P UeX @` P@T d@  @ @ -LMM0Q K"P@U Ps P P T$L\`K  0@Pr PO 4 PF  P :P PP SoK 0 @0@@B @P @T\  0SxPP@0@Q !R 0@S@> S 2T Ζ@ @\@NpNxw -LMr3 Y@0 P0S8 SQPU%: \, ^$0S 0 D K0Pn R? R RCX^  \X㘀 T< 娀 嘀X{ 0 @\  DZ  D< Zᔀ 1  LP P0S HQ   @ SQ  `0 ` 0 `0 `@P0PX P@Ud pp@X(@̀ 0 ` G I=0@0@;  @@!@ ̐!ؒ1 G>*1!00 0R! pp@p//Oppp@堀0笀吐唀؀ܠ̀@ Đl Ȑ!@@@@夐Ԑ!0xP1PP/ (1D(K R @80K@ Pt840  8P400P 堀 9@80K< PPPk8KP 8K) P 0 40S 8P@P@80KD P 8P40 P 840唠 0 0XZ㐠 < @D H夀 LP0堀 T \ 4 <P1ʠQ< @PU9ʜ R D \ʐ 0  `0V!  0 嬀 0崀 0 0p0`0 p ` PQPUk@P]pp p p PR&@PO!P@T^唐 Q\A琀! @P*8`K< @0ppPP8KP8P@00D P 4 PP8K8Z40  00: @ @ PP8Kp 吀 `8p4` p ` 00 @ 0᐀ P堀p P 圀 0 p 5@`K!PK T␐ 0⠠hKT 倀KtK\ X 0ȀAPQS &@P@PW&@P꬐YD 0&@P@P@PA&@PzQL 0SA o.@Pm&@PfM&@P_k.@PX  D Pv&@9f&@P2  P    &@ ^ Q '@P  ,x -LM P@PfKP`K`\pK  d0 0@  dP  !@0 T    ,   8K  D K⸠ 0 PGU!  R ^* \' 8D0R"@0tK\ 倐KPcX T0 P HP L 0 0 (K @@ 0@8D @ @ -L H* -LPQ0R N\>PNoA` n@~ p@ L D0 4p H L 8 <  -LPN,0SNϠ  -LPN̠ 0S0N?  3: -LPN̠ 0S01a! -LPN̠ 0S1a -LPN<\( 0L0R$ 0\N/Q QP 0N/\NP R 0P P 0N/\ R -LPN<\ Q0L @  N?T  Q  '>N Q  '>   -LPN< -Lp3pS ``@VP. >@P -LQ( 0A R@:0ST R101S R@11 R110S0S -L?Q?P00@1S V/1 H -L?Q?P00@1S V/1 ` -L?Q?P00@1S V/1! -L?Q?P00@1S V/1! -L?Q?P00@1S V/1! -L?P 00@QU  @`0 @ @p@0 @ @ 0 @ @0 @ @0 @ @0 @ @$0 @ @(0 @ @,0 @ @00 @ @40 @ @80 @ @t 0 @ @x&0 @ @|0 @ @ 0@ @@  L T0@?W@pVoT@L T0@L T0@?Wtf@0S@,pڗT.@@V@@@PA  0@ V/V'00PP0PQ X (0S @ @V`00 `0`0` $@00@$@00@$@00@L x-L?Q?P@`xPP@1Sx V/!TPx x 0-LM00@!RN t@T)V,0D0Q5 0T, \ \Q, 0, T,\\! , 0R \ 0, TKP K0KP!P P   0 TK0QT@@@ -L?P>00@!RB t@T3 )V,0D0Q& 0T, \ !0: \Q 0, T,\\ , 0R \ 0, TPQT!@00@!@00@ 0-L?P 00@AT PP0Z @00@0[ @00@0 0-L?P00@AT PU004 @00@03 @00@0 -L?Pp`&Q- @@@1S 0SPP @ P0@0@ @00@P 0@0@P -L@ -LM?P`PP@1S! @ Q0 L@^0TpW @V?@T LV/QTpWVϠH0 RH@q Vqbpqq tP.V<@ R^ pW,0Q RQ p,0W, Q^w ,p^0\o p,0WVT qWo V/˅T!01Q[m A00 R 0Q4 !\ \ 0Q8 0 P 0QPV/ T,8 1110P1V?T,P(\ Q L0 S  Q0 Q V T.@bώ ,, P!Q x6^a,\ `& aRpq@T𯝸 Q aX@>Rp@T @T aY A`@TaPYA`>\ pp @TTX -L@1 -L00@P -L0 0@ -L00@ ! -L@1 -L @2P -L@2 -LP 2P -LP 2 Rʜ"r3 -L -L -L -L -L@Q PxP@ -L00@@0S 3/@A @@A x-L@P@@` @0S 3/P `V @0`S 3/P x@ 0S 3/xV$@x 0-LMPK@00@80S 3/@@ #K0 @ p-L M PK`@00@40S 3/@ @cKp @ 0-LMPK@00@!Q@@2CT@003K0 -L00\ -L$M Pp@@ @@@@Ə`!Re0#H0 H0P#Q\ @`!RO0#H0 H0P# QH0 PH0 /H0 D H0Q Q Ó8K4 8 0 1/PFz0P" 3P #a8Ö0%):@lP(@Z83@(KH0 PH0| σH0 D H0Q  Ó8K4 8 0 1/P D` @0``@prP 00@<0S  3/P @`@ d0 rp c a@`V<@ P #a8Ö0@lP(@83#@'#@T -LM@@@,P@#@p bp@8 RD4@40000 Ö#,3X# Xw X  @(K,Q 3,`dSd00 c Ú a,^   @ p s  @PR #p4 c3V_ p$X3N  0@`pp@$#(Æ$3S (^ 4QP  MBdQd@0  C0A,Ö r\@p,Æ` `@Pz 0 @ Cd^dࠣ 0Al “ ^ʜbv3p 2 \X$38 @`Hb\ 8  0 ӀP QP#YX `BV<=`` -Rd0S<!`p 0YX1 ,&:8! 7, 08 KЫ BR 0WV YX 8Q WVhD@ 0`8\P~ 0 ׀ 08 S(`p -LR1Π0 S@@2l l0UOS@0c0 -L00@\  0  0R8(!=Q -L00@!R ! -L00@Q0  0R8(!= -L00@ATШ0 8 Q(Q  B>0R BQQ2p!`"„2`p` Ш -LQ00 -LQ00 -LQ00 -LQ NU/0@?0T S !?0 R \@ -L@@ S?@ N R U0 (! 1H!111 11 0-L@@@PP0010 0-L@@@PP 0  0R8(!=0 P0 -L0 R  R RQ Q KpRQR /RP   R00P 0-L P@0R @0P0S 88 :P0 8 -L M@QP 0S j(  q P*pW3 W (K 8 `∀ (00S ( (@ !1!D0pC pW< W@0 PW@00 00<  `00 L p-3: 8D0bb 0  8( 1D0P@  `(0B008P`(0 0 p}p  p(R000l@` @Y -LPQ@ 0S `V J\ p`8( `Z`8P@z0(    Rp!: ``4Pp V* -L$M`Q@P  pр  0LK p0pD @ < 80K4p K8 pP, w00`( (KV8pPL`V @`0 S*8` RL ^3 D 8l8P00d< h c`0 `  lD0 `l `8ʄ8``( t p ppD08 -LP P P -L M@Q (K0SQ S S`p HRqaP0?PS:P ?PR5 1S+ 倠 ZPU0E?0QZ0?  UR0@ 0S S S P  @Hn`PP괥 -L MPQ@P K0S( S S`RqU0 RP .P0 @ H1?00n`괥 -LP@NqnH1S/@Πd000p```pR`U H.0: 00!81!!! !!(1败 -LDMP@@ UX < 1 `@`@ Up0?pS X?p\ ! R@넠?p\X dR`0Sd@0S X <(Kd\؀X KЁ @K܃K܄K 0QP 0QP hY lX0q03PZ`01d\2 1\(1$p' ^\l ȂX,X0 !(Rpp@ pp@0S 4 KP 4 K@3K3/P! R 0S , K@bP 3/P Xz 0S 4 KKKKᴗ@徒K3/,U4>|  $ R【@ 00? Q @0S @, K@@b3/P'@Jo@@@ P0cpQ3B:0S p6`0d$`0dh0 lpt [@@ ap0P`U@@1,' Q 0 2 0 (@괥 -L0 0@ (0 S00 \  0@R (0S0 \  -L?P 00@1S 48 /"+0ˠ,;b\ -LP90 S2 0 Q -LPQ0)  \ 00 -L4Mp3Ϝ (KRS p P `PBV`@Bp0p ЀЀ@I@WPeQ0p`C<  @0 P $00S$K XP! ZQX@' (;`i/%:pa 2p!P SR Q!P >@įp*+);`b ㆠa 2X0 剡Ё0 PYXKЀK @' k&ipLp L` @ q`ЁPpYXK LQ r܃K`Ё@0 0< P0 < @0@` ɠ \ @p@l`@P`e`ЀKY -LP0  0b0S -LP9  0l0S;0 -LP0  0l0S;0 -LPQR000 -LPQ00R  @@00  Q 000L0 aCQ00LaQ -L0P$ 00 -LP:  0l0S<0 -LP,0(00 -L00@<P0"R  <"<" -L00@< -L00@<"R <" -L0 0@!R Q@2S 002S -L0?P0@ 1%S"   4  0 bD \ˌ < `L H  bl \̌0 -L A 0R0@1S -L0SQ -LP0S R \ -LM@P`p K`$0K`$ @ QP K` -L -L` -L -L@PP @ @H` A@L   @T @X0  @\ @`  @d @h0  @U0: H^P PppW|BW1@Gi`P`P @ @ @ @ @ @"@VX&  @ @` @ @ @ @ @P@V @ @P @` @` @ @"@ @ @ @ @ @ @"@P@V -L$MpDK p@0PA`PPPPPDP T_  @0  @ @g 0  @ @fF0  @ @4`0  @ @0  @ @0  @ @ 0  @ @x0 0  @ @| 0  @ @ 0  @ @ 0 @ @ 0  @ @0 0  @ @ 0  @ @ 0  @ @ 0 @ @40  @ @<0  @ @80  @ @@0  @ @ 0  @ @00  @ @ 0  @ @0  @ @0 @ @ 0  @ @00  @ @ 0  @ @0  @ @0 @ @  @ @,2  @ @02 8p @ @00 0 @ @< @8p\A p8 @PW{G U4 5BaU4 0S+ @8 p W ?1:{GA!c\% ^ P 8 @5?pW{GBc U @\ @(K @ @ -L@PP @ @0`A@4  @8 @< @@0 @U0t0 0ppW{BW؃b8@` PG @P @ @ @VU  @ @` @ @ @V @ @ P @` @` @ @ @ @ @V -L@@ @ @ @ @ @ @ -L@p@ @ @X 0@H 0@ 0@@X @` PZ  0@`0 @0 @@XP@ 0@ 0@ 0@ p@` 0 @ 0@ 0@`@@XP -L00@P 0/@ <"2$@@ <" -L MPP@(K,A=?ORq * R ?n R Z 0S. @ʠ Z p@ @!Rڈ`@ `VQP @㊡ 0@*0S $ 0b T !2:@A\ \0/+ˠ;0bS! :   0! -L MPQP@(Kpp@0 (P00 T 0@Xu  (0S0 T Q  Z+0jSc: !E`"0` 1@D`U0 ` 1*;0P "@1 "@14 1 4*@! b 1  / "14 4  U 1* c 1ɠ 0 P P U[E Pw 0@m 0-L0?P0@ A0T0xP Q000 p-L$MPpP3@_   ` P $P   \JQKp$0K K,K4KP 90$ S  0Q -L MAA ApA`APA@ AA@ 0 @ @ @ @ @ @ @00@ (K 0-L@@ALPPADA  P5A 0TA0 p-L M@02S Kp a P`@@T`d \@APT`d \PU @A 0 @ 0-L0 0@PAT0U0  00 S 0`00P0 0-L@A A AAA A,(PPA0  A3: 0 -LA -LA 0-L@PP 0S 3/P00 @0 -L0 0@PATP 0`8`Z fZ p@J0  80p00 Zˠ,k*Y  @pꆂ`0 @80p0(k@ㆂ 80`0 0;Z#k8  ZJ x-L0 0@P`AT P 0Sx3/PD x @x -L0?P0@ AT   -L@P 0ʠ 0   x-L0 0@ATx04  PQx RH0`40 @v\R\+ R)8aQ& /@Q"` N R Q | 0BPS\ S @@8x@x p-L MPQ@PKp`r`3 S`3V0 $0 $0  @@0@ -LP -LMP @`0 `@40 pWl 0 R` 00`A@ pp` p000PFX  @p `1p  0 000\- P@ P10 000p1`8  @ 0810 00 0 10 R```04 (K0 ̃80(̠(8Q(04`  p4::0 0 冁` 0pQ61$ P  0(  PP  Q 1 ` \ ` 0 ^  4V`& @0@FVp@W  0@@Vp` 1@@ @1Wh -LB@@@PD& Ap`DP  W @App@AD”PAP@@ -L @ @’ R (0S Q \ 002S R@ -L`@ 0@@1SP !pW pH"@UHR bQ  @HRPP x-L@ @@`QUP HPx 0-LM@KP P00@1S  R PK0 x-L@P00`Q0S x PP@AT  0R @PS Q \0 00 0 C    0  0c * 0cSڤ <?0@0 @H L"P;C  S0 -L M 0@?P@Q$KU pD`KpW 00@"R40 pGQ0BW0002S 02S -L MPQ@ : 0S !QQ 0/+;0bS!(K(`㎁,Pp5 : @001@@ @c BO/@ ! -LMPQ@pp`B P` 0/+; 0bS`4 a膡8 (0 $0`4 ,0` `4p0  1q 8p  0/+0;;0b00  0 0 0   (K -LM0@SP(K\PK A@ < \P L R YPpH∐ Y0p  X ` p `4p 8` AX 0 8p\P `4L0 a0Pp p`0 U\ A?U#0  R, pj D K00KPP000 S<0 PA00堏S 0C 00  L ⌀ K `K⬐Ⱀ ` ` pP @ 圀 Sl00`  p W@4X0lL00lSڴX \ @< K Pn@K|0 P pP @< T!@@P0< @`p @|0L  1\WV860S | R@P 0PKPp܆K@ p@ @|0@X L\P  0@KPl b< K0h0 | p |0S{ڈY L H P U  B E^<  ` `@VP@`0< @p @|0PU SPڰPL0 n P| K밀@ ܆Kpp |0@p0X 4p\ K Pg@ e| 0p 0 p@ |@`PP A AĀ @ς00C00 S0P !  0 p @|0@`6: P+A P. g Q  PS |P QAPPQQS`  |P  aS0C\@@P p@` -LM0 0@PAT(KQ 04 0 R( ⃒H`` 040 0 08` C40V=Xp   Q Qp4 @8` Q4  V`FQW  40 8 8 4 02``A`a @"08 @08 -L0 0@`QpQ@U 0CSPS S S S S S S$QP IH@xT  @ R 00@W @@ 0-LPQ0@@0 P ! +"+ aU0  0 -LPQ0@@) R   -L4MLK`RP  PL { I0Pu p@ DL0 Hpd W@L@ H \ 0  @PDp   ' X`  @ D0cTpZ Q RX  @ L`D` 00C 1P pP D R PJ0Z ST(K T 0cSL`@ L!PP` D H`a P0@@ -LMPp`@ 0PPK -LTM0`@P`(KyHpW x44 0 7:0  @ZB D<0YJ @Z`YL B 0Q B@` Z`4K0 K04 OA0@ 00 40 ` 00\ڀ Xp  pU 4t p 甠 !d X tphp ` P L 80 l T H & U@  0@0  @0lK0 DP PP pW(m= 4Rpp(W  R( R: -L pW mLpP@P`P@m-$ 0PapS> pW(m= $Rpp9: (W  R( R: -L 0S -L 0S}  pWm\@G@ ` Z  aV @WP𭝘X4 ` X  aVaV& @PW𭝘 `! aVaV @P ` Z  aVaV @PW ` XXXaV`VmM$@S!1!1h\\!Rl!1!p! pWmL`G` PU 0S@(V PU 0@S :0@ PU 0@S *` PUlQUpXxZ 0@ PUlQUpXxZt 0@S:蘡Z{ZxaV`V @PWzaV`aV`VZmM$@S 1! 1!1h\\!Rl!1!p!aVMaV`VGaV aV aV`V꘡ZZaVG`VCꘁXXaV:`V6lQUZpXWxZTm=$ !t !l 瘁 !ā pQ !Q 1QlQUIpXFxaVCaVaV`V 0-LlAPpQPA1Q!A!10 -L1AQ!1 S @ |hA! Ql\S 1S q318 \ 0!p401\ -L @^ @0H  RPL.  RLP^  | t^  p. 8` 4 T < D 0PQ] -*H A ` 後haL `d : : .laHpp|qPQ ph q l 0aȁq1QAa圁qQA QHn A`L h <^ 0`PUJ PP8p. W```WV ЅYXS !*Hn A`L h <^ 0`PU, PP8pW` ``WV ЅYX% !R4 %45`.  H80.S000H8.\000ee! p-L60S &0S00 PU0 Sm  E@, \p\l\x\  UTO S @ aV  ATATAT  U7p  aVv  \\\ p @TpATlATxATZ S@( PpPlPxPI  US @ aV!  ATATAT S@   aV  PPPaVaVaVaV @TpATlATxAT}ZpaVaVepaVeaVb p-L60S &0S00 PU0 Sm  E@, \p\l\t\  UTO S~ @ aV  ATATAT  U7p  aVv  \\\ p @TpATlATtATR S@+ PpPlPtPA  US @ aVaV3  AT;:ATAT S@   aVaV  PPP @TpATlATtATZpaVaV aVaVaVfaVcep -L@P`p0X!0pG00 SX!a0P @T0 0 X\ P ^* 0 XP @T@T 0 R P^ !0 X@T X\ -L@P`p0X!0pG00 SX!a0P @T00 X\ P ^*0 XP @T @T 0 R P ^ !0 X @T X \ -L$MP p0R00  P 60L) #< , (08 @  0S  <`@0K+Su @ 0 @0S(K 0 @@^1S S 1 @1!S SS!`UJ<0 S800aS1 `FJ<0S80n `80 `S`c0`8`P``P60 L) ,< 0#  Ȑ08 {S<@`J<^80` }8 `8`0< 8`< `Q`a^08 ` 0-LM@0S h R6 Q l#\6  K0oV,6S\<: 0Ù pPx @V\0S˄0 P -L0Sp3 -L0SP -L 0R -L 0R -L 0R -L 0R38 -L 0R -L 0R -L 0R -L 0R -LMR@1@# @RPP@` PP80 P`0 Z # 34 4X0#03s S6 0pPPq0upX)*U zpX :pPYpX*   6/P 80-!4Q 00 Ppp Q  @PZ*W 0;PZ :P pPZ* e6/P 80e/!(Ke6/P  6/P  6/P e6/P e6/P  6/P `0 X#3Z0#034  S6 00 pPP q wpZ)*U  rpZ :p P VpZ*0 e6/P 80e/!4\ 0PppQ08PX*W =PX :Pp PX*  6/P 80͎  6/P e6/P  6/P e6/P e6/P  6/P -L>`VPMV`. @=: 𨝘m `FTP baR0FSQ b 00cS0cS+0SU 0m\TP l\l\ SPm< pm|TP 00cS0cS TP 00cS0cS 0S 0S -L M0SQ D POol0 ,`⬀00 0Q;  p 0G @ R  W0,\  @\  0W 0 @0S  0WP@ P@PU0Q! @0S Q !W0Q`P(Ko ,⬠0 0QG 0&p ` G @00R0S@  W03Q  @@TQ4  0W #0 @00Q0S  0W@ P@PPQQV`!` V `!W`0V P``V`!`^Q!d 0-L3 PU :E@ RP  RM Q> *T3 R=  R: >Q):# \0< @ RL@0(T  R0( 0 R:0@T 1S 0S >Q*@.T$ 1S$ $Q >:$  -L -L MP9@p`XL4) 0v P`8p <%<a̕ \P00Q@0S   K"K"Kr, KrK3/0l)PT& U0R K0 -L&@P XL9&0 P Q<%8Sȕ| I*Q,%$3\9S P 3P*0`S0 ##0'*30Q*aQI\ #>:, 4\ 000#8#004LH# 0 0QS # 3  SQ$ 0SH#LT3 0Q0P#0L#&D 0P0080C\04#,000 0L#PH T3  QP3   $3pW TH0 P#0ȕ0\LD# P  D S| d0 0Qڍ p 0 0QD3pW`3`p, pG\` `d#`X# `Q.Qp` `W Q` ` 0pQ` `p ` `6\ȕ `` `Q  P<#< 8#``,0``L#P4 H3T ` <3@, ``0048#P`` ``D R B |80P#00,400 00H000 0   8R 0,0 00(0S% 3 H3T0P0 4\,0 00L3Hs R*TsP #0b#0,P0T#0 -L6P)P@LD.  T#RP0$̠W ~R@@`RPPV& m 0P  aV  0Q `V ` V`l` ` ZZ``a `n0Sm,0  Q  qWqW  QQ0\^@T mPn 0 0Q @TpATlAT@ pTpl@p0@xAQN\m,0 Q 0 \p\l\tQ?: aV``at -LQ >@T P R m x   -LP= PPP8\R3 PQ  @ @>@ A0CR.` S`RSq@>` L0Rq` SU@Rq.`0A SU`0RP p-Lh1SQp@ b \ <\R\A` P00S@a h1@@h1<\p0p -LQ0 hqWR@@@lP <P\ P PpP`pQ` W @Tha`:hq@@hq< Q -LD9-,= =8+ @   =   -$= ( 0-;0@0 -L!0Rh 0 4’0 \ 0S QSh #  -Lt 0S -LM0Pd QY `@p PVW @ p`U PT  @pU `T R``R 4 0 80 < b< @*:S8p\\@D X @@ X0`PR`pdPd@h\h0Ul l@PpppR00ttP W00x@xpP||PW  p\00PP00@Q  @pD\  PT@U00T` p T``R``0@4@@\0 4 2 4P$0$S``S 0Q0 0 <T R  008 1 < 6  $ &( <,&0 48 <0S SL:00@0X*\<D  H L &P0T0P @T) 0 0Y o< 0 R 8!@4@  0\  0X  P:4 6@T" 0 0Qb :48 0Y U0 0C):YP 0 0\J  P:< D X  0SL oLP8p @ 4p 60@

o\@8p P4p   0 0S; R& R R0> 0R2K00 @3  @(P( R0@(0@ @@@ -Lh @P@pP 0S Q Q ( Q Q ( 00  x-LP9 `h @88@0x -L`9 pPh @8P8P@0 x-LL9l@P @#-R@+-\-R"C0 @C= P0  80P@Q  C\@ C=@0xT ͔\ t=S  o` @D @ H-0S  @0LxP 0 ` -Lأ ` 0S# Jp@P pPQP PQ PQ PQ P NP \l 0 RLE&:0(S  R(  R: p-L M_ D @P@` 0fUU bPq qlH P`P > 0 @Kp x-L@Q`$ 0P\PS`P  @0PPP P 4 @0 , < @ x @ @<x -LLìt@┠` pPQ pQ p@ Tt 8  -L@D)(-=- 8;0@000-00  =$-0,00= + @  -L1`x hS 0h P 0h S h@!PRc,Pe!0Sh  -L`s  0R  S LP@ PQ @Qq\⿬@ pQ pQ pQ p Q  p^Q qQ pQ p Q  pN T@ -Lh@Q ( 0h1 -L@@8    -L&0 Rk 3^*Vlo|`p P @TA QN… !ô \ B\?\<T  \ R R7Zπ"!o, QT  QT  R Q ZP` Up* R  p-L M@h0 S?*@Ph@` $0`h0 ` ch@4 ` h1F%:Ph1 b h1 $ b h1  h1    > X  46\  h:8  8:<  p9@  d:D  83H  ,3L  03P ,&1khg 琖 Pth d d Pd X 0  d \   $$ , 8( <0$ @` `4 D8 H<$ L` `P00`P 8!R<1 <1S \4 4818 (5  0% 6 $`' LX<,e / nl\Hd h 0p@堠p@*Y p\@l p@0* @p`\@@ @p` 0@@: @t)X>p:0S<1 @@`  a0S`QP00  Q0 SPP$P n|Ǭd`Pp G0:  p0@0 P \ P(Kp0S1 0@" AA=` 0QSa 0AA= P 0 SQ  1 0@RR=` 0Sa PP0R-R= P 0 SQ @0@ -LM6@ RvD PUu PU mP0`,K 0 P@` pPWlK 00@D~ o,p6`` 0V\⨀`PU`K 0`KP m̂PQ0 00@D>  0  Q QD> 0S, / S?eό͌&00Q01 R ! S0 D pW  PU m|P0 `~  0Z `,K^@ P Ql`K 00@ Yp mp0 `  0Z ,K^@ p Qe   00@U㬀K K Z J0R! R  0Z  0 ZW j P0ISZP Q  Z PZ ōD^ 㬠⨖6 ` ``V 0`嬐 ΂ ` 0 PU`K 0`KP mPQpp0 00@D~   0 0VPU Q&P V0V^o * Q0!  S  Q Q  Ro͂ *00A@0dS NR! R 0S  0S(KH0: n^p m<PNd^ X  R0 *P@  \B  0R8:oᬠ 00@ >XP m< HP d `V  R0 *Pl  P  0Rd:ga 00@W% o o0*V F0R  \ ō0V 0oo0V U%o`g*0 a0 0SF\ \ ʄ4 0S  ʌ00 S0.f6PQP m<A ^p  R0 *\ \  0R:` f00@ 0!0@a  PPU E0^0S*P R0S: PSz* 0\ ^P m< N pW  R0 *Py  P<  0Rq:op 00@6PQ` ml0  `V 0 \  R*0 \  0 \l^paVomZ*Po0*|aZ Xp Q  0R*  \ 0 QomZ*|1 XplqWp\o}P*Z q0 Q  0R*  \ 0 QlQp\oͅZ?*Pq0o|a* 0ZYaP Q  0R*  ^ 0 QoZo*|1 ^P`l^ om*` PZa0P  0R* `V 0PlPo *` Z?Pa00laVGp\DoͅZ?*`P0=&`Pe 00@` I%:Z/ lQpqWoZ/P | XoZ/p laVo kZ/P 0 l\p^oZ/P  |aQoZ/*`P |a ^omZPal\pqWo}ZPql^_o˅ZoP `0`V|`Vo Zp004L@@K x-L>@`VP5 PV`. P -`F aQPaa0 m,T0 0`S0cSP000m,T bR bR PSm T  aQaQP0,0PPS P' P @x @Px < R@ PPx x -LDM``KP@8p0\ X @p Pp Hp x DP ` TP LP P U4 < 8  R, 000 PP (0K P K@@ -L6PI PL@.  0#P# MNN MhaVs0{8 X4 a!V ``L R R   TP͓\T͓X!\ 0Sh1S1 <P = R00 R00 R00 @ ( PPH.00hPP0<048   48   x a V؁R:8p4^ ^`u{|p`-^`z`nV`v؁R:̀p̀{d -Lm}`J&:P@(/ @0R( Bn1  P \  1  .1$ @ V*p Q q `` *V  Q *0 Q0 :m  0B -L>@Z T{ !`J`PP ^  0S  P(^  $ 1 pWs PpZdV mm`1P} ^l 1 ^O$ RL(PI  pZFm`PB ^  0S  01( R$1 `V,$ R)(\&  m`p!P ^ 0S 01( R$1 ^ pPZP(0S$$Q(P  0S! 01(\$( R$} -L M6@04 S 0S00x 00 Q<    0<>  P 0 R 8> pW jm`TPPn *P0 .PU S~  P*  Ss Sp  Sl  P:nྫྷ⠠o r| 8 P0qep. p 8P0$/ PP,P P$p (P 0SJ 4Pu3pPWPX  ` V o .H0 .HpD^ _ 0D  < 0PS0 Ph1PP X &0PX1  Ph1 `1 \  (KnWk@X QUX 0SPx Q `  0RF&\J\ 0S> L 0`S7 <> RZ 0PK3: US 0Q\ pp$6( 0`! \! h X 0`8 04)D| xLd000 l0 4< Hhc\ Q  @$P$ 8|^  0, $ (s RQ -L0 !!  !! S 0 0p1l18  -L @0R *\>  H RL. P -L$6.@ 0`RZmlJPP Q/pZ`𭝘X P 0S.p`ZP Rp`ZPp \ P Pp`ZPpZ`P -L~P0Sml@`@P -L~`0  SmLP@Q P@P:Q -L 0SS `Vm̀PFP0AT AT V𨝘U 0AT AT VQUr 0PAT ATr V 0AT @ QUqW 0PAT @ qWqWy V `Vm<F@t\U \0(T tATv 0\:t1S 0\*@tQU PUlQUpQU8 t1S 0Sl1Sp1S+ 0\: @ QUqWQ @ qWqWG @` qW]qWZ \l\p\ @X QUUqWRm@4 @q1h!RRpq!lq1 Q<0L):=$01 @TlA TpAT @! qWqWḿ@4 @1q1h!RR @ QUqW -L \m\@Lp@`V> ` VP(W @pWB `P V :@`PpW `P V*@pWR RqW T R RqW T`P V:qWqWR RaV T` VP:R RqW T`P V:aVqW x-L> Rx=0\ m̀@P0@P\ x0`V 0@\ 0RPx 0-LP @R 00P000P00 -LP p`Q 0@@ 0\@b m< L  ^Z  !RN  R0*P   ^  P#  0 R*  ^#  P%  0  ^^^ 0^P 0^^^P^!R^^ -L0 PE ` Vm,F@x P P (T xA T  P:x! R  P*PxA T @TlATpAT x! R Rl!Rp!R  P:`V bm̃PFPAT[ AT VU ATo AT VQU/ PAT AT/ V AT @ qWQU1 PAT @ qM<: WX! V @ qWQUQ @ qWȁXG @ qWXm @$ @q!h\\B= PElPBpP? @ qWQU @T9lAT6pAT3 @n qWkȁXh @q qWnQUkm @$ @!q!h\\pqlq! Q<  ͌$ 1 -L M`@@T 8 q|㔐␠✀pP@0 0"e2΀r,0  q̎:QPxP@@@@@@@@l @L @Q 8 @Q ( @~Q @(U0O Q x 4O Q 8O Q ( 00 @0Sf :SP o lQ  h!Q P Ph  l pp la PP: .爁 0@ 0 P0$P,PH|. t  8 0hQ P4p^ 00Q0\P  l! o <^  h!pWlq QR Pla @~ p.t 0$p,p p040pH|. p 08 甁 0Q  ;o <>  hPULlq Q Pla @~ p,.t 0$p,p p040pH|> p !8 !0 0R  |  XP  0SPo  hlq 㾌.^HePPT̄.  0> |r l Pl TPPSRP la 0%tn 0S@> PPl1 P pp`4PU4P%45|  pha P`!pp P8 qq`V 0 la  Px 0SP   l! lq 㾌.^HePPT̄.  0> |r l Pl PPTSR la 0%ptn 0S@> l1  PPp`4\4%45|~  Pha`!Ppqp^ 8 `V0` 0P01P0` } -LmM`@ P$ p 0S -L~P0S mL`P@Q `@ P QPm,nP@~PE PX/   0 Q:p+$\( \ * 0S$^  \* P$ R   0S0\:P \ : -L/ `0Sr  P3 m\pP@ @ plApA@AA@AA@0 @@@@@$@@,@@0n-1@ P @ @@R@@@P >\ < RL *^  R* 0 R:/ 0S .L H 0 0T. L H>  P -L? |@8p`P$P $؋x< P@dU$#Q> P@dU P@dU 0P@dU PdU@ PdU@D P  0 0R1 %*`> lN h~ ,8 0#PPlP@Dl aU࠱ࠡ a Q0 0 0 0P Rl A8#00000h. B8, 0000 0-LD X (0@R S$3  /   0S \> \0P$X P \  R  0 \ <. PUH P\ ^ H L> Q   0P 0 -L@P @R!0 # 00 -LM@ 0P @h1SP  R! @h1S C ` ^ R Qh1( `h1`\K<Q`Ph1<Qa h<0cR:h < 1bh< 1bh< 1bh1< <0SD RA ^> !0Rh0 4"0R 0S# !RShhptq`pah1 h hq``h`dh1 0 N@ . 6  P 6 d  4 t PTPP@ R  K0" 3/ 1;`1( ` Q P  0Pc P @PKpt \t8 Q p , R p t. 0S\ Pp PQ \ t. Qtx t -L d! -L Mp @R :R @(K!mm`!刑$P$P1,, 1R  h.dP<HD 8倡爁刁崁1hQl1p<4儑`01( ,|0148Y1lp儡刑唁ܡ尡崑P0'31 P (  1hPUmm`' mm`1S" ! `VZ \ Q~0nmPP\~ ` QB:00S!-  |$Z  R$Z ^  \$P  R ^^0S0P.0Q*\> ^| H Rx^T:Pt mlP 0s `0Qh \ `$X,$`< \$`<D o P0ASQ PQ 0SR P_̄8p Q 0Si D`8` '` 8Q \  @0S o3/Q 0Px   0`P   ( Q(` R \ \ ^<8 `P   ;@PX'.>^0 S,,@HY R P   p0@9, @1=  Y,@ @Z<H)^P\  P 0,@P? $ 8. $KX ^ l  PP >^ P] P m@P 0K P ?  8 \# \8  . 1@3 m;P  Q$`@ul\Pa pP^,8 0PU>PmxX \* PP @S<Ȉ pWPh PPZ @<8 D08Q,@0D P   @ @[;@ @;{,@ @|<@@0S ( h, K, ( 3/ @; ,@U: 00,@ @<X   @;0+@ @; -LdQ@U |> `P5   |>  PA P8D 0 8+ @ 0  =-= - $= ,0=(+  @     P@@@ P -LM\~`@P  P \ d `> h l 8 pp> H 4&L @ `0` `p` ` pf ,(vn  08pZ. 焞 ㌮ 『 p   㘦 ` pV0娮 fgf@„~ ],4؃n ؄ ᔦ @㘈 4 06`a ,p)D f. ` \?  `( R  ̠bQ `   W  h    -  - P  P 00S0  |l@00`s PU2 0SZ# "ÍJ<  `Qp Vp%Z `FVp% 0F`Cp%Vp%# t PPP(KZ  PZ  U E  Z U U ] <Ba8`V 0 S% V: 0P6 }%@^ ȗ\P H0P %@@6\ Y-@  0 $0P0, V 04` nb  49^T0 d!H Vh Yx 8 8 ^:|P# hdH  H<0P 4 0PPP@@QRV0C0F00P /&@W:,U&@% 3 l&@4P89P0@%  @6< <   0@ &0c%@< <   0@$&0c@@ -L9lp` @PPPP 0e4C@@dh 0@8P8PP  A P @@dP -LM@S0 `dTD040 P0@B',p0 SU0S   !pPT  <4Q TSpc0  PT$T!ppS30 'TP!qq: TpS0'!PT(K0@< ,0 SW0S 0@̈/"  0\W0\lp`0Pr0@8 8 <!̠ 0 SW 0S  -L9lp` @PPP @ P  h 0@8P8PPP 0e4C@D@@@P x-L@@ @ m<P  @<@  x @m @] @  @ = @ @ = @ @  = @ $RP  @(= @, X: @ 0= @4 @8@ <- -L$M9Lh1@-K`p   -P[pZ-[P P@8 @ -[ @Y-[^ Y TY3h1< R ,0 ! Ww )WR XW :Wf W TpDpTY pT0pTʽWo UW  W\ W0@T0DpWYppW P@ W Wm W0@Tz0DpWrYppWdWz W& W0@TS0DpTKYppT=0@0 01iY*0i<0 SࠡΑYI D WD0S p W pp W<? n Pjp -@[pY-0[S S(K0@TpDpTY pTpT0@TpDpTY pTpTʝ0@TpDpWY pWpWx0@TnpWD fYppWX0@TNpWD FYpY:  pW80@T.pTD &Yp pT0@TpWD Yp pW@ W! W0@T0DpWYppW0@TpWD Yp pWW! W0@T0DpTYppTʊ0@TpTD xYp pTj-W W0x @ p 0-̓<<0Q h Tp{@<0^#2*n R <  @ <I" @Y  R< 8<嬑I  H  < R8@ <塑I @I H^  P^ W, 0pIMp< @YW @Y @Y < =( <  0̓<180S ( ͉4 K<4 3/ <00)p01pgWpgc0@TpDpWY pWxpWm0@TfpDpW^Y pWVpWK0@Z: TApDpT9Y pT1pT&0@TpWD Y pW ppW0@TpDpWYppW W <@":T DpWY pWppW@gC @ = <  ́<0! -LP@@P@P@P0 0@P8@PD@PTD @ @X @\X0S`! pW`@p@d@XQd`* @ @ @ @@PT^P@@P 8 \.@@@@@@@@( Q  @P? @ @ 2  @  @H@LP>@@<@, @@ @$P(  @ @, @04@@ @ @!R1 pW`,@p@@1S`* @ @ [: @ @@ -L4MPQ@ 0dSnS  + zS) S 00$ @ Ph  R@P$0S!P P @h \ (K@Ph 0S@PP@PQ@P R@P @}n`TPT $ @PP (F p @PL ,)   @PH 0  0p @PD 4 @ @P@ 8 P @n`uP4 < ɟp@P0 @ @@ <@ PPK @O@I@C@=@\4@Q,@ R$@P0 `V~ 0S8V@`: ^@ Q@]1 @ R^ @@  0TKTpW @04K4PcT pVP`0 @K@0S4 /@`@0 0K0Q@ @0 DKD Rl 0p0 HKHQ, p0 LKLP p0@ PKP0S  @ @Y1Z@ PQ@  RIPA\ : @̕0S 2،X.S+  "@r0Q B\ thhh<HH\TT@@P`1`# ,R Y 0@<SV`1l@ㄘ R@ 0SPw0 = }@(  0 RPTLЬ$=0@=p0(,-Z0  V `! HV1#  P  W:Z#\xd0 ` Q @0S < j( < K8 3/VY!*@0S|  㼃KsKkcK< KⶓK3/rP Q  V:R0@0$ Ь@@ @ @ ̕0, a Ljc RSeڢ࣠ -=dЬ$ R`! `1p @'/@$"i@  @@@@@ @<,C\|0 P`p -LM @@@P@D @@ @<  @8  @@`p 0Sg占 BWdU `MU XU BUv  @d)V ^ܐLi0Z%D0@<0 80 p0Pw0 P(K@DDD8@<0THLP0X \pP= DP HL DzU U nU@)V ܐ)0Li]:@0) Z @)V @)V 0>#@@ B W@0S  0 p4 K4p m3/0U#@0 P -L# Q\ 2\pTPW`T P ~4`Kp}P 8 0R  \ X@ \00SD L 0># \5 TZPP0XZ̃@@pP `X t I \P 0`PW P@}.  .0@ 0P `P<Z8@ @0P`p -LM@@DYp0@WD@͠ 0ASYL "^X ܨPi ԈXp0PL 0P$K@0~>pP(0P  && @ BW^:@0S ( ( pn,p , K3/@@@@ (0PԈ< -L@@DP0@U RPP9h&LP&0PP>% P  Q @ @ 0&SUpWf v㼆000 PK ,̕"S00Q0 0^U SS RpW sQT lh@ @X  PT3l%X%T, , Ă PU 3b:0@ U @0S ( f 3/ 0@h&6PTP~   @$KX  0@`V{00X  0@`V@ @0SH $ K d@@"3/ @ @ @ @ @ @@0PT @0S p 3/0d1Pv%@ p-LM0Q@ 0S `V` (( (   8 `  `Ph KphP`: 9\8Ph  h1p P hRRT K$ K0PB ` V  $`V' `h8`h1 P @t  R h 803 `P( (K00K, K)@@0S  K d@@"3/ @ @8 -L -L 0-LQ0Q A@P 0U @Q 0P@QP P P0 -L|M@ 00@+ @^  t @Ì ф x | 00@” 0,S,àX P h H \ T L p  K3/K%@ -L$MP@P0 S 0SR0 0000SF p 01pl p,p@8 4 0 |p00( 4<q8 4$ c: p0 :( 0S0  0p  $0H@D0 x0p(L0PT 4,(81 0S \8YG   ` 0< @ 4@ Q& 48Q,x @8q|FHp qtT0,< @@^H@njd@Q0a`@` `<0p40 ` < @ 4@ Q& 4<Q7 @8q@Hp qT ,<0≀@@P Hnjj@Q0a`@ <0p@ /0 0 00@ @0 0 0 , 00hsWv d3S`6d3SU40C ,,S 00P` pWd3S,"R @ 0S 3/ @ l1CPlv@pP@g $@y#@00@X/@00@O#@00@F#@00@=@ 7 -L0K   f:  0 P   -L4 -LP00s0s -LDM(`0 i@ ` h0 h0 Z  pB @( $H |xÓ4 C8@ @ӈsj g 28 0 h l < 0 P0P c P0 h 4Lh  80 #lSl PPL a h T 0h 08 <! XQl`< i!1#S`H0QP#@ P@D:T Dp\0g$@ j(p,SC"à( # P$@, (KP65053`bH U@@ 0PdL0EDP ^40 XDWD0$0D<Q  P<@ h l h0D4 H>gP  "8p   PpH dlpH008 <0咗,p (h Dh04\ p@8哚" 0<p,p~`gP 4@D 2LH8 bP0咄#$ h4 0*!D0@z$ppZ,0@(\ PU4 P 0 ( ,P$@pPpp@0 PD \ Q7PB S?D@$p@U\D@(,0W P\p$X'SǠ( ,@A@@ @$@(@,@@@ 004800L0 <0 @0T . X  PdP P -LQ0Q R R 0QO 0` SRS\//O`RS\g:0  R00RS\ SRO ` -L -L8S0 0S S080 R 0S08 -L0Q0P -L@8P8p8 -Lp<@8P4S`0dh0l   `d \hh0Rl l -L@@08 -L@P@`pP`tp 0H!0!T# \  < 0 1 x-L@`PPPP  Px x-L P@88PP 8``8`x -LM@Pp<dlXX|8P88U ( @' @(3 8P 0Ȕ\ , `V4 gV8 @x^X,^p \ `` p`q 8WV``PV R 0R.*xl8 8 >PP3 ((Kplx<tgp|Zx t #K؀KR  #K `@8`8x` 88pp8p 88@J?`, 8`8x ` 8ܬ8P8888뜀吀 ᔀ嘀88 @ 0 @{ p-L M@ 0S! d,8PP 8 8 >PP 8``8`Kp 0-L0@VPbP@h:C.`I 0 @0 SŽ,0@0 SC 0 -L@08<<<<88888<8888 -LDM\@KP`00S hlȖp (t8!c, q $p(, ((0 100$4⌅Pt %ȖdU崓ᶣܗ̧9:p堇w;<ǖ=>PW?p@ABCDE8FPt@|P` 0RPP|p, !2(i:  L  H 0 $4TP -L7t,@S0; 8p<P<^*d|@8`XP8888`` ``88 ``@n8 (8ΐ@  -L\M0!@PS p Wn `pt p @\ PP@( 0  0Z(K \dQFh SD|xp`Wt  Xt !`0pp0 dQ\ p;:h!`VP8:<>S |x\t  Xt 1 p y@@ @h! @@hP @P -L`@pP@` PAuP"u@?T00P0SPD?PdAAό0 d SBQaQ  0 Sa0a Sa 0-L M0PK@0 4 @XPR  P P P P P P P @P(0S 8f3/PK0 @XPȄ -L M8PK@04b PP P01hP``\h P@0S 8 f3/KpPo P P 0`0j: v`V |0s01`P P`P `P `P 1S!R SB R`\hP@0SP`. \PPsj@\x @0SPz 8 g3/uPV pP' pP pP  pP pP%@\h00@0SP+ 8 g3/&0@GP`R QP`PO `\h@0SP 8 f3/@@pp @\`\hP@0S 8 f3/@P[ `\h00@0SP 8 f3/@\@0S  8f3/PW!R $ P` @ P`1Sz PpW @\h@0SPux(,aV0]\x @0SP 8 f3/@VP5 @00` S†P%00 0` S ÆP'P  @`\hc@`\hPT\XP@\x@0SP 8 f3/ k:-L$MHPK@p`0 54444555 55dP\`aP`h `ThP@0S 8 f3/(K`dP`hPlTP\`dqhalp]脁씄tdń %5PptPx | -L M8@KP`C` 0@lSSx[[T[\ZX - ptą$Q4k ,RPfapPP0P4P? pWE``h@@0S 8 g3/K0Πpt4ą `ptą$``h00@0S@ 8 f3/ 0p$t4pPW@TD`HD@@ p-L$M8@KP `P@Xh00@0S@ 8 g3/KpX@ -L$M@@KPpaᶁ ^3  ` R'0S/  \  RP0SL0L\PPL0 K0 P x-L@@@P0P`Q P`J  P`C  P`< $ 0P`5 ,(P`. 40 P`' <8 P` D@0P` LHP ` TP ``@P ` \l: X P` x `Ax -L,M4@pS`8 P(KHPKCn`` `@ 44$Re 4Sy S\ ̔\ qPyP Pq Xd PpPo dQ~ᤄpPe P8u 44S~ Sy <`Ŕ @$\ 1SL40H4D@^4ĔPP0P4\b Ą` `ȄP}@` @0SP 8 g3/@fR P`X @PX@PPRr @`x00@0SP@ 8 g3/;|P4T`XP.P<PpTO 4^PpX`00@0SP 8 g3/@HLb4Qcǔ\` pPp pP/$8}S(P P p,|tPP P 7S;` @0SP  8g3/4$@ GP I h IPp Ap pg -LM1S  K   P01 -L$MR` 4` 8` @<` Q@` -`Kdh$0P 04 S PR` p04 S ` Vp PRU ‚QVQd(KPEU ‚Q3-8(P #} F#} V 1+#@ ̔0S` ج, K8`"3/4K X0;8K`h @0-`K`Py80m:P4(80$e ,8 @PZ (KV Pp8 0@ ` W `U @0S , K8P"3/0^Z^r  ,M @8P881SR @\O <QL 8 PĔ`0`@@@@V"  0RP SI*p,8 @ y@s@mp<8 @ `pl8 d,X 0@8@< I -LP00s0s -L -L$M@@"S<0  0||< RPBQW00@ 0S8 3/(0SZ dp o : P㠡! pjP8  $8t0D 40 H @ 00 |bp p@@`B|0! !0@"à ""‚) , @  0  @ @0# @0 @ <00@<0@@0D0 H0L0P0 T0H ` 0!㾢@""d 0@ "h 0 l0@0<,<`0<`? ;`: 9` 78 `6<0  g( k@01`" 0PB "bB@F`|0( @ 8 @HD,4 $ @ (`@0@,4 l @0 L0 @4 P  @8 T @< X0 @@ |y'@8$ D <ė @H 2P (K00 P0`p40 娡$ @` 8` D H 1P p |0}@42 8`0 ~048@ ?  # #& #&) #&)-!     !(0)" #*1892+$%,3:;4-&'.5<=6/7>?    !"#()01*+$%&',-./2389:;4567<=>?   (0891)!  "*2:#+3; $,4<%-5=&.6>'/7?can not create thread! VDEC_Resume ok ! VDEC_Suspend ok ! ****** fatal: UNKNOWN CHIP TYPE(0x%x), no thing can be done on this chip! VFMW has been destror?: yed, so any operation is unuseful! vfmw.c,L%d: pArgs is NULL! vfmw.c,L%d: capability level out of range vfmw.c,L%d: MORE_GAP_ENABLE out of range VCTRL_CreateChan() return %d vfmw.c,L%d: pArgs->AcceleratorCharacter is NULL! VDEC_InitWithOperation has NULL parameter, error! VCTRL_OpenVfmw() return %d VdhId is wrong! VDMDRV_V200R001_OpenHardware <6>load vhd firmware.ko OK ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/vfmw/vfmwfunc.cHI_NULL!=pfnVdecEnvent create vfmw failed: %x create vedu: %x HI_SUCCESS==s32DrvRetHI_NULL!=pArgschnid invalid :%d stat erro:%d %d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/vfmw/../../../arch/common/vedu/vfmw/vfmw_drv_comm.cNULL!=pDecIntfpstChnOption!=NULLcan't get mmz name Vdec%d_%sSliceData[Func]:%s [Line]:%d [Info]:valg alloc mmz buffer failed! valg alloc mmp buffer failed! Vdec %d malloc err. NodeDataVdec %d malloc NodeData err. Vdec %d rgs to chnl err. NULL PTR 0Vdec %d dec param is NULL Vdec %d err. Vdec %d state %d err. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/vfmw/../../../arch/hi3521/hal/vedu/vfmw/vfmw_drv.c0HI_NULL != pRegHI_NULL != pstH264DecParamHI_NULL != pstMemInfoHI_NULL != pstH264SliceParamHI_NULL != astSliceMsgVALUE_BETWEEN((u32SliceNum+k), 1, H264D_MAX_SLICENUM)pstH264SliceParam->pNextSlice->first_mb_in_slice>pstH264SliceParam->first_mb_in_slice[Func]:%s [Line]:%d [Info]:slice null ((pstWReg->u32RcnYAddr&0xf)|(pstWReg->u32RefYAddr&0xf)) ==0(pstWReg->u32NalAddr & 0xf) == 0chn %d pic size is out of range. %stracer memory '0x%x' is mapped to '%p' map vir address for '%x' failed!!! no valid trace info stored in '%x'!!! ====================== tracer context ===================== %-25s :%x pstTraces*:BaseObj%-25s :%p s32TraceBasePhyAddr%-25s :%d s32MaxTraceNumMinus4s32CurrTraceNum-%05d-func:%-15s; line:%5d; data:0x%08x(%-10d); time:%u =============== destroy tracer: phy,vir = 0x%x,%p =================== vfmw_tracer________________ mem_phy, trace_phy,trace_max = 0x%x, 0x%x,%d _________________ %s=(%02d,%02d,%02d) x F%d ---------------------- img que (%p) ----------------------- %-25s :%d max_queue_sizequeue_sizehistoryheadtail%d | ResetCount%-25s :%s queue_name%-25s :%p DelImageProc%s=(%02d,%02d,%02d) - F%d IMGQUE_InsertImage but the queue is full!!! %s=(%02d,%02d,%02d) + F%d VidStd Err! DecSliceNum(=%d) out of range! DecSliceNum out of range! pRepairParam[0].MbGroup[i].EndMbn=%d,pRepairParam[0].MbGroup[i].StartMbn=%d total_mbs=%d,err_mbs=%d VDMHAL_NULL_FUN_PRINT,L%d err_ratio=%d vfmwvfmw_dbgvfmw_prnvfmw_decvfmw_scdvfmw_chnvdm_ctrl.c,L%d: %s ChanID out of range(safe,warn,danger) :amount = %d,%d,%d,%d strm_ctrl: I->IPB strm_ctrl: IPB->I (CurrMode,NextMode) = %d,%d ERROR: (nPmv(%d) + extra_ref(%d)) <= 0 ERROR: TempMinFrame(%d + %d + %d), TempMiddleFrame(%d + %d + %d), TempFluentFrame(%d + %d + %d) VCTRL_GetChanMemSize L%d: arrange return failure ERROR: s32MaxRefFrameNum(%d), extra_ref(%d), s32DisplayFrameNum(%d), extra_disp(%d) ERROR: (MaxRefFrameNum(%d) + extra_ref(%d)) > 16 VDEC_CID_GET_CHAN_DETAIL_MEMSIZE_BY_OPTION is designed for CAP_LEVEL_USER_DEFINE_WITH_OPTION, please change channel's capability or use VDEC_CID_GET_CHAN_MEMSIZE. VDEC_CID_CREATE_CHAN_WITH_OPTION the purpose of creating the channel is not clear. s32SlotWidth or s32SlotHeight is 0. CAP_LEVEL_USER_DEFINE_WITH_OPTION option is illegal. VCTRL_GetChanMemSizeByOption L%d: arrange return failure ChanId out of rangeChan inactivevfmw_ctrl.c, line %d: ChanID out of range vfmw_ctrl.c, line %d: Chan %d is not open or not running create soft-decoder fail! can NOT config a not-opened t0: Chanregister soft decoder fail: '%s' can not be NULL pfun_iMediaSoftDEC_Createpfun_iMediaSoftDEC_Destroypfun_iMediaSoftDEC_Initpfun_iMediaSoftDEC_Decodepfun_iMediaSoftDEC_RecycleImagepfun_iMediaSoftDEC_GetRemainImgpfun_iMediaSoftDEC_GetImageBuffer=============== chn info ============================== =============== chn by vdh ============================ %d =============== chanid by prior ======================= =============== chan prior ============================ =============== chan isopen isrun ===================== %d %d %d 'print_enable_word' definition, from bit31 to bit0: --------------------------------------------------------------- DEC_MODE PTS DNR FOD SCD_INFO SCD_STREAM SCD_REGMSG BLOCK DBG SE SEI SLICE PIC SEQ MARK_MMCO POC DPB REF QUEUE IMAGE STR_BODY STR_TAIL STR_HEAD STREAM UPMSG RPMSG DNMSG VDMREG CTRL ERROR FATAL 'vfmw_state' definition, from bit31 to bit0: <2D_TO_QUEUE> <1D_TO_QUEUE> ------------------------debug options-------------------------- %-27s :%#x tracer address%-27s :%s path to save debug dataprint enable wordvfmw_state enable word%-27s :%d bitstream control periodframe control periodrcv/rls img control periodyou can perform vfmw debug with such commond: echo [arg1] [arg2] > /proc/vfmw debug action arg1 arg2 ------------------------------ -------- --------------------- set print enable 0x0 print_enable_word set err_thr 0x2 (chan_id<<24)|err_thr u%:set dec order output 0x4 (chan_id<<24)|dec_order_output_enable set dec_mode(0/1/2=IPB/IP/I) 0x5 (chan_id<<24)|dec_mode set discard_before_dec_thr 0x7 (chan_id<<24)|stream_size_thr set postprocess options 0xa (dc<<8)|(db<<4)|dr, 0000=auto,0001=on,0010=off set frame/adaptive storage 0xb 0:frame only, 1:adaptive pay attention to the channel 0xd channel number channel vcmp config 0xe chanId: arg2>>27, %42smirror_en: (arg2>>26)&1, %42svcmp_en: (arg2>>25)&1, %42swm_en: (arg2>>24)&1, %42swm_start: (arg2>>12)&0xfff, %42swm_end: (arg2)&0xfff print tracer 0x100 tracer address. do not care if vfmw still running start/stop raw stream saving 0x200 chan_id start/stop stream seg saving 0x201 chan_id start/stop 2D yuv saving 0x202 chan_id save a single 2D frame 0x203 frame phy addr save a single 1D frame 0x204 frame phy addr width height=(height+PicStructure) set dec_task_schedule_delay 0x400 schedual_delay_time(ms) set dnr_active_interval 0x401 dnr_active_interval(ms) stop/start syntax dec 0x402 do not care set trace controller 0x500 vfmw_state_word in /proc/vfmw_prn set bitstream control period 0x501 period (ms) set frame control period 0x502 period (ms) set rcv/rls img control period 0x503 period (ms) =============== vfmw info ============= %-25s :%d version num%-25s %d:%d.%d%% VDM load%-25s :%d.%d%% DNR loadextra_refextra_dispUSE_FF_APT_ENg_ResetCreateNewSaveu32VdmKiloCycleu32StatPeriodThis Chan has not been created!!!can NOT get a not-opened Chan's information of bitstream=============== scd info ============================== IsScdDrvOpenSCDStateThisInstIDLastProcessTime%-25s :%#x HwMemAddrHwMemSizeDownMsgMemAddrUpMsgMemAddr--------------- inst[%d] ------------- Modev&:cfg VidStdis wait seg extcfg BufPhyAddrcfg BufSizeraw Total sizeraw Total numseg Total sizeseg Total numseg read_addrseg write_addr%-25s :%d Kbps actual bitrateVDMHAL_NULL_FUN_PRINT,L%d vfmw_ctrl.c,L%d: %s =============== dec info ============================== vfmw_read_proc_dec L(%d): pFspInst[%d] null --------------- chan[%d] ------------- deced by vdhs32IsOpens32IsRuns32PriorityeVidStdcfg s32ChanErrThrcfg s32ChanStrmOFThrcfg s32DecModecfg s32DecOrderOutputcfg stdext APcfg stdext CodecVercfg stdext bReversedChanMem_vdh mem phyChanMem_vdh mem sizeChanMem_scd mem phyChanMem_scd mem sizes32SdecMemAddrs32SdecMemSizes32OffLineDnrMemAddrs32OffLineDNRMemSizes32VdmChanMemAddrs32VdmChanMemSizeRecent UsrdecFrame: enFmt=%d,w=%d,h=%d,Ystride=%d,Cstride=%d,PTS=%lld s32ScdChanMemAddrs32ScdChanMemSize%-25s :%d,%d,%d ref,read,new%-25s :(%d,%d,%d) decQue detailactual DecModeactual DecOrderOutputimage formatframe packing type%-25s :%d.%02d fps stream frame rate%-25s :%d.%d fps actual frame rateVDH 0 loadVDH 1 loadskip frame foundskip frame discarded %-25s :%d fsp s32DispLoopEnablefsp s32DecFsWidthfsp s32DecFsHeightfsp s32DispFsWidthfsp s32DispFsHeightfsp s32ExpectedDecFsNumfsp s32ExpectedDispFsNumfsp Logic fs num%d%d %-25s :%d dec_usage: fsp s32DecFsNumfsp s32DispFsNumfsp s32PmvNumvfmw_ctrl.c, line %d: ChanID out of range is %d vfmw_hal_%dvfmw_scd_msgVDEC_interruptSCD_interruptpstCfg is nullpstStreamIntf is NULLVCTRL_GetUsrdecFrame but VFMW_USER != s_pstVfmwChan[ChanID]->eVidStd! VCTRL_GetUsrdecFrame but s_pstVfmwChan[ChanID]->s32UsrdecFrameNum < MIN_USERDEC_FRAME_NUM! VCTRL_GetUsrdecFrame but FSP_IsNewFsAvalible(ChanID) != 1! get frame store fail! get image buffer ok: LogicFsID = %d decode %p, disp %p, tf %p VCTRL_GetUsrdecFrame get LogicFs fail! userdec frame(phy=%#x) address error! can not map vir addrw3: for usrdat frame(cbphy=%#x) pUsrdecFrame == NULLVCTRL_PutUsrdecFrame: VidStd is %d VCTRL_PutUsrdecFrame return err USERDEC_Init enter -1 == VCTRL_GetChanIDByCtx() Err! This channel is not openedThis channel is not runningSyntax is stopped from This channel[%d] vdm busy [%d] no frame [%d] no stream seg_pts: %lld, seg_usertag = %lld pic_pts: %lld pic_usertag = %lld line: %d Flush DPB failed! pImage is NULLcall VCTRL_ReleaseChanImage, ChanID, ImgID = %d,%d vdm_ctrl.c,L%d: Chan inactive vdm_ctrl.c,L%d: This channel is not opened call VCTRL_GetChanImage, ChanID = %d, This Chan has not been created or has been destroyed !!!can NOT stop a not-opened Chancan NOT start a not-opened ChanWARNING: vidio std not setted!image size abnormal(%dx%d) no mem to arrange for soft dec partition fs memory fail! %s: L%d : vdm chan memory is too small to support user decoder FSP_ConfigInstance fail! VideoDecThe channel %d is not active The channel %d is deced The pDecParam of channel %d is NULL Thread running... thread running... Thread stopped! thread stopped... Thread killed! *** vdm can NOT exit sleep, state is %d *** *** scd can NOT exit sleep, state is %d *** wait vdm overtime(%d), force it sleep! wait scd overtime(%d), force it sleep! *** vfmw sleep totally take %d ms chan %d: new ChanErrThr = %d chan %d: new DecOrderOutput = %d chan %d: new DecMode = %d chan %d: new StrmOFThr = %d USE_FF_APT_EN = %d USE_FF_APT_EN can NOT be set to %d, must be 0 or 1 ResetCreateNewSave = %d ResetCreateNewSave can NOT be set to %d, must be 0 or 1 NO SUCH CHANNEL : %d Pay attention to CHANNEL : %d print memory tracer... %s/vfmw_raw_save_%d.datOK create file '%s' for channel %d raw stream save failed create file '%s' for raw stream save! >>>> close raw stream saving >>>> %s/vfmw_seg_save_%d.datOK create file '%s' for channel %d seg stream save failed create file '%s' for seg stream save! >>>> close seg stream saving >>>x3: > %s/vfmw_yuv_save_%d.yuvOK create file '%s' for channel %d yuv save failed create file '%s' for yuv save! >>>> close yuv saving >>>> address '0x%x' is not valid! %s/2d_0x%x.yuv2d image has been saved to '%s' open file '%s' fail! %s/1d_0x%x.yuv1d image has been saved to '%s' stop chan %d: VCTRL_StopChan return %d reset chan %d: VCTRL_ResetChan return %d start chan %d: VCTRL_StartChan return %d ------ dec task delay %d ms ------ ------ dnr active per %d ms ------ ------ dec stop = %d ------ ------ g_TraceCtrl = %x ------ ------ g_TraceBsPeriod = %x ------ ------ g_TraceFramePeriod = %x ------ ------ g_TraceImgPeriod = %x ------ MMZ: your parameter string is too long! MMZ: copy_from_user failed! error echo cmd '%s'! ******* vfmw save path: %s ******** vfmw debug: arg1=%#x, arg2=%#x ------------------------------------------------------------------------- VCTRL_ConfigChan with same config paramater. can NOT VCTRL_PartitionMemForStdUser VDEC_CID_CREATE_CHAN_WITH_OPTION is designed for CAP_LEVEL_USER_DEFINE_WITH_OPTION, please change channel's capability. line %d VCTRL_GetChanMemSizeWithOption failed! L: %d : sdk can NOT alloc buffer for channel context L: %d : can NOT alloc buffer for SCD L: %d : can NOT alloc buffer for VDH vfmw_chan_ctxL: %d : we can NOT alloc buffer for channel context vfmw_chan_vdhL: %d : can NOT alloc buffer for channel vdh vfmw_chan_scdL: %d : can NOT alloc buffer for channel scd L: %d : part we can NOT alloc buffer for channel context L: %d : can NOT alloc buffer for channel context L: %d : can NOT alloc buffer for channel vdh, %#x < %#x mem alloc mode is not supportted can NOT enable FSP instancen vfmw have max(%d) channels opened, can NOT crerate more channels VCTRL_CreateChan eCapLevel = %d error! Try to use VCTRL_CreateChanWithOption(CAP_LEVEL_USER_DEFINE_WITH_OPTION, ...) VCTRL_GetChanMemSize ERROR channel memory have been allocated outside, but the mem-infoy&: is not correct! mem-info(phy, vir, size) = (%#x, %p, %d) this channel totally need %d bytes memory fsp.c,L%d: %s InstID out of rangefsp is not initedFSP CONTEXT: %-35s :%d eFspInstStates32DispLoopEnables32TfEnables32RprEnables32DecFsWidths32DecFsHeights32DispFsWidths32DispFsHeights32ExpectedDecFsNums32ExpectedTfFsNums32ExpectedDispFsNums32ExpectedPmvNums32DecFsNums32DispFsNums32TfFsNums32PmvNumlogic fs state: %d%d dec fs state: disp fs state: pmv state: %d PmvAddrTab is NULL PmvNum is NULL DecFsAddrTab is NULL DecFsNum is NULL LogicFrameID out of rangefsp.c, line %d: pstLogicFs->PmvIdc out of range(=%d) PhyAddr is NULL pFsNum is NULL ~~~~~~~~~ setdisplay, LogicFrameID,IsWaitDisp = %d,%d FSP_SetDisplay: LogicTick=%d, DispTick=%d! ~~~ disp fs ID = %d FSP_IsFsLeak: fsp is not inited ref=%d,read=%d,new=%d,total=%d pstFspInstCfg = NULLThis inst is not activeno logic frame store!!! no decode phy fs no pmv memory no display phy fs can not find disp fs RefNum,ReadNum,NewNum,Total = %d,%d,%d,%d eChanCapLevel = %d is not expected! decode channel CapLevel is %d(w=%d,h=%d), this stream (w=%d,h=%d) can NOT be decoded! disp fs(=%d) less than expected(=%d+%d)! arrange ret %d, min = %d, actual = %d pstVoQue is NULLVDMHAL_V200_IsMpeg4NvopCopy point of picture para null, wait forever!!! VDMHAL_NULL_FUN_PRINT,L%d wait vdm time out The channel %d is not active The channel %d is deced VDM Start Fail 2 ! isr begin: *pVdmStateMachine = %d, timeout = %d, ErrRatio = %d ISR process vdm timeout! *pErrRatio = %d *pH264NeedMoreStart, *pH264FinishedMultiStart = %d,%d VdmStateMachine=%d Error! vdm state machine = %d, but DecParam is null! ISR called but chan %d is not active! Vdm Time Out(%d ms), Reset Vdm! VDM Start Fail 1 ! h264 more start need parameter wait more start time out! ====== forece VDM sleep! ====== VDM register not mapped yet! L%d:z%: %s VDM register not mapped yet!1d_yuvfailed mem_allocMemBlock 1d_yuv save! Mem addr is 0image size out of range'pVdmMemArrange' is NULLMemSize not enough for pmv slotcann't allocate img slotVdhId is wrong! VDMHAL_V200R001_CfgRpReg vdm register virtual address not mapped, reset failed! VidStd Err! PRCNUM_1D_CNT=0x%x PRCMEM1_1D_CNT=0x%x PRCMEM2_1D_CNT=0x%x can not map repair msg virtual address!ValidGroupNum=%d out of range! ***** RpMsg ValidGroupNum=%d ***** RpMsg [start_mbn, end_mbn]=[%d, %d] VdhId is wrong! VDMHAL_V200R001_PrepareRepair vdm register virtual address not mapped, VDMHAL_V200R001_PrepareRepair failed! VDMHAL_NULL_FUN_PRINT,L%d FIRST_REPAIR Parameter Error! SECOND_REPAIR Parameter Error! VdhId is wrong! VDMHAL_V200ROO1_BackupInfo VdhId is wrong! VDMHAL_V200R001_CheckInt VdhId is wrong! VDMHAL_V200R001_EnableInt VdhId is wrong! VDMHAL_V200_MaskInt VdhId is wrong! VDMHAL_V200R001_ClearIntState VdhId is wrong! VDMHAL_V200R001_ResetVdm VDMHAL_V200R001_ResetVdm: map vdm register fail, vir(reg,reset_reg) = (%p,%p) VDH: %d VDMHAL_V200R001_ResetVdm ERROR!!! VdhId is wrong! VDMHAL_V200R001_CloseHAL WriteMsgSlot error! ReadUpMsgSlot error! 'pDecReport' is NULLcan NOT map vir addr for up-msg ***** UpMsg DecSliceNum=%d ***** Up Msg (phy addr: %#8x) ***** 0x%02x 0x%08x 0x%08x 0x%08x 0x%08x ***** Up Msg print finished ***** VDMHAL_V200R001_OpenHAL: input error!VdhId is wrong! VDMHAL_V200R001_OpenHAL g_VdmRegVirAddr, g_VdmResetVirAddr = %p, %p BPDRegVirAddr, BPDResetVirAddr = %p, %p mem is enough! !!!!!! HAL memory not enouph! need %d, have %d image point NULL Initializing VO queue VidStd=%d Error! pSegMan error! More than two packet!!!ERROR!!! *****************copy packets tobe one***************** *****************two packet***************** image[%d] null Queue=(%02d,%02d,%02d) x F%d Queue=(%02d,%02d,%02d) - F%d call InsertVOQueue FATAL: p_image(id=%d) has alread{0: y in the VoQueue! error=%d,W=%d,H=%d,not acceptable! out_pts: %lld -> %lld Usertag %lld Queue=(%02d,%02d,%02d) + F%d REPORT_IMGRDY!!!in insert vo queue SegHead=%d SegTail=%d SegCurrent=%d SegBufPhyAddr=%p SegBufVirAddr=%p SegBufSize=%d SegBufReadAddr=%p SegBufWriteAddr=%pd SegPhyAddr=0x%x SegVirAddr=0x%x SegLength=%d SegStreamID=%d SegState=%d SegIsLastSeg=%d SegPts=%lld ------------------ s_SmIIS.SmInstArray[%d] -------------------- %-25s :%d ModePriorityVidStd%-25s :0x%x BufPhyAddrpBufVirAddrBufSizeRegPhyBaseAddrSmPushRaw.PushRawNumSmPushRaw.PushRawTotalLenDownMsgPhyAddrDownMsgSizeUpMsgPhyAddrUpMsgNumUpMsgSizeseg BufPhyAddrseg BufSizeseg BufUsedseg BufItemNumraw StreamHoldraw StreamPacketNumfilter ProtocolTypefilter ModeFlagfilter LastH263Numfilter SegBufPhyAddrfilter SegBufSizefilter SegBufRollAddrfilter pScdUpMsgfilter SegNumBlockTimeInMsLastBlockTime%-25s :%lld LastPtsThisInstIDSCDState raw packets Head : %d, Histroy : %d raw packets length is(first packet %d bytes used): %5d RawHead=%d RawTail=%d RawHistory=%d RawFirstPacketOffset=%d CurShowIndex=%d RawPhyAddr=0x%x RawVirAddr=0x%x RawLength=%d RawPts=%ld ***Print Scd State Reg Scdover = %d ScdInt = %d ShortScdNum = %d ScdNum = %d ScdRollAddr = %0x SrcEaten = %d ***Print Down Msg Now DownMsgVirAddr = %x DownMsgPhyAddr = %x DownMsg[%d] = %x VDMHAL_NULL_FUN_PRINT,L%d -------- forece release seg[%d] ----------- 0x%02x,Release SegPacket.PhyAddr=0x%x,LenByte=%d,IsLastSeg=%d Release Err DelRaw err PacketNum=%d,DelNum=%d Release RawPhyAddr=0x%x,Len=%d ***Print Scd Vtrl Reg Now DownMsgPhyAddr = %x UpMsgPhyAddr = %x UpLen = %x BufferFirst = %x BufferLast = %x BufferIni = %x ScdProtocol = %x ScdStart = %x scd time out: t_start,t_now,t_wait = %d,%d,%d Chan %d has been destroyed or the function pointer -- ReleaseRawStre|*:amData pStreamIntf is NULL!Chan %d has been destroyed or the function pointer -- ReadRawStreamData pStreamIntf is NULL!Raw packet(VFMW_RAW YUV) TOO BIG(maybe caused by w/h... err)! can't copy to seg! VFMW_RAW YUV disp w/h err)! discard raw packet! ***Print Up Msg Now ScdUpMsg[%d] = 0x%x scd reset register map fail! ResetSCD ERROR!!! Read_seg SegPacket.PhyAddr=0x%x, LenByte=%d, IsLastSeg=%d Error! (PushRawTotalLen - SrcEaten) > SM_RAW_DISCARD_SIZE, packet discard... Insert err Scd SegPacket.PhyAddr=0x%x,LenByte=%d,IsLastSeg=%d RawLen = %d, Pts = %lld, Scd SegPacket.PhyAddr=0x%x,LenByte=%d,IsLastSeg=%d CheckSeg err SegFreeBufLen=%d,SrcEaten=%dInsert 2 err Scd SegPacket.PhyAddr=0x%x,LenByte=%d,IsLastSeg=%d CheckSeg 2 err Raw packet TOO BIG! can't copy to seg! Len: %#x copy raw to seg fail RawStreamNum=%d SegStreamNum=%d SegStreamSize=%d RawStreamSize=%d VFMW_RAW SM_CopyYuvToDnr fail long time(%d ms) not release stream seg, release anyway! raw_pts: %lld Get RawPhyAddr=0x%x,Len=%d !!!push raw err!!! Chan%d raw full ###################### SCD not ready ########################### NULL pointer: %s , L%d /home/pub/platform_h3/mpp/code/mkp/vedu/vfmw/firmware/common/syntax/h264.cpH264Ctx->pCurrNal->nal_bitoffset = %d; code_len_byte = %d; bitstream_length = %d; pH264Ctx->pCurrNal->nal_trail_zero_bit_num = %d stream[%d]: bitsoffset = %d; valid_bitlen = %d; bytespos = %x stream[%d]: bitsoffset = %d; valid_bitlen = %d nal_segment = %d is not expected value new pic flag = %d tmp slice pps id = %d PPSSPSCheckTmpId: pps with this pic_parameter_set_id = %d havn't decode PPSSPSCheckTmpId: seq_parameter_set_id out of range. PPSSPSCheckTmpId: sps with this pic_parameter_set_id = %d havn't decode slice pps id = %d pps with this pic_parameter_set_id = %d havn't decode sps with this pic_parameter_set_id = %d havn't decode list[%d][%d]: frame_num=%d, poc=%d L0: %d %dt %db L1:pH264Ctx->DPB.fs[%d]: frame_num=}?: %d poc=%d is_reference=%d pH264Ctx->DPB.fs_ref[%d]: frame_num=%d poc=%d is_reference=%d pH264Ctx->DPB.fs_ref[%d]: frame.poc=%d framestore %d allocate apc %d find APC, but logic_fs_id %d abnormal(ref=%d,plfs=%p, pdfs=%p) exg_pts: %lld <-> %lld frame %d, state=%d, is already output plfs(fs=%p, eFoState=%d) is null, logic_fs_id = %d not used frame: (%d,%d) frame skip: is_used=%d,skip=%d topfield skip bottom field skip err(%d) > out_thr(%d) H264 recycle image %-50s%50d DecPicTimingSEI but SPS is invalid. SEI: cpb_removal_delaySEI: dpb_output_delaypic_structsave pic yuv : structure = %d; idc = %d structure = %d pH264Ctx->CurrPic.pic_width_in_mb = %d pH264Ctx->CurrPic.pic_height_in_mb = %d NULL pointer: %s, L%d VFMW ** release streambuff=%08x bitstream_length=%d H264Dec destroy clear curr slice. END of the bit buffer, copy the first packet! 0:phy:0x%x, 1:phy:0x%x; len0:%d len1:%d 0:phy:0x%x, len0:%d nal_ref_idc=%d, structure=%d, image_id=%d, pmv_idc=%d logic frame id(=%d): get LogicFs error! phy fs is null: pstDecodeFs = %p, pstDispOutFs = %p for P slice size of list equal 0. for B slice size of two list all equal 0. init list error. L0: list after init. L0: list after reorder. partition fs memory fail! ERROR: FSP_ConfigInstance fail! stream frame packing type is %d! what can we do? FS_ALLOC_ERR, ClearAll Can not new logic fs! ClearAll clear all dec para cann't find FrameStore ========== H264 FrameStore state(is_used, is_in_dpb, IsOutDPB) ======== %02d: %d %d %d ReadImgNum = %d, NewImgNum = %d FrameStore leak, ClearAll -1 == VCTRL_GetChanIDByCtx() Err! InsertVO err:%d, ClearAll H264.c line %d: frame para err(ret=%d), recycle image self line: %d flush DPB failed! receive streambuff=0x%08x; phy_addr=0x%x; bitstream_length=%d nal_release_err cann't find slot for current nal receive a zero packet ----------------- Imode -> %d ------------------ ***** VDM start, TotalPicNum=%d,~<: pH264Ctx->CurrPic.structure=%d. line %d, get APC error, ret %d InserFrmInDPB: cur pic struct = %d! CurrPic.state is 'EMPTY' StorePicInDPB return(%d) from L%d line %d, return %d directoutput mode err(%d) > ref_thr(%d) marking return %d line %d: pH264Ctx->DPB.size = %d, ref %d, ltref %d store pic err, ret = %d imode nal store pic err, ret = %d imode nal flush dpb err, ret = %d GAP found while DPB is empty! frame num gap try to fill it CurrFrameNum = %d UnusedShortTermFrameNum = %d cann't allocate frame store when gap find allocate frame store when gap find line %d: store gap pic err, ret=%d line %d: flush dpb return %d line %d: init dpb return %d resolution error, the CAP_LEVEL_USER_DEFINE_WITH_OPTION channel with s32ReRangeEn == 0 can't support such bitstream. s32MaxRefFrameNum < pH264Ctx->DPB.size, the CAP_LEVEL_USER_DEFINE_WITH_OPTION channel can't support such bitstream. mem arrange err, ClearAll get back frm line %d: frame gap(=%d) > dpb size(=%d) frame num gap don't allowed but gap find line %d: find gap in NON-I slice but here gap is not allowed line %d: dec gap failed line %d: alloc framestore failed dec_pts: %lld dec_usertag: %lld %s %d NULL == pH264Ctx->CurrPic.frame_store!! : delta_sl SEI: frame_packing_arrangement_idSEI: frame_packing_arrangement_cancel_flagSEI: frame_packing_arrangement_typeSEI: quincunx_sampling_flagSEI: content_interpretation_typeSEI: spatial_flipping_flagSEI: frame0_flipped_flagSEI: field_views_flagSEI: current_frame_is_frame0_flagSEI: frame0_self_contained_flagSEI: frame1_self_contained_flagSEI: frame0_grid_position_xSEI: frame0_grid_position_ySEI: frame1_grid_position_xSEI: frame1_grid_position_ySEI: frame_packing_arrangement_reserved_byteSEI: frame_packing_arrangement_repetition_periodSEI: frame_packing_arrangement_extension_flagSEI nal dec payload type err SEI nal dec payloadSize err SEI_BUFFERING_PERIOD,offset = %d,payload_size = %d ):SEI_PIC_TIMING,offset = %d,payload_size = %d SEI_PAN_SCAN_RECT,offset = %d,payload_size = %d SEI_FILLER_PAYLOAD,offset = %d,payload_size = %d SEI_USER_DATA_UNREGISTERED,offset = %d,payload_size = %d cann't dec usrdata SEI_RECOVERY_POINT,offset = %d,payload_size = %d SEI_DEC_REF_PIC_MARKING_REPETITION,offset = %d,payload_size = %d SEI_SPARE_PIC,offset = %d,payload_size = %d SEI_SCENE_INFO,offset = %d,payload_size = %d SEI_SUB_SEQ_INFO,offset = %d,payload_size = %d SEI_SUB_SEQ_LAYER_CHARACTERISTICS,offset = %d,payload_size = %d SEI_SUB_SEQ_CHARACTERISTICS,offset = %d,payload_size = %d SEI_FULL_FRAME_FREEZE,offset = %d,payload_size = %d SEI_FULL_FRAME_FREEZE_RELEASE,offset = %d,payload_size = %d SEI_FULL_FRAME_SNAPSHOT,offset = %d,payload_size = %d SEI_PROGRESSIVE_REFINEMENT_SEGMENT_START,offset = %d,payload_size = %d SEI_PROGRESSIVE_REFINEMENT_SEGMENT_END,offset = %d,payload_size = %d SEI_MOTION_CONSTRAINED_SLICE_GROUP_SET,offset = %d,payload_size = %d SEI_FILM_GRAIN_CHARACTERISTICS,offset = %d,payload_size = %d SEI_DEBLOCKING_FILTER_DISPLAY_PREFERENCE,offset = %d,payload_size = %d SEI_STEREO_VIDEO_INFO,offset = %d,payload_size = %d too much usrdat, cann't dec SEI VUI: aspect_ratio_info_present_flagVUI: aspect_ratio_idcVUI: sar_widthVUI: sar_heightVUI: overscan_info_present_flagVUI: overscan_appropriate_flagVUI: video_signal_type_present_flagVUI: video_formatVUI: video_full_range_flagVUI: color_description_present_flagVUI: colour_primariesVUI: transfer_characteristicsVUI: matrix_coefficientsVUI: chroma_loc_info_present_flagVUI: chroma_sample_loc_type_top_fieldVUI: chroma_sample_loc_type_bottom_fieldVUI: timing_info_present_flagVUI: num_units_in_tickVUI: time_scaleVUI: fixed_frame_rate_flagVUI: nal_hrd_parameters_present_flagVUI: cpb_cnt_minus1VUI: bit_rate_scaleVUI: cpb_size_scalehrd->cpb_cnt_minus1 out of range VUI: bit_rate_value_minus1VUI: cpb_size_value_minus1VUI: cbr_flagVUI:): initial_cpb_removal_delay_length_minus1VUI: cpb_removal_delay_length_minus1VUI: dpb_output_delay_length_minus1VUI: time_offset_lengthVUI: vcl_hrd_parameters_present_flagVUI: low_delay_hrd_flagVUI: pic_struct_present_flagVUI: bitstream_restriction_flagVUI: motion_vectors_over_pic_boundaries_flagVUI: max_bytes_per_pic_denomVUI: max_bits_per_mb_denomVUI: log2_max_mv_length_horizontalVUI: log2_max_mv_length_verticalVUI: num_reorder_framesVUI: max_dec_frame_bufferingSPS: chroma_format_idcpSPS->chroma_format_idc out of range. SPS: bit_depth_luma_minus8bit_depth_luma_minus8 not equal 0. SPS: bit_depth_chroma_minus8SPS: qpprime_y_zero_trans_bypass_flagSPS: seq_scaling_matrix_present_flagSPS: seq_scaling_list_present_flagSPS: log2_max_frame_num_minus4pSPS->log2_max_frame_num_minus4 out of range. SPS: pic_order_cnt_typepSPS->pic_order_cnt_type out of range. SPS: log2_max_pic_order_cnt_lsb_minus4pSPS->log2_max_pic_order_cnt_lsb_minus4 out of range. SPS: delta_pic_order_always_zero_flagSPS: offset_for_non_ref_picSPS: offset_for_top_to_bottom_fieldSPS: num_ref_frames_in_pic_order_cnt_cyclepSPS->num_ref_frames_in_pic_order_cnt_cycle out of range. SPS: offset_for_ref_frame[i]SPS: num_ref_framesSPS: gaps_in_frame_num_value_allowed_flagSPS: pic_width_in_mbs_minus1pSPS->pic_width_in_mbs_minus1 out of range(=%d). SPS: pic_height_in_map_units_minus1SPS: frame_mbs_only_flagSPS: mb_adaptive_frame_field_flagpSPS->pic_height_in_map_units_minus1 out of range. pic size too large. level_idc %d not support. dpb size according level : %d pSPS->num_ref_frames(%d) > DPB size(%d), try to select the reasonable one. SPS: direct_8x8_inference_flagSPS: frame_cropping_flagSPS: frame_cropping_rect_left_offsetSPS: frame_cropping_rect_right_offsetSPS: frame_cropping_rect_top_offsetSPS: frame_cropping_rect_bottom_offsetSPS: vui_parameters_present_flagmax_dec_frame_buffering(%d) > MaxDpbSize(%d) SPS: profile_idcSPS:<: constrained_set0_flagSPS: constrained_set1_flagSPS: constrained_set2_flagSPS: constrained_set3_flagSPS: reserved_zero_4bitsSPS: level_idcSPS: seq_parameter_set_idseq_parameter_set_id out of range. Baseline stream, try to decode, exit when FMO occurred. EXTENDED stream, try to decode, exit when datapartition occurred. others High profile stream, try to decode, exit when high profile not support occurred. profile_idc = %5d error, try to decode as main profile. level_idc = %5d error, try to decode as level_idc %d. Line %d: SPS[%d] decode error. PPS: entropy_coding_mode_flagPPS: pic_order_present_flagPPS: num_slice_groups_minus1Baseline stream with FMO, not support. PPS: num_ref_idx_l0_active_minus1num_ref_idx_l0_active_minus1 out of range. PPS: num_ref_idx_l1_active_minus1num_ref_idx_l1_active_minus1 out of range. PPS: weighted prediction flagPPS: weighted_bipred_idcweighted_bipred_idc out of range PPS: pic_init_qp_minus26PPS: pic_init_qs_minus26PPS: chroma_qp_index_offsetPPS: deblocking_filter_control_present_flagPPS: constrained_intra_pred_flagPPS: redundant_pic_cnt_present_flagredundant pic not support when find redundant slice later, exit PPS: transform_8x8_mode_flagPPS: pic_scaling_matrix_present_flagPPS: pic_scaling_list_present_flagPPS: second_chroma_qp_index_offsetsecond_chroma_qp_index_offset out of range. PPS: pic_parameter_set_idpic_parameter_set_id out of range. PPS: seq_parameter_set_idSPS haven't decode. PPS decode error. SH: pic_parameter_set_idpps id:%d in sliceheader err PPS or SPS of this slice not valid recover point but isn't I_SLICE. SH: frame_numIDR NAL but frame_num!=0. SH: field_pic_flagSH: bottom_field_flagfield first_mb_in_slice bigger than pic size frame first_mb_in_slice bigger than pic size SH: idr_pic_ididr_pic_id bigger than 65535 SH: pic_order_cnt_lsbSH: delta_pic_order_cnt_bottomSH: delta_pic_order_cnt[0]SH: delta_pic_order_cnt[1]SH: ?: redundant_pic_cntredundant pic not support. first_mb_in_slice in currslice small than prevslice in same pic overflow MAX_MMCO_LEN SH: memory_management_control_operationSH: difference_of_pic_nums_minus1SH: long_term_pic_numSH: long_term_frame_idxSH: max_long_term_frame_idx_plus1mmco exceed 6 SH: no_output_of_prior_pics_flagSH: long_term_reference_flagIDR and no_output_of_prior_pics_flag = %d SH: adaptive_ref_pic_marking_mode_flagadaptive_ref_pic_marking_mode_flag = %d MMCO para would save dec err mulitislice diff no_out_of_prior_pics_flag, used first. mulitislice diff long_term_reference_flag, used first. mulitislice diff adaptive_ref_pic_marking_mode_flag, used first. TotalPicNum=%d, SliceNumInPic=%d, TotalNal=%d SH: luma_log2_weight_denomSH: chroma_log2_weight_denomWP log2 exceed and err flag = %d SH: luma_weight_flag_l0SH: luma_weight_l0SH: luma_offset_l0SH: chroma_weight_flag_l0SH: chroma_weight_l0SH: chroma_offset_l0SH: luma_weight_flag_l1SH: luma_weight_l1SH: luma_offset_l1SH: chroma_weight_flag_l1SH: chroma_weight_l1SH: chroma_offset_l1SH: ref_pic_list_reordering_flag_l0SH: reordering_of_pic_nums_idc_l0reorder idc l0 = %d, g_SeErrFlag=%d SH: abs_diff_pic_num_minus1_l0abs_diff_pic_num_minus1_l0 = %d, g_SeErrFlag=%d SH: long_term_pic_idx_l0num of idc l0 exceed SH: ref_pic_list_reordering_flag_l1SH: reordering_of_pic_nums_idc_l1reorder idc l1 = %d, g_SeErrFlag=%d SH: abs_diff_pic_num_minus1_l1abs_diff_pic_num_minus1_l1 = %d, g_SeErrFlag=%d SH: long_term_pic_idx_l1num of idc l1 exceed SH: direct_spatial_mv_pred_flagSH: num_ref_idx_override_flagSH: num_ref_idx_l0_active_minus1SH: num_ref_idx_l1_active_minus1frame num_ref_idx_lx_active_minus1 exceed field num_ref_idx_lx_active_minus1 exceed reordering para dec err apply_weights_flag=%d wpt dec err mark para dec err SH: cabac_init_idccabac_init_idc bigger than 3 SH: slice_qp_deltaSH: disable_debl*:ocking_filter_idcdisable_deblocking_filter_idc dec err SH: slice_alpha_c0_offset_div2slice_alpha_c0_offset_div2 dec err SH: slice_beta_offset_div2slice_beta_offset_div2 dec err Slice nal or IDR nal = %d sliceheader dec err Start Reason: SliceParaNum, MaxBytesReceived = %d, %d(thr=%d) Too many slice or bitstream, err! Start Reason: new_pic_flag init pic err, find next recover point or next valid sps, pps, or exit DecList error, ret=%d dec list err. SH: first_mb_in_sliceslicecheck first_mb_in_slice >= MAX_MB_NUM_IN_PIC error. SH: slice_typeslice type = %d slice type = %d, err pH264Ctx->TotalNal = %d, type:%d stop i want ***** NAL: IDR/Slice, nal_unit_type=%d, TotalSlice=%d ***** NAL: PPS, nal_unit_type=%d, TotalPPS=%d ***** NAL: SPS, nal_unit_type=%d, TotalSPS=%d SPS decode error. ***** NAL: SEI, nal_unit_type=%d ***** NAL: AUD, nal_unit_type=%d ***** NAL: EOSEQ, nal_unit_type=%d ***** NAL: FILL, nal_unit_type=%d ***** NAL: EOSTREAM, nal_unit_type=%d ***** NAL: SPSEXT, nal_unit_type=%d ***** NAL: AUX, nal_unit_type=%d ***** NAL: EOPIC, nal_unit_type=%d ***** NAL: UNSUPPORT, nal_unit_type=%d,nalu header:%x H264_DecOneNal ERR DNRHAL_NULL_FUN_RETURN,L%d L%d: %s can not map slice msg virtual address! chroma_lg = %d can not map down msg virtual address! VdhId is wrong! H264HAL_V200R001_StartDec picture width out of range point of picture para null point of fst slice para null vdm register virtual address not mapped, reset failed! VDMHAL_NULL_FUN_PRINT,L%d ***********************H264HAL_V200R001_StartDec is Now %d*********************** BASIC_V200R001_CFG0 = 0x%x BASIC_V200R001_CFG1 = 0x%x AVM_V200R001_ADDR = 0x%x VAM_V200R001_ADDR = 0x%x STREAM_V200R001_BASE_ADDR = 0x%x EMAR_ID = 0x%x YSTADDR_V200R001_1D = 0x%x YSTRIDE_V200R001_1D = 0x%x UVOFFSET_V200R001_1D = 0x%x PRCNUM_1D_CNT = 0x%x PRCMEM1_1D_CNT = 0x%x PRCMEM2_1D_CNT = 0x%x PPFD_V200R001_BUF_ADDR = 0x%x PPFD_V200R001_BUF_LEN = 0x%x 0: REF_V200R001_PIC_TYPE = 0x%x FF_V200R001_APT_EN = 0x%x pSlicePara = NULL! !!! no slice to dec, add up msg report.MPEG4 destroy NVOP VDM copy process................ pImg is null, pCurImg %#x pBwdImg %#x pFwdImg %#x FrameNum=%d vop_coding_type=%d err(%d) > out_thr(%d) CurFsID(fwd%d,%d,bwd%d) abnormal!(%p,%p,%p) MPEG4DEC Init ----- -1 == VCTRL_GetChanIDByCtx() Err! MPEG4DEC Init success ----- dec_pts: %lld Usertag: %lld get frame store fail! actual frame size(%dx%d) exeed max config(%dx%d) MPEG4 Frame_Init return err! MPEG4 Frame_Init PmvNum=%d, FrameNum=%d, error! partition fs memory fail! ERROR: FSP_ConfigInstance fail! warning! profile_and_level_indication=%#x, maybe HD pic... fatal stream error --- VOP marker_bit = 0 VDH doesn't support SPRITE_STATIC & SPRITE_GMC VDH doesn't support SPRITE_STATIC Unknown sprite_enable ERROR: not_8_bit !=0 not support no complexity_estimation_disable not support data_partitioned not support newpred_enable not support reduced_resolution_vop_eanble not support scalability fatal stream error --- GOP marker_bit = 0 vop ---%d VDH doesn't support S_VOP parse time_module_base stream not enough error: vop_coding_type = %d, but vop_fcode_forward = 0 error: B vop, but vop_fcode_backward = 0 module time base parse error, more than %d '1' was found! DivX%dBuild%d%cDivX%db%d%cFFmpe%*[^b]b%dFFmpeg v%d.%d.%d / libavcodec build: %dLavc%d.%d.%dffmpegXviD%dNot find start code VOS beginning ~ ! VO beginning ~ ! VOL beginning ~ ! GOP beginning ~ ! VOP beginning ~ ! BitUsed=%d SHVOP beginning ~ ! USERDATA beginning ~ ! MPEG4 Frame_Init return err 1! vop right MPEG4 Frame_Init return err 2! bits over boundary bitsream para error ----- MPEG4DEC Decode ----- ptr_strm_para->PhyAddr0=0x%x ptr_strm_para->Length0=%d ptr_strm_para->IsLastSeg0=%d ptr_strm_para->PhyAddr1=0x%x ptr_strm_para->Length1=%d ptr_strm_para->IsLastSeg1=%d ptr_strm_para->Length0 = %d %:byte0: = 0x%x byte1: = 0x%x byte2: = 0x%x byte3: = 0x%x Mp4_Frame_Atr return fail Frame req error--- dec P/S frame, fwd ref err > ref_thr(%d) dec B frame, bwd ref err > ref_thr(%d) dec B frame, fwd ref err > ref_thr(%d) NVOP mem move-- CurFsID(f%d,%d,b%d) abnormal!(%p,%p,%p) bits not enought configuring VDM registers... L%d: %s picture width out of rangeVDMHAL_NULL_FUN_PRINT,L%d BASIC_V200R001_CFG0=0x%x BASIC_V200R001_CFG1=0x%x AVM_V200R001_ADDR=0x%x VAM_V200R001_ADDR=0x%x STREAM_V200R001_BASE_ADDR=0x%x EMAR_ID=0x%x YSTADDR_V200R001_1D=0x%x YSTRIDE_V200R001_1D=0x%x UVOFFSET_V200R001_1D=0x%x PRCNUM_1D_CNT=0x%x PRCMEM1_1D_CNT=0x%x PRCMEM2_1D_CNT=0x%x DNR_MBINFO_STADDR=0x%x D0=0x%x D1=0x%x D2=0x%x D3=0x%x D4=0x%x D8=0x%x D9=0x%x D10=0x%x D11=0x%x D12= 0x%x D13= 0x%x D14= 0x%x D15= 0x%x D16= 0x%x D17= 0x%x D18= 0x%x D%d= 0x%x VDEC_InitWithOperationResetVoQueueMEM_Vir2PhyVCTRL_GetChanIDByCtxdprintInsertImgToVoQueueMEM_MapRegisterAddrKernelFlushCacheVFMW_set_dbgoptVCTRL_UnRegisterSoftDecoderVCTRL_RegisterSoftDecoderVDEC_ExitModuleVDEC_OpenModuleVDEC_ControlVDEC_ExitVDEC_InitDBG_AddTraceMEM_DelMemRecordMEM_AddMemRecordMEM_ReleaseMemBlockMEM_AllocMemBlockversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=extra_disp:intparmtype=extra_ref:intsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 ht ,/mnt `  @  @ 0`  @   @ @ @&:     % %* "   !!$!$&!$&(!$&(*    ! !#HSPICEND  (!  P!  @!c!@+ 7 )E???6J5h362N9>A1 ) vS>aVHNC>AZCh hI1 V2=_C- JJHP:QE7`VC:X^LE6XQ""(7 )E???6J5h362GA4O) ) vS>aVHGL4O$)9EeF2 E6 4ZB+FMHV=RE;`WK8dUJQ;_V( 7 )E???6J5h362U9f>3) cS>aVHUJ9f*%6a uI9]9,X77KO2a<gY9tT:?`jUK?eZ!@+ N-)`???6J5h363 ( ;N9>A1 ) vS>aVHNC>AZCh hI1 V2=_C- JJHP:QE7`VC:X^LE6XQ""(3 )P???6J5h361 6GA4O) ) vS>aVHGL4O$)9EeF2 E6 4ZB+FMHV=RE;`WK8dUJQ;_V( X")???6J5h362!=U9f>3) cS>aVHUJ9f*%6a uI9]9,X77KO2a3: <gY9tT:?`jUK?eZfJRk_rs{sz*G62:>H?[JW]GMD?>T=AB8=@N    % !->:=T]BO>G;<>KB:GOD     (,/D?hTC,'@.NDVM42,# -& ,.32>!- & * '-, 1 ) *"37 Y.>, ($ $,* > 0@ .#9 2M?^RmE ]FZ7\>VOaZHKGKE.A>H%69 H >#%&&&%#*0'<%aD JLKFAD>ID>7 KF @#"""$# ' ""B'K+"76@=\DpxUrY\QGDP8F2DJ1(-,6!",RajZZIXVOFIBE:@; $#Cb~Ce^RnSf[]Y\l`,L4-;@KFfRNUMK262DQ*F?9CL( 1,,./3>'6.:6?jjrWbnjnkgpl_`[     '")*&.A.]9M0*;7SGwW@# # = $  I]. Id1 9345- 75$7R.NT^]C VUP<F=: 22 615-A0'+ 9KR}a\J~W:&$7+@:ZJ55 =5889E3'D "  "%F.) 13) 47/, ) 52?1 @ "! ,)A/G<6E;F*:;QHa=@? ;CC ;EF?<AD0XE: ( F:UO'24,<0 ;;,!N+E < #&)+; ? ^@ lY , 5+ & "( 4, 2 &+9   (*59V =#B-*80>AB? '!-)- 1;$QUQMIPSJCGB=;B;!.'<3"7=>*[Q`fbwancf3: YP\^Gp5=MBTPW[g\YWLinpNc -! 4#"& 'f8|~~ni|uyufztd__!%!*'-/)1 A'T'e=5MKk[zoNBHG7;KFwY K !3%4'CE , 7$roPYURHQC@E8 EE?EMB46$)(%A 7 hI[,L94H:EEVJ=6<:C=JT4A=9FE7"!&$"&"#% #)CE@MC=9@BA3 >GBK'%&(*.1((&.&,87=7"B 74ICY:G=HKMHF<1 0 -D5XJ4 %I=NF) + ,/ .3B&* &Y" ##*--B6I 8tC /%% #) ) ) 0;) (22B!*"2'6F S GG*$94A?RCQUQMIPSJCGB=;B; 1*@5B D9/LQNHDHLF>B=96<: 1*@5B D9/[T_YV[gLZLP NTRs5>U;^Y\XVHRHCEYB;G9:GJ*' "%(*+ !/$ :7<xuruvvq|xf^c)%0*.'.4+4 =7S9dGCUMhXbE,3>*/5)NL4 SZC, ,0*481 % 0 :E- ?!j9\^VM[IGQ@9@8=Q>#-"'-&O6hO[0RB=KFSOl\HCPK@S@K ^J?#[ !# "'4!$"IDCDC@MND;76A<,F%$ %""#)!/$>OA\HEO:KN:QScEAM",VLF $D8bG&Q:>I;VLWS>BQDJ|B,%2$$ ]*98&F@87 AE6JL6MR*M*)4<N<5{=8%G1,;8C?ODJNHHGKF?HK5C4;D ! !&%@JNHHGKF?HK5C4;D ! !&%@>~&:    hi3521_vfmwA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilico%:n_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.rodata.str1.4__ksymtab_strings.modinfo.rel__param.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4 1x)D% H8`<4 H8C$Z$V HPdhl2`\{+`--  (J0 .  XJP,H$ JPIPIpPI/IL D J P  VD \| b h o v }     $ < L  \      0 < H T  d t    % , 3 : A H ! O ! V ,! ] L! d 2 E 8. L P2 S / Z ,/ a $3 h 2 o t. v . } 01 1 0 0 0 0 d/ |/ / P0 0 3 3 x3 3 L3 lt 3   H4 x4 \d|hl\6 5 6 5 7 %l7 ,,6 3H7 :5 A 7 H4 O5 Vl6 ]6 dL5 k6 r5 y7 d8 8 8 H8      4 H h  t  B Z L6L@ EX@)jtuvw 'd> & &O> , J> 6x> <*@*;> Tp? E$? Z8? @? H/L/z? _? |33? @ @ <@ \7`7X@      = TTX #;x8|@ "@ '@ 6@ O@ ;A Z\A J@ E\P DP PpQ JQ VQ \Q hQ bQ oR $S 4S R R S }R vDR TS S S سܳS 0T T T dT , DT ,0T T T T  T  n }    @I Ȧ  " "PU 8U 'U 6 V O`V JV ;V @V ThW EV Z0W _W X zW 8X |X dX pX xX hX \X X X X (Y HY Y 8Z Y Z Y Y \Z HZ tZ Z Z Z Z Z Z $[ [ [ [ [ *\ 04\ 6`\ ,<3\3<x\ H\ B\ N] T: 8] Zd] $x] `] l] f] M Mr] x ^ ~8^ X^ l^ ^ ^ ^ _  _ `_ D_ _ _ _ ` 4` ` L` ` ` (a a La `a  a a ta a &b a 2Xb 8xb Db Jb ,8b >b old P c Te de }d d hPd e 0e V@c xe v|d \`c bc TXe  e e , g  f 0f Lf pf f f f f g  $g @g  \g  xg  g % g Lk dm y j l H h ,m k  0j O h k l r i 3 (h j `j l k d 8i k i j Xl A hh V i : Hh ] ti m m  $n / n D ho ` o n o g p u p Tp pp p p p p q 0q pq q :Xq q q r r @r dr |r m m m K o R o Y o 6 o = :   0 L  ~ Ѐ , T Hx O d ́  L ,t :܁  r ] k4 Ax V  3 y  4 H  d :| %ă A H O VԄ ] d k rD y    < ܆    ` h   |  ܈  < $ 4  0  H !\ (ć /P 6t = D K R\ Y `x g nЉ u |X p   Ԋ    @  D   |  8  \  Ќ 4 ܋ P P  , 8U ;`I<T,d 6 " ' Oč J ,_Ď z 8 T p :   ܏   0 H `     Zp T ; @4 EP ܐ @0D0,Wd c`033 "( 6 O J 'P , p@t@; @ Z, E TL _l ؒ  ( z  pMtML     8   Д h  WWLZ\Z  $ Е @  l  ( 8 ` p x    Z  *Ԗ 0 6 < B  Td NX H8 ` f̗ l r x( ~H d    Ę Ԙ    $ h Й  @    r| hv OH Jd ; @ E: ZК T _ z 4 H ` x     ̛ ؛       , 8 D P 6,  " '       B t t#  !   >dQ|DGgT!+=8X[0kU/`eXa 'H,8h(b$D06P!(G R0b\ pH\<|l( p`(`|yDh0# -"J^'D}x\}DLHPxdd(tX J@$l0TPD<QR3]Hjv04h4h(ܰD`T$|`5>HxSf$tx9PTlt@ t@* DApP ~(\I$3"ATZXXw|6P:T\L0! T * W<9Hd9Tx@8  \x8-T<t/XGdUcImTw<,8$ A$' Hܳ||{0 @ ~t! 1 up= I 8Ha ;v  b  H0 <T  b c  !!*!YxA!  J!tMY!hb!6$w!p!!X\!$X!=(!`7D!pG!p!3  " "H*"97": &(K"<W"Xu"x^"!$"D $""TI\"L9,"T0" #U #2,#x9#XF#pY#Lj#X |#sP#P#P #0##ؖ#x#aX$0$< *$`S@$P$/tW$ d$r$()$$x$$$A$ w$pU$l;%D%p"%H7%G%LV%$|i%~x% %%h\%%؜%8%%\|%%&,/,&{*&!,;&GH&WV&hg&`{&4(4&&pc<&&&vH&&4"8' '5d*'SE'`0Q'>]'m'D*x'̈L'''4T'D'Э'8'*'p2'|z (N%(Wh<({LO(c|[(Ohr( (X(4H(v(T((h((L/8 ):)P2 0)$64A),0R)H*])Yll)D]4z))P)@)))))*~*H%*R`C*V*0pc*hnw*P*bd*: *4*te*`L*T*}4+(+$X+07*+_;+`DK+ІU+ a+hipp+ |(+T ++h+0+x++(+tNT ,GX,4|d,/7,CLG,d\,:`r,p,d,K,$,,4, o,",| -@  -L+-0<-,I-c$a-$Ts-XP -X -t-$--0E-L --l ...f%.(0.,2?.x Q. $ `.t..Q.0...dB..E.. /,YP)/4/`vPC/tY/8m/@ |/`(/`/FT//|$d/p@/,04%04<04T0 g0P1n0( 00000DT0 T00t@008(1< 1l 1trx01{(A1?Q1||h1\y1i1*1ܶ41|1D19D1q1,P1N 22 Q52TT>2G2et\2pp2Xd28@2L2r2$2D%27h2:x3!3܁53@z<?3V]3d3r3Db33ВP3xh3{D343d3t3 4l424d*0C4\$U4hg]4&t444T4#L48)4p(4 &44@5L55l)5$l>5J5`5v5u55"5Xk5t58556l 636 w 16>644[6`<8l6 z6$6E`6 66p66=66t%p7Ȧ< 7\ 7\K07@)>7U7\7 ,g7|7ȿP77L71x7$787<787?7> @*>7>8A>[LP> `>L#lq>pP,>>X>H(>@*>>>*>L$>kT?,"?Q;? J?(c$]?Hn?`+|~?}L??0?D?<?[|??@0?8X@H@~+@h@@@Lc$X@h@ w@@Hf@Ī@(@$@y@ؿA3A|*A2A$CBApLAiXUA4xdA3uA(FAH@AA4A=$AA(ZXB@BBФ)BtL3B|EMEuhgEwETEDEapE(xEE,xEE$\EOFT)F0Fx:Fd$a.LANCHOR0.LC0$d__key.26620.LC1.LC2.LANCHOR1.LC3.LC6.LC7.LC8.LC5.LC4.LC10.LC9.LC11__kstrtab_VDEC_InitWithOperation__kstrtab_ResetVoQueue__kstrtab_MEM_Vir2Phy__kstrtab_VCTRL_GetChanIDByCtx__kstrtab_dprint__kstrtab_InsertImgToVoQueue__kstrtab_MEM_MapRegisterAddr__kstrtab_KernelFlushCache__kstrtab_VFMW_set_dbgopt__kstrtab_VCTRL_UnRegisterSoftDecoder__kstrtab_VCTRL_RegisterSoftDecoder__kstrtab_VDEC_ExitModule__kstrtab_VDEC_OpenModule__kstrtab_VDEC_Control__kstrtab_VDEC_Exit__kstrtab_VDEC_Init__ksymtab_VCTRL_RegisterSoftDecoder__ksymtab_VCTRL_GetChanIDByCtx__ksymtab_MEM_MapRegisterAddr__ksymtab_VFMW_set_dbgopt__ksymtab_VDEC_InitWithOperation__ksymtab_VDEC_ExitModule__ksymtab_InsertImgToVoQueue__ksymtab_VDEC_Control__ksymtab_VDEC_Init__ksymtab_VCTRL_UnRegisterSoftDecoder__ksymtab_ResetVoQueue__ksymtab_VDEC_Exit__ksymtab_MEM_Vir2Phy__ksymtab_KernelFlushCache__ksymtab_dprint__ksymtab_VDEC_OpenModuleVIDEOFirmWare_GetVerMagicVIDEOFirmWare_ModExtVIDEOFirmWare_ModInit__mod_version130__mod_license129__mod_author128s_stModules_stExportFuncs__func__.21080__func__.21020__func__.20996.LC12.LC15.LC13.LC14.LANCHOR2.LC16.LC17.LC18.LC20.LC19__func__.28738__func__.28935__func__.27566__func__.28861__func__.28797__func__.28769__func__.28773__func__.28762__:func__.28561__func__.28490CalcZeroNum__kstrtab_DBG_AddTrace__ksymtab_DBG_AddTrace__kstrtab_MEM_DelMemRecord__kstrtab_MEM_AddMemRecord__kstrtab_MEM_ReleaseMemBlock__kstrtab_MEM_AllocMemBlock__ksymtab_MEM_ReleaseMemBlock__ksymtab_MEM_AddMemRecord__ksymtab_MEM_DelMemRecords_MemOffsets_MemBaseAddrs_MemSize__ksymtab_MEM_AllocMemBlock.LC21.LC23.LC22.LC25.LC24.LC26.LC27.LC28.LC29.LC34.LC33.LC32.LC31.LC30.LC35.LC36.LC37.LC38.LC39.LC40.LC41.LC42.LC43.LC44.LC45.LC55.LC46.LC47.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC56.LC57.LC58.LC59.LC60.LC61.LC62.LC67.LC63.LC64.LC65.LC66.LC68.LC69.LC70.LC71.LC72.LC73.LC74.LC75.LC76.LC77.LC78.LC79.LC80.LC81.LC82.LC84.LC83.LC85.LC86.LC87.LC88.LC89.LC90.LC91.LC92.LC93.LC94.LC95.LC96.LC97.LC98.LC99.LC100.LC101.LC102.LC103.LC104.LC105.LC106.LC107.LC108.LC109.LC110.LC112.LC111.LC113.LC114.LC115.LC116.LC117.LC118.LC119.LC120.LC121.LC122.LC123.LC124.LC125.LC126.LC127.LC128.LC129.LC130.LC131.LC132.LC133.LC134.LC136.LC135.LC137.LC138.LC139.LC141.LC142.LC143.LC144.LC145.LC146.LC147.LC148.LC149.LC150.LC151.LC152.LC153.LC154.LC155.LC156.LC157.LC158.LC159.LC160.LC161.LC162.LC163.LC165.LC166.LC167.LC168.LC169.LC170.LC171.LC172.LC173.LC174.LC176.LC175.LC177.LC178.LC179.LC180.LC181.LC182.LC183.LC184.LC185.LC186.LC187.LC188.LC189.LC190.LC191.LC192.LC196.LC194.LC193.LC195.LC164.LC140.LC197.LC198.LC199.LC200.LC201.LC202.LC203.LC208.LC209.LC206.LC204.LC210.LC205.LC207.LC212.LC211.LC215.LC214.LC213.LC216.LC217.LC219.LC218.LC224.LC225.LANCHOR3.LC223.LC222.LC221.LC220.LC226.LC228.LC229.LC230.LC227.LC231.LANCHOR4.LC233.LC232.LC234.LC235.LC237.LC240.LC238.LC236.LC239.LC241.LC242.LC243.LC244.LC245.LC246.LC249.LC247.LC248.LC250.LC251.LC252.LC253.LC254.LC255.LC282.LC283.LC284.LC285.LC286.LC258.LC256.LC290.LC265.LC279.LC280.LC263.LC277.LC288.LC262.LC260.LC2 : 91.LC273.LC289.LC257.LC287.LC269.LC264.LC293.LC292.LC259.LC261.LC278.LC281.LC270.LC271.LC274.LC275.LC266.LC267.LC268.LC272.LC276.LC297.LC298.LC295.LC296.LC294.LC299.LC300.LC301.LC311.LC307.LC309.LC305.LC318.LC317.LC310.LC316.LC306.LC315.LC302.LC303.LC312.LC313.LC304.LC314.LC308.LC319.LC321.LC322.LC323.LC320__func__.30940__func__.29836__func__.29774__func__.29014__param_str_extra_disp__param_str_extra_ref__mod_extra_disptype5854__mod_extra_reftype5853s_VfmwSavePath__param_extra_disp__param_extra_reflast_rec_pos_time.30934last_rec_pos_decparam_time.30935ChanPriTab.30823s_VfmwCTrllast_rec_pos_time.29833last_rec_pos_time.29771PrioArray.29473FspInstInfo.29007LastEventTime.28752save_file_cnt.31281save_file_cnt.31284save_file_cnt.31287buf.31982str.31983Capability.29637PrioArray.29636__func__.27350__func__.27448__func__.27684__func__.27589s_eVdmDrvSleepStates_VdmIsInISRlast_rec_pos_time.27344last_rec_pos_time.27445last_rec_pos_time.27682cycle.27681__func__.28415last_rec_pos_time.28406__func__.29366__func__.29478__func__.29217s_eScdDrvSleepStages_SCDInISRpScdResetReg.27459LastEventTime.28592s_RegPhyBaseAddrlast_rec_pos_time.29362last_rec_pos_time.29477last_rec_pos_time.29212.LC324.LC325.LC326.LC327.LC328.LC329.LC330.LC331.LC332.LC336.LC334.LC335.LC338.LC339.LC343.LC344.LC341.LC342.LC340.LC333.LC337.LC352.LC357.LC358.LC360.LC362.LC363.LC353.LC354.LC345.LC346.LC349.LC355.LC356.LC350.LC347.LC348.LC361.LC359.LC351.LC364.LC368.LC365.LC366.LC367.LC369.LC370.LC371.LC372.LC373.LC374.LC375.LC376.LC377.LC390.LC391.LC379.LC383.LC381.LC380.LC384.LC385.LC387.LC386.LC388.LC389.LC378.LC382.LC392SarTable.34429__func__.32025sps_tmp.34856pps_tmp.33832TotalPicNumStartCnt.27688cnt.28365MemArrange.29926__mod_srcversion23__module_depends__mod_vermagic5MPEG4DEC_GetRemainImgPostPro_SetDecReportFSP_GetPmvAddrIMGQUE_DeleteFieldVCTRL_GetChanVoQuefilp_openKernelReg: isterMapVDMHAL_V200R001_StartHwDecodeMP4_GetGMCparamVDMHAL_V200R001_MaskIntVDEC_DRV_VeduCapsMp4_GetUserDataBuffree_irqGetUsdVDEC_DRV_MakeFrameNodeH264_GetPicStreamSizeMp4_Get_DecModeFS_ClearFsPoolVCTRL_GetStreamInterfaceH264HAL_V200R001_InitHalVDMDRV_IsChanDecProcessSPSReadScdStateRegStorePicInDPBUnMarkLTRefCapItemWriteCurrPicYUVH264DEC_InitOSAL_WriteFileMp4_Syntax_VopVCTRL_StopVfmwReleaseRawStreamDatavsprintfklib_freadOSAL_TellFilePosGetRawStreamNumIsLTRefFlgg_ZZ_SCANVDMDRV_AvsFirstFldNeedRepairdec_ref_pic_markingH264HAL_V200R001_CutSliceChainFSP_GetDecFsAddrTabSetInstModeBs_Get_MatrixScdReturnSegFilterref_pic_list_reorderingVCTRL_IsChanSegEnoughVCTRL_SetSendStreamAgainFlagVDMHAL_V200R001_ArrangeMemOpenDriversVCTRL_InformVdmFreeg_pDbgMemVirVCTRL_GetChanMemSizeByResolutionCMPI_RegisterModg_TaskIrqLockVDEC_DRV_Destroyvfmw_save_str_fileFSP_PrintContextReceivePacketPostPro_GetVc1MbGroupg_StructTransVDMHAL_V200R001_CloseHALVDMDRV_AvsSecondFldNeedRepairOpenUsdPoolVDEC_DRV_GetDrvChnId__this_modulememmoveExitSliceScdDriverVDMDRV_WaitVdmReadyIfNoIsrsnprintfg_VdecIrqHandleOSAL_UnLockIRQvfmw_save_yuv_filePrintScdVtrlRegg_eVdmVersionVCTRL_IsChanActiveFSP_SetStoreTypeFSP_IsNewFsAvalibleUnMarkLTFldByFrmIdxKernelRegisterUnMapcompare_pic_by_pic_num_descGetBytesg_ZZ_SCAN8default_inter_matrixue_vVDEC_DRV_WriteCloseUsdPoolDeleteRawPacketPostPro_CopyYuvGetAPC__arm_ioremapSCD_OpenHardwareFS_SetErrLevelIsNewPicg_VdmDrvParamVDMHAL_V200R001_MakeDecReportUpdateCurrFrameInfoBsLongSkipScaling_ListMP4HAL_V200R001_Log2bincompare_pic_by_lt_pic_num_asccompare_pic_by_poc_ascVDEC_DRV_ReportErrRateGetVdecCapabilitySM_CopyRawToSegSM_Resetg_RepairParamReleaseStreamSegfinish_waitProcessScdReturng_TmpMsg__iounmapProcessPPSvfmw_save_seg_fileOSAL_SpinLockVDMHAL_V200R001_IsVdmRunGet_V200R001_VirAddrSYNTAX_ReleaseImageg_chipIDInitDPBSM_DoNextInstanceVDMDRV_AfterDecMEM_MapRegisterAddrOSAL_CreateTaskPrintScdInputRawAfterStartFrame_InitV:DEC_DRV_ReadVDMHAL_V200R001_CheckIntVDMHAL_V200R001_WriteMsgSlotVCTRL_ExtraWakeUpThreadSM_GetInfoqsortVDMHAL_V200R001_Write1DYuvVDMHAL_V200R001_PrepareDecVDMDRV_GetSleepStageVCTRL_RunProcesscleanup_moduleg_ResetCreateNewSaveVDMHAL_V200R001_ResetVdmFS_GetTotalNumProcessSliceHeaderFirstPartVDMHAL_V200R001_IsVdmReadyDecVDMPassBytesprepare_to_waitGetLongTermPicPointMarkingvfmw_read_procmemcpymem_freeCMPI_MmzMallocSCDDRV_EnableIntVDMHAL_V200R001_OpenHALVDMHAL_V200R001_MakeRpMsgg_event_reportZerosMS_32FS_InitFsPoolTracerPhyAddrprint_queg_ChanCtxIsSTRefFlgg_DbgMemPhyHaveSliceToDecMEM_UnmapRegisterAddrVDEC_TypeSelg_PrintEnableVIDEOFirmWare_InitShowNextRawPacketGetFreshSegStreamReorderRefPiclistGetSegPtsOSAL_SpinUnLockGetRawStateg_DecReportMPEG4DEC_GetImageBufferMPEG4DEC_VDMPostProcVDEC_AcceleratorCharacterFreeUsdByDecsave_str_chan_numH264_FlushDecoderDBG_DestroyTracer__wake_upMarkUsdByDnrIsImageInVoQueuesave_seg_chan_numhi_sched_clockOSAL_SeekFileMp4_Syntax_ShortHeaderFSP_InitMp4_Syntax_VosSM_StartCHECK_REC_POS_ENABLEVDEC_DRV_ResumeSchelhi_sched_setschedulerMp4_Syntax_Gopu_1MEM_ManagerWithOperationVDMDRV_WakeUpVdmLockImgQueVCTRL_MaskAllIntBsIsByteAlignedgstExtraAccvfmw_read_proc_scdVdm_Mem_MoveVDEC_HAL_GetVSWSizeinit_moduleVDMDRV_AdjustPriorityAfterDecbs_get_spritetrajectoryVDMDRV_ClearChanIsDecCalcStreamBitswake_up_processIMGQUE_DeleteImageVDMHAL_V200R001_GetCharacterBsGetcreate_proc_entryPostPro_GetVp6MbGroupBsResidBitsFSP_IsFsLeakSM_ClearInstInsertImgToVoQueueKernelFlushCacheg_ListStructFrameVCTRL_GetSendStreamAgainFlagFindNaluArraySlotInitPicGetReRangeFlagVCTRL_GetChanCfgVCTRL_GetDecParamsprite_trajectory_lenInitUsdPoolInsertRawPacketFSP_EnableInstancePostPro_GetAvsMbGroupVDEC_ExitModuleBsInitDeleteRawLenVCTRL_Scd_Isrg_RecordLockschedule_timeoutCloseDriversSM_Wakeupg_astModulesMEM_AllocMemBlockMP4HAL_V200R001_InitHalVDMHAL_V200R001_EnableIntDBG_AddTraceFSP_GetLogicFsReorderLTListOSAL_MapRegisterAd:drVCTRL_StartVfmwg_SpinLock_fspVDMDRV_StartRepairSM_ScdPhyToVirg_pMemPrintg_pSmIISVDM_OpenHardwareOSAL_WaitEventVCTRL_GetChanStateDBG_PrintTracerquant_orgklib_fwriteIsOutDPBFSP_GetDecodeFrameTableCombinePacketSCDDRV_GetSleepStageVDMDRV_IsVdmIdleUnLockImgQueMp4_Syntax_VoCutStreamWithSCDquant_inter_defaultVDEC_DRV_ReadRegOSAL_AcrtUsSleepVCTRL_CmpConfigParameterg_SpinLockIsrSM_GiveThreadEventChanCtx_InitSPSEqualVDMDRV_H264NeedMoreStartOSAL_AllocMemoryBsSkipWithoutCountVDMHAL_V200R001_BackupInfoH264_DecPPSMEM_Vir2Phyvfmw_write_procextra_dispVCTRL_EnableAllIntVCTRL_GetUsrdecFrameVCTRL_SuspendVDEC_DRV_InitFSP_GetFsImagePtrVCTRL_PostProcdprintClearCurrPicBsToNextByteGetFreeSegBufVDMHAL_V200R001_CfgRpRegPostPro_GetMp24MbGroupvfmw_read_proc_dbgInitVoQueueRemoveFrameStoreOutDPBFrameStoreRefFlgOutputFrmFromDPBInsertStreamSegGetRawNumOffsertPostPro_GetVp8MbGroupGetMinPOCFSP_GetInstInfoReadRawStreamDataVDMDRV_VdmIntServProcDBG_GetTracerInfoBsBitsToNextByteBsGetNextBytePtrVDEC_DRV_MakeRegg_SdecFuncSimpleSlideDPBNextStartCode__aeabi_idivquant_intra_defaultMEM_ReleaseMemBlockFSP_ResetInstances_pstTracerH264Hal_V200R001_OnlineDnrOSAL_SpinUnLockIRQPrintSmInfoPrintScdSegStateVCTRL_ResumeVDMHAL_V200R001_PrepareRepairVIDEOFirmWare_ExitDirectOutputSYNTAX_ReceiveImageOSAL_GetTimeInMsMarkCurrPicLTrequest_threaded_irqcompare_pic_by_poc_descReleasePacketGetQueueImgNumVCTRL_VdmPostProcCheckScdStateRegKernelMmapCacheu_vMp4SearchStartCodeProduceTimeStampFSP_GetDecPhyFsSave2DYuvscan_tablesvfmw_proc_exitSCDDRV_ForeceSleepklib_fcloseVCTRL_PutUsrdecFrameVCTRL_ExtAccPostProcessUpdatePicQpInfInsertFrmInDPBg_LogEnableOSAL_GiveEventMp4_Syntax_VolIMGQUE_GetImageNumSM_StopWrite_V200R001_CabacTabMEM_CopyPhy2PhyAcceleratorCharacterMPEG4DEC_RecycleImageOSAL_ReadFileIsNewpicSegH264_ArrangeVahbMemVCTRL_OpenVfmwg_CabacMNVFMW_set_dbgoptVCTRL_GetChanMemSizeWithOptionVDMDRV_IsVp6NvopCopyKernelMemMallocvfmw_read_proc_decs_pFspInstOSAL_Spin : LockIRQGetStreamSegVCTRL_GetFrameInterfacepred_weight_tablePostPro_BubbleSortg_IntEventSM_CloseSCDDrvg_TraceFramePeriodPrintScdStateRegMEM_DelMemRecordOSAL_LockIRQstrncpyVCTRL_CreateChanWithOptionklib_fopenDecChanSyntaxSegManReleaseNALFindTrailZerosg_ListStructFieldFSP_NewLogicFsFS_CreateFrameStoreCalcInstBlockTimePostPro_GetDivx3MbGroupIsRefListWrongInitSyntaxCtxPPSSPSCheckMEM_CopyVir2PhyCMPI_UnRegisterModMPEG4DEC_InitpanicLongTermRefFlgVDMHAL_V200R001_ReadMsgSlotmem_mallocGetFirstOffsetFSP_ClearNotInVoQueueMp4_RecordVFMWStateMp4_Set_DecParVCTRL_UnRegisterSoftDecodervui_parametersMEM_InitMemManagerVDEC_OpenModuleH264HAL_V200R001_SetPicMsgquant8_intra_defaultUpdateReflistcompare_fs_by_frame_num_desccompare_fs_by_poc_descH264_DecFramePackingSEIVCTRL_SetDbgOptionBsSkipResetRawStreamArrayOSAL_InitTaskMutexStopPicNumsscanfprintkSM_CopyYuvToDnrAllocFrameStoreGlobal_Data_InitFSP_GetDecodePmvTableH264_DecSEIg_TraceCtrlFSP_DisableInstaceVCTRL_GetVidStdGetSegStreamSizeMEM_ReadPhyWordWrite_V200R001_QmatrixSCDDRV_ExitSleepMp4_Syntax_ParseClearAllNalVCTRL_PartitionMemForStdUserDumpListFSP_GetDispPhyFsInitListXVCTRL_GetChanMemInfoFSP_GetDisplayIMGQUE_InitQueueOSAL_InitSpinLockRemoveUnUsedFrameStoreClearDPBPPSEqualVCTRL_GetChanIDByCtxH264DEC_VDMPostProcShowFirstRawPacketVDMHAL_V200R001_StartHwRepairIMGQUE_InsertImageRefreshDecCoreVCTRL_UnInstallChanH264_DecPicTimingSEIVDMDRV_ForeceSleepFSP_GetStoreTypeg_VfmwEnableFlagVCTRL_GetStreamSizeGetSegBufVDMHAL_V200R001_ClearIntStatememsetH264_DecSlicePostPro_GetErrRatio__memzeroDeleteLastSendRawFSP_ClearLogicFsSCDDRV_PrepareSleepcompare_fs_by_poc_ascOSAL_GetTimeInUsVCTRL_ResetChanH264GetDarOSAL_LockTaskMutexVDEC_DRV_SetVfmwChnIdg_VfmwGlobalStatg_dnr_hal_fun_ptrstr2valVDEC_DRV_NeedFrameNode__aeabi_uidivg_DnrSleepTimeResetStreamSegArrayVDMDRV_IsMpeg4NvopCopyg_SpinLockIsr_DnrImageVDEC_SuspendVDMDRV_ActivateVDHg_PrintDeviceUpdateLTReflistHI_LOGOSAL_AllocVirMemVCTRL_GetCh:anMemSizeH264_DecSPS__init_waitqueue_headVCTRL_FreeChanResouceg_VdmCharacterg_SpinLockIrq_DestroyVDMDRV_IsVc1SkpicCopyGetNextDecodeModeFillRawDataFS_MarkReferenceCalcPicNumquant8_inter_defaultg_SleepTimeWritePicMsgMP4HAL_V200R001_StartDecCMPI_MmzFreecompare_fs_by_lt_pic_idx_ascDBG_CreateTracerWriteSliceMsgOSAL_InitEventMp4_RecordFrameAtrVCTRL_FlushDecoderstrcmpFSP_GetPmvAddrTabFSP_SetRefMEM_Phy2VirFSP_RemovePmvVDMDRV_PrepareSleeps_SmIISOSAL_UnmapRegisterAddrIMGQUE_GetImages_pstVfmwChankthread_create_on_nodeDecGapGetPicNumXConfigStreamSegArraySM_PushRawsave_yuv_chan_numGetImageParaBsBacks_MemRecordMarkPicLTRefShortTermRefFlgFindLeastTickPhyFsMp4_Syntax_InitUnMarkFrameStoreRefBsNextBitsByteAlignedMPEG4DEC_Destroysprintfg_TraceImgPeriodVDMDRV_ResetPostPro_GetH264MbGroupWriteScdVtrlRegPPSSPSCheckTmpIdVCTRL_StopChanPostPro_SetFullRepairOSAL_DeleteTaskSM_SCDIntServeProcFindZeroBitsInSegResetVoQueueReorderSTListMarkSTToLTRefOSAL_FreeVirMemPrintScdRawStateVCTRL_DestroyChanWithOptionvfreeClearCurrSliceMPEG4DEC_DecodeSetFirstOffsetKernelMmapVCTRL_ExtAccGetDecParamBsShowUnMarkSTRefFSP_EmptyInstanceVDMHAL_V200R001_MakeRpRegBPD_OpenHardwareVCTRL_ReleaseChanImagevfmw_read_proc_chnGetInstIDByRawArrayReorderListXTmpBufSliceCheckPostPro_GetRepairParamse_vOSAL_OpenFileMP4_SetImgFormatMp4_Syntax_UserDataIDRMemMarkingIsDprintTypeEnableVDEC_ControlGetSegStreamNumg_LogFileNameFS_MarkDisplayfilp_closeDecPOCVDMDRV_H264FinishedMultiStartUnMarkUsdByDnrClearCurrNalgastVDEC_DrvCtxGetRawStreamNumInBufferdefault_intra_matrixVDEC_DRV_ReadSedPerformremove_proc_entryVDEC_DRV_QueryOneTaskNoPicOutVCTRL_GetChanImageFindNearestPOCPicIdg_vdm_hal_fun_ptrwait_voSM_OpenSCDDrvPicTypeStatisticFSP_GetRefInquireSlicePropertyGet_V200R001_PhyAddrg_DnrEnableVDMDRV_InitVCTRL_IsChanDecableVCTRL_ConfigChanFS_GetImagePtrGetRawStreamSizeVDEC_FuncInitMp4_ClearUsrDataDecListg_SliceTypeForSEDFSP_ConfigInstance__aeabi_uidivmodGetTrailingOneLenM: peg4SegMang_BackUpWriteScdMsgFlushDPBH264HAL_V200R001_StartDecOSAL_CloseFileVDEC_DRV_CloseVCTRL_DestroyChanVDEC_DRV_CreateVCTRL_CloseVfmwMEM_WritePhyWordDecodeStreamFSP_GetLogicIdByPhyAddrUnMarkLTFrmByFrmIdxInitOldSliceExchangePtsPrintDownMsgVDEC_ExitUnMarkAllSTRefVCTRL_StartChanVDMDRV_ExitSleepg_AspecRatioIdcOSAL_UnlockTaskMutexSM_ReleaseStreamSegVDEC_Resumeextra_refg_SpinLockForeceReleaseg_CurProcChanIMGQUE_ResetQueueVCTRL_GetChanCapLevelVDMDRV_SetPriorityVDMHAL_V200R001_CfgRpMsgH264_DecOneNalVCTRL_GetSyntaxCtxVDEC_FuncControlH264DEC_DestroyCheckSegValidautoremove_wake_functionDNR_OpenHardwareg_UpMsgKernelMunmapUpdateMaxLTFrmIdxDumpDPBBsPosGenPiclistfromFrmlistVFMW_CTRL_thread_procSM_GetExteriorStateGetShortTermPicPointVCTRL_GetImageInterfaceVDEC_FuncInitExSCDDRV_MaskIntProcessSliceHeaderSecondPartVCTRL_GetChanIDByMemAddrDecSyntaxVCTRL_GetImageBufferVDEC_DRV_StartOneFramevfmw_read_proc_prnVCTRL_Isr_0VDMDRV_CheckDeviceH264DEC_DecodePacketg_fpLogMEM_CopyPhy2VirSM_ConfigClearAllg_ActivateLockH264_IsNewPicNalMEM_AddMemRecordMp4_Frame_AtrVCTRL_SetStreamInterfaceOSAL_ReleaseMemoryMEM_ManagerClearOperationDeleteRawPacketInBufferSlidingWinMarkFS_GetFreeFsparam_ops_intUSERDEC_InitVDEC_InitFSP_ExitVDEC_DRV_ConfigRegResetSCDH264DEC_RecycleImageVDMDRV_IsVdmInISRvfmw_proc_initg_NalTypeEOPICvmallocVCTRL_SetMoreGapEnableVDEC_InitWithOperationVDEC_DRV_IntProcessWaitSCDFinishCheckFrameStoreVDEC_DRV_StopSchelVDMDRV_SetChanIsDecH264DEC_GetImageBufferAdaptiveMemMarkClearAllSliceGetBackPicFromVOQueueSM_ReadStreamSegUSERDEC_RecycleImageVDMDRV_GetCurrChanIDH264HAL_V200R001_SetSliceMsgquant8_org__copy_from_userFindMinRefIdxOutputFrmToVOVCTRL_CreateChang_VfmwChanStatRepairList__aeabi_idivmodg_SliceTypeForPMVVCTRL_SetFrameInterfaceSplitFrmToFldsReturnImageToSyntaxmsleepVDMDRV_StartDecVCTRL_Isr_1VDMHAL_V200R001_GetHalMemSizelog2binFSP_PartitionFsMemoryg_DnrIrqHandleg_HwMemCombineFldsToFrmCloseUsdPool_WithMemOSAL_Init: IntrMutexpstVdecUsdPoolVCTRL_RegisterSoftDecoderOSAL_WakeupTaskKernelMemFreeg_TraceBsPeriodOpenUsdPool_WithMemDecMMCOUSE_FF_APT_ENg_TaskLockVDEC_FuncExitVDH_PutUsrdecFramePostPro_GetRepairStratageVDEC_DRV_MakeSliceListVCTRL_GetChanImgNumg_StopDecFSP_SetDisplay+,laa $+(,1+,,K@]+,L] j0/<+@,Ddx @T\+ `, d||+ , 1+,+,L+P,h+p,x         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |     +N ,N  $ + + , , z +N ,N  +N ,N  $  z +N  ,N  8 +@ ,D X +N \ ,N ` d $t J z +N ,N  3 + ,  +N  ,N   $, +4 z8 +N < ,N @ P +N T ,N X \ $h  +N ,N  $ + + , , + ,  +N  ,N   $( X +N \ ,N ` d $p  +N ,N  $ ? +N ,N  $  z +N ,N  +N ,N  $ {$ +N ( ,N , 0 $<  P T X \ ` d h l p t x :|                                   +(,,8+N <,N @D$P X+N \,N `d$l7t+N x,N |$+N ,N $+N ,N $^z+N ,N +N ,N $z +N ,N  +(,,<+D,HX+`,dt+|,+,+,+,+,+, +$,(8+@,DT+\,`p+x,|+,+,+,+, $+(,X+N \,N `+d1l+Jp,Jt1|+n,n1+,1+W,W1+,1+C,C1+O,O1+ , 1++,,,+\,\+, +(,,+> 4,> 8+@,D+L,P+X,\+d,h+-p,-t+e|,e+Q,Q+,+#,#+c,c+,+,+,+,+,+u,u+1,1+ ,1!$(+,,<`+d,h1! c+N,NcLc+,c +$,01t +a+b+c,a,b,c+d,d 4Xp:|+e,e+&,&+&,&$0+a4+b8,a<,bH+fL,fTdp% +a+b,a,b+f,f+g,g+a+b,a,b+f,f ! ,+&0,&8+ @, HL}\+a`+bd,ah,bt+jx,j+r,r4+r<,rL+NP,N|+s,sH+t,tH+r,r+s,s H<+t@,tDHt+r|,r+N,N+,>YY0+s4,s@HX+t\,t`H+r,r1+N,N+s,sH+t ,t$HD+rH,rL1P+rT,r+r,r(+u,+v0+w4,u8,v<,wD+xH,xP+r,r+N,N+y,y +z,z0P+{T,{`Hd+|p,|tHx+},}H+~,~H>+ ,+ , +$,(+0,4+" <," h+l,pHt>Y1+y,y+, ( Y4 +{< ,{H HL +T ,\ Hh +p ,x H +s ,s H +{ ,{ H +| ,| H  Y!+t!,t!H !Y0!+{4!,{@!HH!+P!,T!H\!+u`!+vd!,uh!,vt!+x!,!!!!+r!,r!!+!,"+",H"+sL",sX"Ht"+tx",t|"H"+","H"+u"+v",u",v"+","""+r#,r,#k4#T#+sX#,sd#H#+t#,t#H#+#,#H#+r#,r$ $+s$$,s0$HL$+tP$,tT$Hl$+p$,t$H: $+r$,r$$j$R %+s %,s%H4%+t8%,t<%HX%+{\%,{h%Hx%+|%,%H%%+r%,r%+{%,{&H&+&,$&H<&+{@&,{L&H\&+`&,d&Ht&+x&,&f&(+(+(+(,(,(,(+(,((+(+(+(,(,(,(+(,(()+,)+0),4),@)+D),L)P))*?`*1P+1++?+++++,+,+++,++++++,+,,+ ,,,,+,+ ,,$,,0,+4,,<,@,+D,+H,,L,,X,+\,,d,h,+l,+p,,t,,,+,,,,+,+,,,,,+,,,,+,+,,,,,+,,,,p.+t.,.H.+.,.H.+.+.,.,.+.,..+.+.,.,.+.,..+.+.,.,/+/, //P/+T/,X/H/+/,3qp6+t6,6+6, 8+$8,H8+L8,`8|x8+|8,8a8+8,88+8,9+ 9,$9X9+\9,`9l9+p9+t9,x9,|99+9+9,9,99+9+9,9,99+9+9,9,99+:,::+ :,$:0:+4:,8:D:+H:,P:\:+`:,d::::+:,::+:,::+:,;w|;+;,;;6;<<+<,,<w8<H<+L<,P<p<+t<,<+<,<O< <14=+<=,==+=,=+=,=+=,>+>,8?+x,>x+x,xx+?y,?y(y+?8y,?Pyly+;py,;tyyy+By,Byy+Cy,Cy+Dy,Dyy+Ey,Ezz+Fz,Fzz+G z,G : 0z4z+H8z,HHzLz+IPz,I`zdz+Jhz,Jxz|z+Kz,Kzz+Lz,Lzzz+Mz,Mzzz{{+N{,N({,{+O0{,O@{D{+PH{,PX{\{+Q`{,Qp{{{+R{,R{{+S{,S{+T{,T{+U{,U{+V{,V{+{,||+W|+X|,W |,X(|+C,|,C<|@|+D|,L|+YP|,Yh|l|+ p|, x|+Z||,Z||+J |,J |+[|,[||+|,|+\|,\||+{|,{|+]},]},}0}+^4},^D}H}+_L},_\}`}+`d},`t}x}+a|},a}}+b},b}}+c},c}}+d},d}}+e},e}}+f},f~~+g ~,g~ ~+h$~,h4~8~+i<~,iL~P~+jT~,jX~+k\~,k~~+l~,l~~+m~,m~~+n~,n~~+o~,o~~+p~,p~~+q,q+r,r(,+s0,s@D+tH,tX\+u`,upt+vx,v+w,w+x,x+y,y+z ,z$+{(,{<+@,\d+|h+}l,|p,}+~+,~,؀+,+ , $+M (,M 0+4,LX+\,p|+,+,+,$+,,0+4,8H+P,T+X,\h+p,t+x,|+,+[,[+z,ẑ+Ђ,+z+,z,+z+ ,z$,<D+zH+L,zP,hp+t+x,|,+z+,z,:ȃ+̃+Ѓ,ԃ,++,,+ ,`lx+,+z+,z,Ą̄+zЄ+Ԅ,z؄,+z+,z, +$+(,,,@H+zL+P,zT,hp+zt+x,z|,+z+,z,+zą+ȅ,z̅,+z+,z,++, ,4@+D+H,L,`l+p+t,x,+;,; Dapaaaa؈+܈,+, $+n(,n,0+4,LP+nT,nXh+l,ptx+n|,n+,$+,,0+(4,(8P+X,hl+M p,M t+x+z|,,z+,+,+,S x+|,+z,z+,+z,z+ċ,؋+,+z,z +z+,z,08+z<,zD+H,\d+h,p+zt,z+z+,z,+z,zȌ+̌,+,+z,z +z+,z ,8@+zD,zL+P,dl+p,x+z|,z++,,č+zȍ,zЍ+ԍ,+,+,+z +$,z(,@H+L,T+X,lt+x,+z,z++,,Ď̎+zЎ,z؎+܎,+,+,$+z(+,,z0,Hh+p,+:,+,+z,zԏ+,+,+,$+(,<H+zL+P,zX,l|+z+,z,++,,ȐА+Ԑ,ܐ+,+,+ ,@L+P,\+d,+,+~,~+~,~+,$,+z0+4,z8,Pd+zh+l,zp,++,,+z+,zĒ,ؒ+z+,z,+z +,z,(0+z4+8,z<,PX+z\+`,zd,x+z+,z,+z,z+,ȓ+,+(,<T+\,`+d,lt+|,+,+;,;ܔ+;,;++, ,D+H,P+;,;++,,+,,+;0,;4t+|,+Ȗ,Ж+,(+,,0l+,ȗ1ؗ Dh1ȘԘhh11,81HT1\ht1+,ԙ   +$,L `x +,O̚ +,O( DX+ `, h+l,t+I,I+,1țL1L +$,p+x,|+,+,+(,(++Ĝ,Ȝ,̜1+,$8S Th+,̝+ԝ,؝+(: ܝ,(++,,$+(,T+\,`+(d,(h|++,,+,ܞS +,P+X,`+,+,+,ğԟ+؟,ܟ+,+ ,+(,(@h3|c~ܠccء U +,08H\pU .P+T,Xl+p,t+,P +,+,0+4+8,<,@P+X,\+(`,(dU ~+,1 +,+,+,ܥw  +,+(,( <+@,l'  +,+,+,+)Ħ,)ȦԦ+ܦ,+,+,HP+T,X+J `,J  ħ+,$h+l,Ш;@(+ PX+\,@+,R;̩+ԩ,ܩ+,R+ ,$+(,,<+D,H+L,P`+h,l+p,t+,+,+,+,Ԫ+ت,ܪ+,+ ,0+4,+,ܫQ8l1+, ,+0,dh"l"x+,\+,+(,(ĭܭ+,!$ 8+@,D+(H,(Lt+x,+,+,@̮Ԯ+ܮ,+),)+,+,*:  +$,DL\d-lt+,̯+Я,ԯد+Oܯ,O+,,+O0,O<HL+P,`+{d,{R+,+O,OȰ+а,԰+ذ,ܰ+,+,++, ,$0+8,<+(@,(HPl+t,x+,+O,O+,ܱ+O,O+,,+{0,{`R+,+,̲+в,ܲ+O,O+,+, + ,$+((,(08T+X,-+,+,ȳ+г,Գ+س,ܳ+,+,(+,,T-+,-$0+8,<+@,DT+\,`+d,hx+,+ , +,+,$0Llȶ жD +,D1|@ +,11+ , + , +,и+Ը,ظ+, + ,@; T; +,̹; ; 0+4,X1\+d,h+l,p1p[E ]̺+к+Ժ,غ,ܺH L(0LTt+x,|+,p@+ ,H+L,P+T+X,\,ļpܼ@,+4,8T+\,`p̽@+$,,8+?: @,HP+X,\d+l,p& +,Ⱦ+о,Ծ+,+,,8+<,@LP`d+h,̿+,+ ,$; ,+0,4<T\`M"  ] "+,(+0,4<@D`+h,x+,+ , +!,!+"," +#,#$@; TX+\,t|eV+$,$e+%,%e; <; LXx(+&,&; 4; e; e,4+'<,'DL; Pe\`dzhl+(p,((+&,&+','@+)D,)HT?+*+U,*,U+,$(++0,+8@x+,,,7+-,-+.,.+/,/? 8+0,0?+ , +1,1(+2,,208_\t+3+U,3,Uza+4,47+-,- (+,,,,8D+H,h+5l,5p+,+6,6+,+7,7+8,8+9 ,9$0+J 4,J @+:H,:L`+d,x+;|,;|+,+<,<<: +=,=? +$,0+>8,><P+T,h+?l,?px+,+,+@,@+{,{+A,A +$,0+B8,B<H+M L,M X+C`,Cdp+t,+D,D+E,E+E,E+F,F+,+G+U ,G,U z0P+HT,HXl+Ip+Ux,I,Uz+J,J+K+U,K,Uz(+L,,L0@+FH,FL\+M`,Mdx+N|,N+O,O+,1,=h=+,+P,P+U,U+Q,Q@l0 1+R,R==,+S4,S8X+T\,T`lp+,11 8@BHX+\,+W,W-+,+(,( 0+4,Tm+,(cl 7c$%8<+D,+Z,Z-+,+-,-+[,[ +$,(+,,0<+D,H+(L,(P\`t+x,$+,+O,O7&L+fT,fX+\,-+O,OzM++,,(,z8D+H+T,X,`+d+p,t,|+,+, ; $; TLXht  $ 0+8,<):D$p+t,1+f+,f,D7+,D7K -z+b,bO( D+cL,c`Ox +#,#+d,dO    D+&L,&T|+e,e+f ,fz 0+c8,cHO\ h+dp,dO +b,bO X+g\,gdl&-z M$+h,,h0<+iD,iLX+j`,jd+k,k+l,l+%,%+m,m+n ,n +o(,o,<+pD,pHX+q`,qdx+h,h+r,r 0@Pdt+n,n+e,eP1\1h1t+u|,uJ+u,u+v,v+w,w 0+x4,x<L+yP,yTl|x1|1+,<+@,+,+,+,@+D,X+\,dp+t+x,|,++,,++,,++,,++,,++ ,, +$+(,,,0<+@+D,H,LX+\+`,d,ht+x+|,,++,,++,,++,,++,, ++,,(+0,4+8,<D+H,L3: h+l,p+,+,+,+,+ ,,L+P,T`+h,l+,+,+,+,D+H,LT+\,`h+p,t+|,+,+,+,,+4,8+<,@P+X,\+`,d+,+,+ ,+$,(+,,0@+D+H,L,P\+d,h+l,p+,+,+ ,+$,(+,,0<+D,H+L,P`+d+h,l,p+,+,+,+ ,+,`+d,+,+, +,+, 8+<,\+d,h+l,p+,+,+,+,+,+,0+8,<+D,HT+X,\+,+,+,4+<,@+H,LT+\,`+h,lt+|,+,+,+,+$,(8+<+@,D,HT+\,`+d,hp+x,|+,+,+ ,+,,+0+4,8,<D+L,P+T,Xd+l,p+t,x+,+,+,+,+,+,H T t+x,+,+, <+@,\+`,d&:l+,+,+ ,$+,,08+@,D+L,PX+`,d+h,lt+,bU +,S $+(,4D+H,Ll+p,<6l+t,x+|,+,+,+,1+ , + ,  +$ ,( +, ,0 P +T ,| 1 + , + ,  + , + ,  + ,  $ Dt +x +| , ,  + , + ,  + + , ,  + , 1 + ,, < +,@1c clcxccct+x,S +,+,|+,+,+,+,+,+,+,+,+, @+D,Td+ul,u+,+u,u+,+ ,$p+t,|+,+,+,+,+,(+,,H`bpbU U  +,+, 0+8,<+@,DX+\+`,d,h+,1Th+p,t+x,|+,+,+,+,(!,!c,>cc+?c,?c d+=$d,=8dTd+=Xd,=dIde e+@e,@eeee1ePff1f1f1f+Af,Afg,gtg+Bxg,Bggg h8h1xh1hh+Ch,Chi+D i,Diii(j8jj j; kHktkkk1kllDlxl l, llm+Em,Emm m+Fn,Fnn4n, Pndnnno+Io,Io@oToxoop4p+N8p+=u,>uu u+\(u,\u+\u,\{+\{,\{+\|,\|+\|,\@|+\H|,\|+\|,\p}+\x},\h~~~+\~,\+],](+^,,^0<+_D,_HX+`\,``p+at,ax+b,b+c,c+d,d+e,e,8+f<,f@L+gP,gT`+hd,hht+ix,i|+j,j+k,k+eĀ,eȀԀ+f؀,f+g,g%:+h,h+i,i(+j,,j0<+k@,kH\+e`,edp+ft,f|+g,g+h,h+i,í+jЁ,jԁ+k,k+e,e+f ,f+g ,g$0+h4,h8D+iH,iLX+j\,j`l+kp,kx+\,\Ђ+l,l+m+n,m,n +m+o ,m$,o,8+m<+p@,mD,pLX+q\+r`,qd,rht+qx+s|,q,s+m+t,m,t+q+u,q,ũ+mЃ+vԃ,m؃,v܃+m+w,m,w +q+x,q,x(+m0,m4+y8,y<L+qP+zT,qX,z\l+mp+{t,mx,{|+m+|,m,|+q+},q,}Ȅ+mЄ,mԄ+~؄,~܄+m+,m,+m+ ,m, +m$+(,m,,0<+m@+D,mH,L\+m`+d,mh,l|+m+,m,+m+,m,+q+ą,qȅ,̅؅+m,m+,+q+,q, +q +$,q(,,<+m@+D,mH,L\+m`+d,mh,lx+m,m+,+,+,+m+Ć,mȆ,̆܆+m+,m,++, ,$+(,,P+X,\+,+,0+8,<L+T,Xd+l,px+,+\&:,\Ĉ+̈,؈+,+,+,,+0,4p+t,+,+,+ĉ,ȉ+,+,+,$+(,0D+H,LX+\,dp+t,|+,+,+,Ȋ+̊,Ԋ܊+,+ , +$,(4+8,<H+L,P\+`,dp+t,x+,+,ċ+ȋ,̋؋+܋,+,+,,+0,4<+@,Dt+x,+,+,+,+,+,+,(+,,4D+H,L\+`,dt+x,|+,+,̍+\Ѝ,\+,+\,\+,+,+,$L+T,\t+|,+\,\<+D,H+,̑+Б,+,<+,Ēܒ+\,\(8HXhl+p,+,+,+,Ȕ+̔,Дܔ+,+,+, +,$LdtЕ+\ԕ,\,<l+,+\,\ԖDTdtėЗ <nt+3: x,|+\,\+, {D+P,p+x,{+,Й{+\,\4n+,+\,\Ԛ11P+\X,\AP+T,`lHx+,H1@1p+x,+ĝ,+ ,X|+,Ȟ؞+ܞ,Hclc,c+, 0+8,@`+d,ht+|,c+\,\̡ @L+T,X`+d,h+\,\ +\,\1+\,\H+\L,\x+|,@+\ģ,\(,+\0,\`+\,\m+\,\ 1̦ +,(ĩ1ةr0$<+@,L\+`,hp+|,+,(0+8,H+,,+0,4<+D,T+,̮ܮ+,0Ph+,ԯHHH+,İ+Ȱ,԰+\,\XA+N,NcT`Ht+x,|H+\,\0DP\|+,+,a+ȳ,гسL<"0, HX~ȷ1ܷ+,+,L+T,d+,Թ+\,\iX̻ػ8`+ļ,ȼؼ+J ,J $+,,8RHT+\,`x+n):|,n+,+\,\Ƚ+\,\o+ ,$(+n,,n0<D+J H,J |R+\,\о+ؾ,ܾ+n,n $,ܿ+\,\C,+\4,\`+J d+h,J l,x+, ?<+@,DT+X,\hnRa ,+0,4DP+X,\xa+\,\R+\,\(L+P,TX h2+,+\,\+, 1$cHcE ltC LT TLT4X+\,d+h,,+0,?+ ,<++,,++,, + + , , $ +( +, ,0 ,8  + ,,  + ,  + , T +\ ,`  + , L+T,X+,+,+,+, l+p,t+,+,+,h+l,p+,+,+ ,+$,,8+<,@h+,+,+,+, $+(,d+h,+,+,+,+ ,$S SSS S@S$SSS+, 8 +< +@ ,D ,L h + l , t <: S|!+ !, !<"S"+ ", ""+ ", "(#+ 0#, 4#D#+L#,\#h#+l#,p##+#,##+#,##+#,##S $,$L$l$$U $2$+$,$ %2%+%,8% &+&,&X&+\&,`&l&+p&,|&&+&,&'@'X'p''<(+@(,P((c(c(+(,(((+),),)4)+<),D)l)+p)+t),x),)))*) +4+X+p+|++, ,8,P,l,,,,,+,,,- -+(-,0-8-//T/+X/,`/l/+p/,///+ /, $0400+!0,!0+!0,!0T2223<3@3D3H3L3P3T3X334+$ 4,$445S56a(7+%07,%7)T9+&X9,&\9l9+'p9,'x9:+:,:X::+Z:,Z::<+ <,<<+5<,5<==L>+ZP>,ZX>|>>L@+P@,X@@+@,@B+B,BB+B,BD+ D,DG+G,GI+(I,(III+)I,)IIJJ+*K,*KK++K,+K$K,K4K5 HK1 \K+,dK,,tK|KK1HLhL@ L+-L,-LL+.L,.LMMMMM8N+1@N,1HNXN~lNPS@PU XPbdQSQS+X,X* h̯ܯ+Y,Y k\hl?+Z,Z<H+[L,[Th(HXThx+Y,Yĵ+Y̵,Yе+\,\+],]83T@d+^h,^lx +Yķ,Yȷط+_,_+`,`@+aH,aP`+bh,bp+c,cȸ+aи,aԸ+c ,c,+d0,d4: @+eD,eHT|̹+й, 202+h,h +h,h\+h`,hdļ+hȼ,hмDL+,Ľؽ+k,k(+l,,l8T+mX,m\+n,n+o,o+p,pľо+qԾ,q+r,r+s ,s$+t(,t4@+uD,uP\+v`,vl+w,w+x,xȿ+y̿,yؿ+z,z+{ ,{+|,|(t+,l+},}(Hp|+~,~+,,8l+p,t+,'XxD+H,LXt+,(HTl+p,t+,(\h+,+,(\h+,+,(+,,0<\+,8+<,@Ll+, L+P,T`i(T`+, +$,(4Pp+,:$0H+L,P\p+, 8D+,+ ,$@p+t,| +, +, +, +,  +, (+,,08+<,HP+T,`+,+,+, +,+,+ , +$,0<+@,D p+t,x |+, +, +, +,+,+,+,(,+0,<@+D,Px+|,+,+,+,+,+, +,+ ,,@+D,HL+P,\ `+d,p +,+,+,+, +,+,+, L+P,X\+`,lp+t, +,+,+,+,+,h+l,p+,+,+,(+,,0L+P,Tp+t,x +, +, +, + ,$ DL+P,T x+, +, +, @+D,H ht+x,|+,+,+,+,:+, + ,$<+@,D\+`,d+,+, +,(+0,4D+H,Lp<X|<Xd+h+l,p,x+,+, +, LPTX\`dhlptx|+,?+,0+4,8X+\,d |+, +, 8+,+,,`+h,p+,+,+,+,+,+,+, $+(,04+8,D H+L,X \+`,l p+t, +,+,+,+ ,$q+!,!,qDql+,+,+,+,8+@,DT+X,\p+t,+,+, 0+4,8 P+T,Xx+|,+,+,+, +,  +$,(,+0,<D+H,LP+T,` d+h,t x+ |,  + , 5+ ,  + ,  + ,  H+L,P`+: d,hl+p,+,+, T Pp+,,8+<,@ PTX\p+t,|+,H+L,`x+,+,+,,+0,4D+H,L\+`,d+,D+H,L`+d,l+ , +!,! D+"L,"Pl+#p,#t+$,$+%,%+&,&+',',+(0,(4D+)H,)L\+*`,*d++,++,,, +-,-+.,.+,+/,/+0,0+1,1 +2,2P+3T,3X+4,4+5,5+0,0X+0\,0d+6,6+3,3+1,1 +3,3 (+10,14@+4D,4HP+2X,2\d+2l,2px+4,4+5,5+7,7  +8,84p+9t,9x +:,: +;,;+7,7  L L D+9H,9P h+:l,:t +<,<+=,=+>,>+?,?+@,@T+AX,Ax+B,B  +C$,C(,+D0,D<P+EX,E\ +F,F+G,G+H,H+G,G +H,H,+I0,I4+J,J +K,K+L,L:+M,M $+N,,N04+O8,ODH+NL,NX\+O`,Ol+P,P  \|+Q,Q+R,R+S,S+T,T0+U4,U8 +V,V+W,W+X,X+Y,Y<+ZD,ZH`+[d,[h+\,\+],]+^,^@+_D,_L+`,`+a,a+b,b<+c@,cDTd+dh,dl|+e,e+f,f +g,g +h,hH+$L,$P`+id,ih+j,j+k,k+l,l+m ,m$8+n<,n@P+oT,oXh+-l,-p+p,p+q,q   , .4 \<  +r ,r  =( W< +s@ ,sD H +L ,|  +t ,t  + , +u ,u  4 +v< ,vD T +wX ,w\ h +xp ,xt  +y ,y  +z ,z  +{ ,{  +| ,| $ +}( ,},  +q ,q    +s ,s 42T+~`,~  $(,048<D+L,Pd2t2+,+, $+(,,P`t+x,| +,K+,v+$,, : 0+4,p+t,x+,+,+,+,$+(,,4D+H,L\/p+t,+,@G2,G8D+L,PGS +?,?+,0+4+8,<,DP+,l?p+<t,<+,cl+t,+,\$+d$,h$+l$,p$$c$+$,'+','+',''c(+ (,(+(,(\(+`(,d((+B (,B (+(,(+(,(4)+<),l))+),))+),))+*,**+,*,@*H*+L*,|**+*,,+<++@+,\+h++l+,++++,++++,+++,, ,,+(,,8,H,+L,,h,(-+,-,@-D-+M H-,M T-+\-,l---. .8.+<.,\.+d.,.+.,..c.+.,..+.,..+.,.+.,. /+/,/+/, /0/+8/,>: (>U H>~X>d>p>|>>3>3>+>,>?~(?8?U P?8d?t???+?1?,?1?1?1?1p@@1@1@vA1BSBSBStDdD+D,DE+E, ELE1XEdE xE E+E,EE+E,EF~DF+HF, GtG?HcHHpH+tH,xHH~HHHHH3H3II^4I+4 8I,4 I+I,I+I,0Jc@J1JJ@ K+K,KK+K,KK+L,L L+$L,0L@L+DL,HLdL+hL,tLL+L,L2pMMGMM2N+ N,@NPN+XN,\NNGN1NN2N2N2N2O24O2TO\O+`O,O2O2O2P2(P2|,>||+?|,?||+@|,@}}+A},A}}+A},A}}+A},A~(~+A0~,A<~\~+Ad~,Ap~~+A~,A~~+A~,A~~+A,A ,+A4,A@`+Ah,At+A,A+A,A+A,A0+A8,ADd+Al,Ax+A,À+AԀ,A+A,A4+A<,AHh+Ap,A|+A,AЁ+A؁,A+A ,A8+A@,ALl+At,A+A,AԂ+A܂,A+A,A<+AD,APp+Ax,A+A,Ã+A؃,A +2,20+3H,3P`+4: h,4|+B,B+C,C̄+DԄ,D؄+E܄,E+D,D+E,E F +W,W$(+X,,X0XG \P T04! xF|8 hl `dHLpt@wD9R8< (, O$ y  R ,048O f*3: hi3521_hdmi.ko9Y9Y9YELF(c4( p-LM@,@ (@ @@@P  ($ 0PK0 KlD`6/l$`KE 03/l F03/Kp -LM@@@0`KPl K$P D(P (p,P 0p $pK 03/l E03/l F03/K -L -LLM@@@Rb`qV X` `@` eaEnX @D ]T bPA0 0+@(Frgqɏ\ p `  0 d  8 0 < 嘗*84 噇*8 0 H<l 嚇)4啊0 4ȯ84 啨8P ʏ8 啉ɏ4< h 0JiP8Ji0 4 44h<Jh8 880 @< ,48P  ʏ40 咊<4 ȯ<H 咨8 ɏL 咉0h 4Ji  < 8 H4 Ih8 hL$Ai@ H @( <0 H嘗h$84嚗jgϠȏ4 啚ǟ4PdJlEhDPGi8 \p  `p4 8p _Tp S `R@@00\`C@@VS@@? zCPQ@@CP@@z C @C@@ zB$@ zA S@ zB C@ zC S@ zD C@ zE S@ zF C@ zG S@ zH C@ zI S@ zJ C@ zK S@ zL C@ zM S@ z : N C@ zO S@ zP C@ @S@Cz S@ z C@ z S@ z C@ z S@ z C@ z S@ z C@ z S@ @CXSS@@`C Sp@w` z@p TS Trs  TW X^Z Y Y Y@S@S@S@C@C@B[A[D [@C0[C@ [@SC @Cz@C@S@C@C@S@CV@S@S@C@S@Cg@Ca@C[@CU@CO@CI@CC@C=@C7@C1@C+@C%@C@C@C@C @C@C@S@S@C@C 0-LM@P@@@@@ @ @00@@@00@ R @,K0  @^00@B Q00@1@Ó0: 0@@ -L,M@Q` PPP@0S" (9 @Q0( @(J(K(<9 @U0( @(JpWLK  0P @0sЕSpwp S pwp Spwp 8 Q @p(powp`0( @0S p :S ( (8 @㑂  @(@?( @LK( @ 0B S 0pB0P3ӕW44(2(2(20K0K$0S S S0(Q0s0 Q0s0R,0s0P0<<s0J0K`V񟗩 88888777@88808(8L5L57L5L5L5L57(6 @N( @(JHW DLPK 0C\@ @hcܕ Q @545(55554443q``L`K 0NS @0 p#ӕ80@Q  D< Q  ; Q  } Q @\KKtş00J0K0I0K@P@|ЕQ H K 0W@0U.mv`0_ q`p~```v`P0s`@|`0q` ~``v`(\4 @v(0 @p0p@` ,`P `&V P0Z(3q @0`( @@ `RO `I`K4 00R0 0 R00 R08 R@0H0K<P@^ D\ H0S 0<0@DHP@< DH<q G K!$F K@0H E0K#ĠDKD.4CKB0KH.ĠAK@KXQ  60 ST Sc Sr S= (2 @e( : @i geca_ ]"[YWUSQO`b1 0@Q  >0@Q  70@Q @pB(1 @ac`0(  @``X(0 @Rc`0(  @``G(0 @W0(  @``6(<0 @0(  @``%4T| p-L M1@P( @,( @T``@0S" (|1 @/0( @(JKp(41 @.0( @(JU, P G@PO @0( @P(PJ$K(> @qΠ0( @P(PJT{ P (4> @( @pX 00@R (QP,U0 \ 4Q 8PPh 408pp@P 4q@B8A<@ T  Rv PX[ ( = @#DH0( @ R L0hSP(< @`0( @Q(X< @(0 @U P (K]B`VP (;( @( @DD0D0:4@8B<AT X X1S P(; @Ewp(0 @0Ku~(: @p/[.P[(-[ 00[ @ dqW PU2 UE (`: @{( @P p00 KS/PK S S S0-0K  : (9 @/[-[(.P[00[ @ (9 @P0( @W ,9( @P( @0 CSX@S> r3 (8 @pP(30 @Pr3 0(t8 @  @(30pAPj$PK%]B,]B, ]B(7 @,P 8 @]0B(P(0$pSt S S 0K(h7 @'/[-[(.[00[ @0S0 S0z R<<00KD< W @W/K  @W /K W/K @ W /K >0@W0/0K } W0/0K /K,0S0.0K S0.0K S0.0K S0.0K S 0.0K S 0.0K S 0.0K S 0.0K S 00.0K00(-[S 5 @@㱨-K/[(-[.[ 00[ @} W(S(5( @( @BPU1|`K (H`V4( @( @(P4 @WP( @P(PJ] R|PK r3 ܇(3 @P(30 @P0 rr3 0(t3 @( 30 @W WP > PU U' (3 @( @P )(2 @JWP0( @ 0S$Kl2(( @( @W]B, ]B, ]B(1   : @P,( 8 @]0B$z# (1 @q( @ Pz# t(H1 @v( @P 1( @1( @0uz# 0OrI PUp U (0 @( @pPI w0r (40 @( @ u(,<< \@QD0PU H @\$LP^(P0\|,TQx0PX Ut40\Sq8`P^m(l4 @ ( @k(44 @YP ( @M4( @( @-(3 @0 ( @ppKL P X3( @( @((3 @( @ @ Rp O RM Rl 0  RF RD RB R@ R> R< R} R{ R R Rl 0  B Pw0 l \U X0 0d P (0 h` `0 \0 T L0 H0 D0 40 00 ,0 WP 1( @( @0l  |1( @( @LpT lp pp h d ` \ X $pP(1 @(  @S00(0 @0 ( @0: T0l S0 0 (\0 @0( @0 zl T 0@ R  qL -LM(P2 @ @@@0( @0S! UH U U3 U U U ((2 @  @(0q``@WV W KUl U P(1 @  @(PP ` ```01( @{p( @rq X0kru X00( @`( @ 0]@P]P 0[hq(P0 @h1(  @P`x 0-LM(@T2 @Π( @T (2 @0( @(JK0@@@GPPO1S1 P@rq X0u X0rG(`1 @( @0P$ (1 @( @0( @( @G(JGL@(x0 @p@0( @0Ds R80( @( @ 0-LM80LQ@0Ph ($ LQ 7TLQ klLT L T TLT!(Q 3( LQ ?LT D T (L3 @~0( @ OK0  LT D ( LTe LTM L TTA 8T :T@ !LQh d:80LQ T= T 8T0LQ (3: T LQy $LQ L T0 LT% 80LT@^`(1 @P( @ 00@~{x h tqnkheb @ Q (JZ 0(0JPQN00@IFDB?<9 -LgM@@@0`KnKLKPpPe 0S] Pb0SW  0P !R|[Q z[00{[y[!qqq q  q@ q q  q q q q q q q q\) 0( @{p( @1 !L0 0 @KƒH ?KpdP (K2d Q !R !1S 01 -L@@@P2 0S ZP2  -L@Q0,10 -L@,0 -LrQ zQ Q,00@0p@0p00@,| -LrQ zQ Q,@1@1@,1 -LrQ zQ00@,0$r00@0 p -LrQ zQ,00@0p@0p -LrQ zQ00@,0$r00@0 p -LrQ zQ@,#Ġ01@#Ġ01 -LPQ0S R rR @ !S 00\&:zR @̌ ! -LPQ 0S \r\ z\ @,!S 00\@! -L@ 0ă8 -L00@ 4ȃ00 -L@@@P00 -L]B 00@ -L -L MH]@BK  K -L MH]@BK  K -L@`Ppr 0 0r 0 -L -Lz= 0r 40]B -Lz= 0r 0]B x-L0@`Pr  r 0Px -L p-L Mr P( 0 @0@P@( 0 @ 00@ Kp( 0 @0@``0( @ r ( 0 @0@P@( 0 @ ( 0 @0@`0( @ ( 0 @0@ ( @ -L -Lp -L -L -Lz  -L0@0z 00000z/ z! 0<<0z" z  -Lz @Tz z 00s0 -L M K0[ @[z 0@K[@ -L00@@0z!  -LM(@  @00@pp(` 0 @`z z 00z  z P<: z/ PpU`t 0z$ 0 pS``v`U @pP1 Ut ( 0 @0@p( @z 0Pz$ 0@z 0`z! 0z" 0z# 0( 0 @0@  @(0z ( 0 @0@0( @p0z/ z 0 K@( 0 @0@`@PP( @pP0z! pz" 2ps00z @P 0-LM @KP  K0 -LM`@P `pP ( 0 @0@pp (0 @ 00( 0 @0@`( 0 @  K -LM PK@  0[`[Pi pp(P2 @[ 0[( @ [X (1 @[ 0[( @ 0[( (1 @  @(00[      8 [ 00KW (0 @[ 0[ @(`pp(0 @[( 0[ @ P0( @( @0   0[x -L M@ (0 @]PP(`P p @0`P p K d0K 0K K -L -L MP0):0K@0K 0@003K 0K0KK -L0 !0! 0##0 !0#s0 #!,|, 0!0#s0# 0! 0#s0# 0!0#s0 #!,| "0! 0#s00 -LQ0!@ `pP#0p'P'`00#Ps0p#00#s0`#P00#s0`#P00#s0`#P00#s0`#P00#s0P%00#s0 Q0 -Lr@3 Tr3 @00s0 -LMr@> @4pr> 㗄%(` p 0P000r@ 0rB rD 00rF m`0rG r: 0r< 0( 0 @0@``0( @`PDp0 TS TT @Dt@T rH q0rH KrH 0 -LM@r@4()X20PP  @Pp ⸐0p `p`  @(0@(1 @3( 0 @` Dr TQ TT1rH 0s0rH w0r2 W4r3 0r6 y0r4 00rS8 00r3 r3 €|0(K@Dt@TrH 0P pE0E@`s0`  E prEq`Ep(80 @&P( 0 @` -L -L"P00@ӗ -L00@ -L@ 00 -L M@P@@ K( 0 @0@_( @00 -L MPq@pwpTz*`.3#*:@Wv Wd ( 82 @=  @(( 2 @> @?<0(t@WR`(1v` @0( @0S 0SL (h1 @0( @@1($1 @p( @p(0 @7(  @(0 @;(  @(K(l0 @9(  @(40 @3Π0(  @@ -LMQ0 K @ P(02P @4 `( 0 @A4 TRY 4@`TQ 0TS` `4@dV 0TSp"WଐPa4@`TQp"W1ଐ R a`4@dV0 ZL(K1 @(4 ( @@ap40 @(4 ( @@ap4p"Wଐ0S (H0 @p"WଐP ( 0 @ -L  --LM@0S K -L> p-L M@@@[`vPU( 0 @P8PP@01( 0 @`VN (1 @J( @8P(H1 @8PĄ   $,(L4( @Kp\0( @;( @},D ; 8a!1`La p-L MP[@@@`r 009 P`51?: ( @( @(l1 @`n`( 4 @``@QC 1( @(  @[/Kp[(0 @`Π`0( @p[/0S(J(H0 @( @P,P -L -LM0,PK@`p0 q P@0p,[wp+[0 00*[0 00)[0 00([0 00'[0 00&[0 000%[ 00W $K -LM @K0P0p `P K  [P [Q -LM?(  @``@( @4S- K- K@@P@[-[ .PK.  @X ` \ -Kd`  P (K  .`[(> @0( @ 0``S ڀS S `- [@t@R S  @S>( @( @(= @(= @@ P   .[h=( @ .K( @.[xPPpK 0PpK P   .[0@s.KP0 q 0Pp  .[ Lr.KP0 ~00 0PT  .[Ap.KP |P; g .0[ C. KLt;( @( @?: 0PpKs P P [R񟗵|D L:( @]Π( @ qP  .p[\:(dp @( @.0[ @ (9 @(  @9( @( @ P   8h0 dph x.[p` ` @@h l .Kt@ P KPP K P KP@[( @AT1ࠓHვ48( 0 @DPp8X08(PpK @( @ 0 sPC  O[N [(P[h l 7 @hl( 0 @PX h Ql0SP7( @( @M[dL[ ,P0[O[QN[10 !1 R P Sd01| (6 @d(d!1 ց @K0[CJ[ àG[ F[x d|  H[ I [t ҂d匀 E[倀 SS31ᜀR#0䁌1刀0!1xt |"I[d2 4V00S C[(X D[ @l ނl(5娂àXh l X (  4 @(4 @X( @4X4S4d4 Cr R SXA [@0[Xp$ 4 ?[>0[4d0d4Xh jp@ d@l` `t  ,pK⃀r Ap$\` q0 S0, w0z x,K$Z,b`h`Pdl`p@*:t4=(<3 @(  @/(3 @M ( @(2 @RP[( 0 @02( @S( @O0[ @T ((2 @N0[  @(1`.[v`Px3(1 @G(  @(1 @J(  @(\1 @D(  @($1 @A(  @(0 @>(  @t(0 @;(  @f(|0 @8(  @X(D0 @EΠ ( @J@`x0( @( @.0[oX0( @( @.0[^0( @( @.0[M0( @( @.0[< 1( @( @.0[+H1( @( @.0[(1 @(  @(1 @(  @(1 @(  @(2( @u( @ qPP0[Op[dpd D[@=[@<[@;[@:[@9[@8[@7[@6[@5[@4[@3[@2[@1[@@0s@T~- KP - [R(8 @-[(0 @ @P`  wx(d8 @p9[?`[(>[ <: @8[=p[<[7[;[:[ 6[@0[`$5[p(4[ ,3[02[41[8-[`|@T7( @P`( @  !  "  #  0   @%  P&  `'  p   )  *  +    -  .  /  HQL R1 @(D5 @ @( 4 @D5 @(( @(J(K\(4 @G@ ( @@ ̄ |P@[@?[@>[@=[@<[@;[@:[@9[@8[@7[@6[@5[@4[@3[@2[@1[@@p@ T@-0[SS}ח(2 @0( @X@!b*@G@[@?[@>[@=[@<[@;[@:[@9[@8[@7[@6[@5[@4[@3[@@2[@t@1[@@T*  qP (@1 @-[@@p-0[ Sr(0 @҇( -0[ @p-pKk (0 @(0 @Π( @(JL0( @w&:r ( @0(J -LM@PP& 4H\pT`A`A(pK(0E4E(@ TG (81 @f( @ K(0 @[0( @`A`A`A`A`A`A ` A`A ` A`A`A`A ` A`A ` A`A (1UP p-LM@P`P&(<Pd @A@A K 05 0 SG (H1 @'( @Kp(1 @GϠ0( @@A@A@A@A@A@A @ A@A @ A@A@A@A @ A@A @ A@AV0  p-LM@P`P|D@A KV    Kp(0 @0( @D@A KV 0  D@AD@AD @AD @AD@AD @AD @A4 -LPPPU& @@@Pa0V \ \ \Q 0QpA p W 0Q,0$QR% P -LM4@KP` P  Kv묀[`[(3 @p[P[0( @XuPC0P R S P `0`@P(L3 @0( @ppPP@110  P S p0@` V ?0 pW S `0@\03: AA?01@[(`K[0 [[|[[@ D1$1!T$~'K(pK5TT'K(Kpq-T&T4( K'0Ktq%TB(@K'KDA [[+K"2,0K ,KDA[0[6[1- $Kc?( P @P@0( @?`ar - [40[03[\2[X1p[Wpp0@[T@@/[Q.[P ``P %K P%[^ 9T` -L$MPP@@p>(㲀  @( @P0S (\> @ ( @0(K.`K~ P (= @}.[(~0 @(= @( 0 @ (T= @}.[( ~0 @.[P(= @( .0[ @.K(< @.[( @ 0. [R   /K A`P/[XP 4K P$ 4[Y4S)``yY %:4 [`P 0u s` V*  P (0 @( 0 @4K P (l0 @ ( @<80( @ ( @;0[   qP : [<[(P0B L @ @R0( @: [;[(0D L @ @U0( @7 [9[(0B  @@0( @7 [8[(41D L @ @[(0 @0 sP 9 [<[(1A  @@0( @9 [;[(1B L @ @g0( @9 [:[(@2A 0@ @,Bj0( @9@[:[(2" 0@ @ @m0( @  qP5 :@[< [(3B @u0( @: [;[(D3D  @@w0( @(3 @Ϡ(90[ @(3 @y( 80[ @[P( 4 @}  @(70[` (D4 @ ( @7[(4 @(  @GV  ~P? <0[S 5;[ \:[PP,  - K8P]P5( @N@( @-0[B@ 5( @( @-0[  5( @H8@( @-0[ ( ,6 @@8A  @((`6 @-0[(  @0 6( @ &:( @-0[(6 @(  @(7 @ ( @K(H7 @{(  @- -LM`@(@JPPPppU<0 @(K4S<00 K(40 @( @(J4 0-LP 00@P@0@ @\ 0P @PP0PPP0 0-LP 0@0@P@ 0@\ 0P P@0PP@@0 -L00@ -L00@ -L@ 0 -L00@!$  -L @0P -LM @00@RRoR0 @R_RR4 RORR8 Rp`< R0p4`@ P8P啠<Ѐ@p`PՐ٠@@RR`P @AB@@囀۠p`P@ (K -L00@ -L00@ -L00@P -LQ@\0A 0 S \ 0\   p-L M@P`t@ s@T r 0DU s@r 0DUT@( 0 @0@D 0 @0@(Kp@P p-LM0PK@`r 0r 0 $4t,0K00K.`K+0K*K/0K-@KKp -L00@ -L00@ -L00@ -Lr @Tr r 00s0 -LPrv rv 0r' r' 0rv !3: rv <|0r' r' 0s0 -L M(@  @00@UϠ( 0 @Trw rw O0r' r' 0Krw rw O0 |0r' r' 0s0 -Lr @Tr r 00s0 -LM KQ3 ?@!(\1 @@(0 @0s0000@  (0 @ ( @(0 @w(  @(h0 @{(  @(00 @r(  @ t -L M@@@@000 SbP:KP*d0 @(( @0lP ( 0 @ -LM$@Kp`Pr 0!`K PK$K# K"0KK -LM0@KP`p0t .`K-PK+0K0K* K(p /0K,0KK -L M@ KP~[[00[ [s00s00s00s0 0s0@0s00s00s00s00s00s00s0 0s0@0s00s00s00s00s00s00s0 0s0@0s00s00s00s00s00s00s0 0s0@0s00 [s00s00s00s00s00s0 0s0@0s00s0S00 K00 0-LMP K@P  K"/1[![R@00K0 -LM0@KP`p0t .`K-PK+0K0K* K(p /0K,0KK -L[=[(<[ @0[ @UP0  㙯(7 @P?[>[=[(<[ @0[ @UYX7(8K @㟟( @ r 06PKP40K8K7K5PK   6( @( @(6 @(d6 @(K<6( @( @(5 @(5 @5( @;( @( `5 @r  @(85( @w( @4( @E( @4( @O( @(h4 @m(  @P| Pf Pa P\ PW PR PM PH PC P> P9 P$00[SbD3( @( @.3( @]( @2( @( @ x2( @( @42( @( @(1 @Ϡ(  @ @1 [@a #%:r @@@r `z0 r r Ppw0((1 @`( ` P @p 0`P p @(0 @( @0T0( @( @ s l -LMr (43 @@( @(2 @ ( @K2( @ C@@(@@ @(|2 @_P(0 @PPp\ %cP$K]B(1 @`$P@( 8 @]0B`V ``PP@ Ap0S RI WB H1( @( @0r  r 0 0r `0( @c`( @p KK PKPKPKr 0]80( @r( @ -LM( 0 @0@'( @~. KPPc. [R` R-PK@@``Tv pPr-0[S xP-[Pp( 0 @0@wpY( @/ KP /[r 3/0KpPx-[  2S~0( s/0[X:`v`V@t  .[R@ X*@( 0 @0@-.[0( @(K/0[X* -[Pi ( 0 @0@B0( @( 0 @0@( -0[$?: @( 0 @0@O 0( @( 0 @0@( -0[ @ ( 0 @0@_ 0( @ ( 0 @0@i0( @  ~`- [ R |-0[S( 0 @0@( @h -Lz0  -L0Pz< z< z< 0s0 -Lr@ T 0r s0r 00r r 0 -L M(@0 @0( @z/ Tz/ z/ 00s0H0( @z/  ( @0K -Lz/  -Lr@H rH 00 -Lr r 0 -Lr r 0s0ry 0 -Lr r 0 -Lr@ 0r  -LM2( @f( @r %0@  PKn (02 @`[0[( `[p[ @ `p 1( @Π( @PG L1( @( @rq X0ru X0(0 @(u0 @XP @( 0 @nϠ  @(Kz00@ (,0 @iϠ ( @ -L@zt0 T8z  -%*:Lz 0  z0 -L M(0 @( @2@ s@T# r 0D s@r 0D T( L0 @  @(K$ 0-LM@KP$]B0 K0$]B Q]B 0-LMH]@BPK00%(x0 @c0( @` ]B]B]B @]BK08 -L M|0( @vF @@( @ry 0KH -LMKKKz 0K K0K K -LMKKKr 0K K0K K -LM$@KpP`z 0!`K PK$K# K"0KK -LM$@KpP`r 0!`K PK$K# K"0KK 0-LMr@ TP K KKKK0r s0K00r -LM``@4@(@ @QP( @3( @rϠ( @ @r %0 @P | Q@ G@ @Kq (2 @p[0[( `[p[ @ `p @ @ @ @@Pn H2( @( @ @BPH 1( @( @rq X0ru X0 @L@PB @( <1 @&):  @((1 @Ϡ ( @Ke0( @( @0( @( @@@(@ $0 @( @\ -LP P P P P00_00_  @00 `  000 -LP P P$ P P( P:00000_  @ 0 0 `0 000 0̠? 0 0 -L -L(M<@K`dpPV ~``1 9`K0R`;K:Kr8pKr7`Kip6Ks`5K=m4K3pK2`K1K0K< K00`u rVPrv z? Pz? r,=s0( 0 @0@( @r (p 0 @0@ ( @0u r`(p 0 @0@0( @rv (p 0 @0@P( 0 @Uz? ( 0 @0@@0( @K 0-LM(@1 @Ϡ(0 @PTK0z? z? P0Tz00 z? ! z?  z?  z?  z?   0z? s0(,0 @' ( @ -L MX@@@``@q0o C|q0s r|q0s '<: r|qz> 0sz> 0z@ 0zA 0zB 0 hzr0C 0 (( @zD 0zE 0zF 0zG 0zH 0zI 0zJ 0zK 0zL 0zM 0zN 0zO 0zP 00 (( @z> 0 (( @0zs0> 0 (( @z> 0 (( @0 (( @z@  0(p0 (zA  0(p0 (zB  0(p0 (zC  0(p0 (zD  0(p0 (zE  0(p0 (zF  0(p0 (zG  0(p0 (zH  0(p0 (zI  0(p0 (zJ  0(p0 (zK  0(p0 (zL  0(p0 (zM  0(p0 (zN  0(p0 (zO  0(p0 (zP  0(p 0( 0(̠ ( @ K 0-(<: LMz@> KPCP 1[z> Pu0K0 0-LMz@> KP(P 1[z> Pu0K0 0-LMz@> KP:P 1[z> Pu0K0 p-L MzP> @; P;`z> 1 :Pz>  9Pz> PEuP EpPU z> U ( T0 @4  @(Kp0z> s0n @ 0-LMz@> KPPK0[P 1[z> Pu0 -LM@P(K`0KP T(@K0'0K T T T T r &`K&[(0[' [P|  R`@@tQ p R`v@` R|pw0 [z`l%`K~@ z|p'0[0 s`z&0[z %0[&[P @q 0z|p&[@ P(h1 @A0P[ q@& [(@0 @ z~P(1 @p`0( @&[p@0T(0 @ ( @X  Kz> [z> 0s0n @r 0&`K'0K[ [PU -LDM0( @=C@( @HK @0 (0K' K&@K(K @0#@K"@K%K$0KK -L$Mp0( @%C@( @@(K &@K 0(K@'0K`0%K$0KK -L$Ml0( @B@( @@(K &@K0$@K(0K@0'K%0KK -L)):M@P(K0KEP T(@K T T T Tr 0'0K 0&0K ['P  0'K&0Kr &[(0['[Pp| ` R@@tQ p R`v@ pRw|0 [z`l%`K~@ z|p'0[` v`z&0[%0[z &0[S @p 0z|p&[@ Q(L1 @@0P[p@& [(@0 @ z~P(0 @p`0( @&[q@0T(0 @( @X z> [z> 0s0n @ K` @'`K&@KZ ' K&KU0 -LM K K -LM K K -LM K K -LM K K -LM K K p-L MP@$K`gP 0[S3:V [-PKp $[z> 2[z> |0$[ -L00@ -L@00@  -L00@ -L@@ 0Rr  -L@@ 0Rr  -L@@ 0Rr  -Lr  -Lru @Tru ru 00s0 -Lrq @0ru @0 -Lr 0@r r0D  s@r0D  s@0D s@TT -Lr 0Pr  p-L Mr P r@00@**: @P `( 0 @0@r `( @P000@T(P @ @00@PPr @@@( @000@P U ( 0 @0@r  ( @0Kp( 0 @0@ r( @0( 0 @0@ r( @0 p-LM @Krp q rp P 0[@ q 0[@ I[ V q[Qc[n [irp 0Kp1( @+a`( @(\1 @K_P @[`[(P[ 0[ @ `P 0[  (0 @=  @([  0( @B(  @ q[Q@@@0 S X -L M0@S @ &K( 0 @0@( @00( 0 @0@( @ ( 0 @0@( @ p-L M|0P`( @( 0 @@0r 0Ts@f@:Kp -LM@Pp`f@`Vr r P 0s@T:T (<0 @0( @PK -LM$@KpP`r 0!`K PK$K# K"0KK -LM$@KpP`r 0!`K PK$K# K"0KK -LMs@@@,`K(+?: 0 ᰣ]BVP&ZP( @ P 0(P@ 00崓]B ( 380  0(8 00 ]B(8 8 0(0弣]B80 (  0(0]B 0 (  0(0ģ]B 0 (  0(0ȓ]B 0 (  0(0̣]B 0 (  0(0Г]B 0 (  0(0ԣ]B 0 (  0(0 0( 0(\( @(K 0-LP@ PP@@T 00r' 0r' PP@r& 00r' 0r&  r&  r&  r&  r&  r&  r&  r&  r&  0 -LM@ 0r r  KPK PKA[K(P1 @][  @( 10[S@Ts@ r 0Df@r Ka[P r 0r 0r 0(\0 @V[( 40 @@ p-LM@r 0 PPLPuP6 Ef@rPU r KQ0  Ef@rPr 00KSr `,%:VU1(1 @ ( @KpPEf@uPr r `V(d1 @ 0(  @@P (1 @(  @r 0KcP[U* U r 0r 00r (l0 @K[( D0 @@ -LpR`p@G 0PW@uPX  0@W|P 0 qP@0 t0WpP -Lp 0 -LRpp@`H `PX@uPV  @X|P ` rP @t0XqP x-LpP@` ` @t00x -Lp  -L$MP@0PEuP#[UK5 U5E3[qPUK' U'ExP[U`cK UPE uP[U #K  U `EvP[U03K U E⸃[rPUK UPEuP3[UK UEc[|PUK U E#[pPU⸃K U PE$uP[U0 3K U E(xP[U` cK U ,0E[sPU #K  U PE0uPc[U K U 4 E⸃[rPUK  U8E3[qPUKq Uq<S[`cK@` P@@.3: @@@@0 @0 @@@@P@U @`0P, K@LpPU0@@aP P@uPU@@X  u#[K PLP 3[S! Q& ,@KQ` @ɌS Q 1<0  A(x4 @@( 0 @44P(4 @@0( @440 R(3 @@( 0 @44P(X3 @@0( @440 R(2 @@|( 0 @44|Py(2 @i(0 @  X2( @( @A@,K` NO C[ @ !x < t p l h d ` \ X T P L H D > o3[S!!,@K`@A@SA T1<0 հ(,1( @( @CYQ1 Q,K` @Ɍ(0 @i(0 @0( @( @ 00@,K` Nŀ,@K` @Ł $ , -L00@ -L00@ -L00@ -L M@@@0S 0CS1 xxx yw( 0 @0@( @( 0 @0@ ( @K( 0 @0@(/&:  @( 0 @0@0 ( @( 0 @0@( @( 0 @0@(  @( 0 @0@(  @( 0 @0@(  @( 0 @0@(  @ p-LM$K,@K@@ bA 0,`((P $@ @Pc<0@df``T$4@(0 @KpL -L M@@@(80 @=(0 @K\ -L @rT00@    -L M@@@(H1 @)0( @0S# S (0 @A 0 @(KP 0( @;(  @Pl0( @/(  @(,0 @MϠ(  @t -L00@ R 0-LM@P@@P@0 R SK0(,2 @( @ Q}H}}}}~~ ~}X~h~x~~|@@00@(|1 @(  @(D1 @(  @( 1 @(  @(0 @(  @@@@(l0 @(  @@@@@ -L@@@90 0-LMPK@K0 0-LMPP@ @T K 0@"@ @abA@c(@0$w @4@  @(0K0 -LMP K0: P (1( @fϠ( @PK@P#[(0 @ @0[( @x0( @( @80( @( @ p-L M@@@PU Kpr 000( @e`r  @`(v` @0V x0( @q( @P80( @v( @` -LM(H0 @( @000@ K 0-LM@PK@@0 0 @K0 -L MP`4 @@@PP@0pp@Q (P5 @`( @`0`V`1 0Sr P K @@@Bq0SA@@@0Cp RPP@4( P @P@( @0S`004( @ ( @ @`P! `VK P-0 C~Pv S Pl (h3 @W( @@@@Q0C|P8S|2( @a`( @``ePkPT2(P @( @L(2 @s(0 @32P` P@I P@,  R,h1( @O( @(1( @!Π( @1:000( @A( @\0( @"( @@@ -LP P R R* +Q@@R( R Q@@R$ R UQ@@r r 0Bt0 Q@@9Q@@qQ@@Q@@Q@@FQ@@ 0-L@ qrP00@@PPS@ЕuPr ?00r r 00r r 000 -LM@@@0( @aϠ( @ @451E(&r pDžR``@V `V Vf (0 @㑡( @ `rI PsWe@r r 0 V@ @V@ V@@U00U0SZZw U  U RF `VN 4@ r r 00r r 0r r 00'0( @c( @rI PsW <00A$t@U UX `V@V((K(0 @qp(  @n(0 @(  @`00 0 4@  -L M0@( @^( @00@r 00z/ @00KL -LM`@PArJ P0@ppwpppp ppp pp rppJ 0(p0 @0( @Pr r 00s0K2:x -LMP@sa`PrI pPwpv`( rI ?00(3 @0( @z/ Dq@T`rJ r`` p pz/ 0(|2 @@@(/0 @`rJ 0(@K((2 @J0( @p]B(1 @( (0 @UE UU U0 (( 1 @BϠ(  @((]B]B0(0 ($1 @ ( @(0 KrJ `p((0 @( (  @( (0 @( (  @( (80 @( (  @ p-LM1@P( @NϠ0( @=a  @(t1  ` @(`0 @`r `r V00s0P% z> @@@z? 0z> 0z? p0( @Π(  @Kp(,0 @FA@ ( @ -L -L 0-LM 0P0 d @Pd @Gd @>d @5d @,d @#d @d @d @d @ ( 0 @0@ 0 @(  @( 0 @0@3: @(t@ @0 0@K0 -L MP@K(3 @,0( @D @T*pP0h؛Ș(t3 @L(  @(<3 @N ( @(3 @0(  @(2 @2(  @(2 @4(  @(\2 @6(  @($2 @8(  @z(1 @:(  @l(1 @<(  @^(|1 @>(  @P(D1 @@(  @B( 1 @B(  @4(0 @D(  @&(0 @F(  @(d0 @H(  @ (,0 @J(  @ 0-L00@Q0 [@P(@T0 0-L M(@KP 00@  R 0 % K (0K&K @K0@(00 @(  @ -L0M@%K,KPCP%0[%bV@ PUU DKp 0SLPPPĴPīPPPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPУ ԤH PPPPPPPPPPPPPPPPPPPPPPPPPPPP$PPPPPPPPPP4:PPPPPPPPPPd̩TP HPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP(|> @0( @$K0S (> @@K, BKDK?KAK 0( @(= @S( @(|= @( @(@= @0( @ (< @( @(< @o( @(< @f( @(D< @( @d B`KAKD K@K(; @&( @\;( @( @(; @0( @?H;( @( @(; @̠0( @":( @( @ds tb0B`KAKDK@ K?K>0K(l: @Π( @Xj PH ooaEA En_r@q0ST(: @P  @(0@TNZ 0a CACrp\^49 @(`0(  @@T4 (P9aLAL @~|^\ @P ( @0@ (8 @aLAL~|^\(5: 8 @P0  @(@T (8 @͠u(h8 @0( @x((8 @( @i7( @IϠ( @0K&KP U(7 @:( @X (`7 @= 0 @(((7 @͠(@ .2 @ @@ , @0K&KP6( @( @00[/[-[.[ "0}AK B`KDK@ K?K<6( @( @0K&KP5( @( @/0[0[- [.[&0[  }"AKB`KDK@K? K>0K_x5( @( @D5 @(( @(5 @&( @4( @( @ (4 @(x4 @( @Xj PH aa EAE Qq@rPTx( 4 @P  @(0@TNZ aLA0Lq sRP43 @(`0(  @@T4 (\3aLAL @~|^\/ @P ( @0@ (3 @aLAL~|^\(2 @P0  @(@T (2 @(t2 @[( @(82 @i( @(1 @Q( @Xj P`H]aaEA EYQr@q0ST(1 @P  @(0@TNZ a AA0Ars^P4,1 @(`0(  @@T4 (0aLAL @~|6 : ^\ @P ( @0@ (0 @aLAL~|^\(T0 @P0  @(@T (0 @aY(0 @( @XB (L0 @@Ha`( 0 @P@X/U (0 @`( 0 @@X(0 @P`0( @@(1 @`( 0 @XT1 @(( @ (1 @z( @XR Xl X(1 @}( @2( @E( @2c h0iB`KAKDK@ K?0K>Ka(2 @( @2( @F( @a1 3a0B`KAKDK@ K?K>0K9 3( @c( @xAK hi0sBKD K@K?0K>K(3 @( @X Pq0B`KUA0KDK U" U 3 @(0( @`44( @( @ (p4 @(4 @( @=(4 @( @X_ X X (5 @(45 @( @`0(  @\`0(  @`0(  @f(5 @`( 0 @(6 @`( 0 @(H6 @`( 0 @|6 @(( 0 @6( @.( @0[/0[- [.[ &0[ { ( 7 @ (7:<7 @rϠ(T7 @( @(7 @Π( @{(7 @( @@PK(8 @( @](D8 @(  @(|8 @v( @@PK -LMPP@`8SX (08R/ pM?@8 8pK  @( 0 4 , , 8S  P P @@@0 R0 8 ,0c 8 K@@@    0 1 1 1 0 S00008x> 0-L@@@P 1 1R  Q  a" a0 0R0@ (0Q0, 0000@, (Q0x> -L$M@@@0KP8P@$(R$80%8hV V 0@[T(K DpK*(9 @D@K( 0 @Z @c`(8 @( 0 @B[ Q{ l8( @Z( @B[!B[(8 @](A0[ @(7 @_D0[(0 @D [ P@(7 @`,0K( 0\ @@D [t@PTP@7( @e( @P- C[PDKZg/0[Sn S_6( @o( @08&8N(t6 @(  @(86 @Ϡ&8( @pp&8S S(/0[S%\ SA \ 5`(h @WSP( @(58: @_P((0 @(H5 @P)(0 @( 5 @P*(0 @(4 @P+(0 @(4 @P,(0 @(X4 @P-(0 @(4 @P.(0 @(3 @P/(0 @(3 @P0(0 @(h3 @P1( 0 @(,3 @P2( 0 @(2 @P3( 0 @(2 @P4( 0 @(x2 @P5( 0 @(<2 @P6(0 @(2 @P7(0 @(1 @^( @%h1( @:( @(T1 @;C@(%8 @%&h1( @i( @ /0[(&(~0(( @O( @%%&0s%%((\0 @F(x( @%%/0[&xp%Ld4 -L400@ -L@4 # -Lr:  -Lr<  -LrU p -L M@@ "40KKP[0KKP s [dPK -LP` 0-L4P00@@P0 @P#"@ 00 -L@@00@ `PpV P4 |e\Z `PV% 4P`|X9 `h vP`Va9 : n\l\ʴan\l\ʲ`\l\aPnUPeUʴaPnUPeUʲQP`UPeU4P`|X`f^n^ʴ`nV`fVʲQP`UPeUڰdU@ pP4 ~`P'p PnUPeU ʴQpgWpgWʲ`QaQ , `4~e\P nQaQʴPeUPeUʲ `^n^ -L(@@, 0-LMqblhdmi:: _SetAttrhdmi_IsChange_AttrDRV_HDMI_SetAttrhdmi_CheckAttrDRV_HDMI_SetParamhdmi_CheckParamDRV_HDMI_SetAVMuteDRV_HDMI_SetFormatDRV_HDMI_SetxvYCCModeDRV_HDMI_SetDeepColorDRV_HDMI_StopDRV_HDMI_CloseDRV_HDMI_DeInitDRV_HDMI_Inithdmi_StartDRV_HDMI_Starthdmi_ProcHotPlugDRV_HDMI_NotifyEventhdmi_ProcEventDRV_HDMI_OpenHdmiDevIoctlHdmi_KThread_CEC+KrTTHv0csc_ct_modeSI_CloseHdmiDeviceSI_SetAudioPathSI_CEC_GetCommandSI_CEC_Interrupt_ProcessingSiI_CEC_SetCommandSI_UpdateTX_656SI_UpdateTX_DESI_Set_DEBUG_FlagDecodeStandardTimingParsingShortTimeDescriptorBlockSI_EDID_Force_SettingSI_GetHdmiSinkCapsParsingCEADataBlockCollectionParsingVideoDATABlockParsingShortAudioDescriptorParsingSpeakerDATABlockParsingVendorspecificDATABlockParsingUseExtenedDATABlockSI_Proc_writeEDIDBlockSI_PrepareEDIDSI_GPIO_ReadBitSI_GPIO_WriteBitSI_GPIO_SetDirBitA B C D EFBasicParseABCDEFGHI J K L M NOPQRSTUVWXYZSI_ParseEDIDCheckFor861BExtensionDecodeEstablishTimingParseTimingDescriptorsParsingDetailedTDPart1ParsingDetailedTDPart2ParsingDetailedTDPart3SI_Force_GetEDIDSI_MDDCTakeBlockFromFIFOSI_AutoRiCheckPrintRiFalureInfoSI_AutoRiFailureHandlerSI_ReadKSVList_TimeoutSI_AuthenticationMakeCopyM0SI_ReAthenticationSI_IsHDMICompatibleSI_TX_SetHDMIModeSI_Init_DVITXSI_SW_ResetHDMITXSI_hdmiPhyInitSI_HW_ResetHDMITXSI_Start_HDMITXSI_SendGamutMeta_PacketSI_SendCP_PacketSI_SendAVIInfoFrameWaitBuffReadySI_TX_SendInfoFramexSI_Set_VSI_3D_SidebySide_HalfSI_Set_VSI_3D_TopandBottom_HalfSI_Set_VSI_3D_FramePackingSI_TX_SendInfoFrameSI_HotPlugInOrOutSI_InterruptHandlerConvertMDDCStateIntoErrCodeSI_BlockWriteMDDCFifoSI_BlockReadMDDCFifoSI_DDC_DebugSI_BlockWrite_MDDCSI_BlockRead_MDDCSHSTransformGetByteBStatusMXSI_SHAHandlerSHAInitComp;:areViPrintOutputStatusSI_timer_diffSI_GetHDMIOutputStatusSI_SetOutputModeSI_PrintAuthStateSI_timer_countSI_EDIDProcessingSI_OutputProcessingSI_timer_stopSI_Check_OutputStatusSI_TimerHandlerSI_TMDS_setup@5,~hVSI_GetVideoPathSI_ConfigTXVideoModeSI_SetDeepColorSI_SetVideoPath51517362SI_CEC_AudioPingcec_PrintLogAddrSI_CEC_SendCommandcec_msg_validatecec_RX_MSG_OperationSI_CEC_Event_Handlercec_ParsingRecevedDataPrintCommand10b`# p  #`!0  pZ z$><  pZ z$>< #pr(n#p28,XL pw>r pw>r## pw|r&## pw|r& ## pw|r& ## pw|r& ##ph @ L ##ph @ L ##ph @ L ##ph @ L##p $|x #:pe)8,$X `q,@@'D  `q,@@'D #(#P e8,( q@? q@?## 8 ~## 9 ~## : ~## q@ @0<: ## 8@ 0## 9@ 0## :@ 0##q,@'#:P e)8,$ #` e)8,$~!# P e)8,$"# e)8,$#$##0*jh $@ @ %&##0* q'@ @(0'##  `>8W (##:'P e8,()##:'(*+##'`,@@'D ,-##'`q@?E .##9.e8,XL/##9.r(nL01##.Z z$>< 23##.Z w>945##0* N`q,@@'D 67##0* N`q@?E 89##0*]Z z*>< :;##0*]Z w>9<##N ## `?## 8!-H*l$@## j  #`!0 A##N q@( B##N LH@ C##4!@8 D##q XHE# t XX(F##3 Xx@8%G##VL q XPH##:!w X@ I#dp@&(#J##L_0&#K##O  `L##$4!`(0=:'`$0M##0*L@#` @N#H?pp1@0.0@O##pp  P0P##c@@Q##'%@PR##-$!)`&PS##0*p'p$8`T##:4!2/@U#0*r*h)p&0V##4N*)&W##=6!0/@X#f!rpPp@Y##t'k8px P0Z##/nHAx$x X[##<?hK.xh\##F0!xQ4x0h]##Ddp1@.0@^##IXp1@.0@_##OLp1@.0@`##Y4!p1@.0@a##Op r1@.Hb##eL 8H@E``c##AUp @.@p+``d##pL @k@ph`e #(<k p  P0f##}Kd *$Pg##_E0 (4.Xh##m-!@ 0;5`i##h[p( (;8Xj##tLP @;8`k##tLP @;8`version=Hi3521_MPP_V1.0.0.0 license=Proprietaryauthor=Hi3531 MPP GRPparm=csc_ct_mode:1: apply new csc contrast adjust mode.parmtype=csc_ct_mode:intsrcversion=3FA7D687D6F96CD0515A763depends=vermagic=3.0.8 mod_unload ARMv7 hdmi<6>unload hdmi.ko ....OK! [Func]:%s [Line]:%d [Info]: come to>: hdmi_Close HdmiId %d is invalid. HdmiId %d is NOT open. ptr is NULL. %sHdmi register failed Hdmi PROC register failed Hdmi Mod register failed <6>load hdmi.ko ....OK! Hdmi not ready! Enter DRV_HDMI_GetDeepColor Enter DRV_HDMI_GetInfoFrame Leave DRV_HDMI_GetInfoFrame Enter DRV_HDMI_GetAttr Leave DRV_HDMI_GetAttr Ha we get a event!!!!!! HDCP Authentication Fail times:50! Enter DRV_HDMI_SetCECCommand CEC do not start Invalid enSrcAdd:0x%x Leave DRV_HDMI_SetCECCommand Enter DRV_HDMI_Extern_GetEDID Leave DRV_HDMI_Extern_GetEDID Enter DRV_HDMI_GetSinkCapability GetHdmiSinkCaps error. Leave DRV_HDMI_GetSinkCapability ########### Hisi HDMI Dev Stat ########### HDMI driver do not Open #################### END ################## HPD Status: Out HPD Status: IN HDMI do not Start! TV: Power On TV: Power Off EDID Parse Status: Ok EDID Parse Status: Fail TV ManufactureName: %s HDMI Sink video capability : TV support: 1080P_60 TV support: 1080P_50 TV support: 1080P_30 TV support: 1080P_25 TV support: 1080P_24 TV support: 1080i_60 TV support: 1080i_50 TV support: 720P_60 TV support: 720P_50 TV support: 576P_50 TV support: 480P_60 TV support: 576i_50 TV support: 480i_60 TV support: 640X480_60 TV support: 800X600_60 TV support: 1024X768_60 TV support: 1366X768_60 TV support: 1400X900_60 TV support: 1400X900_60_RB TV support: 1600X1200_60 TV support: 1680X1050_60 TV support: 1920X1200_60 TV support: 2048X1152_60 CEC Status: ?: ON CEC Physical Add: %01d.%01d.%01d.%01d CEC Logical Add: %01d CEC Status: OFF HDMI Output Attribute: HDCP Encryption: ON HDCP Encryption: OFF HDMI PHY Output: Enable HDMI PHY Output: Disable *****HDMI is abnormal, You can not get HDMI Output****** Video Output: Enable Video Output: Disable Video Format: 1080P_60 Video Format: 1080P_50 Video Format: 1080P_30 Video Format: 1080P_25 Video Format: 1080P_24 Video Format: 1080i_60 Video Format: 1080i_50 Video Format: 720P_60 Video Format: 720P_50 Video Format: 576P_50 Video Format: 480P_60 Video Format: 576i_50 Video Format: 480i_60 Video Format: 640X480_60 Video Format: 800X600_60 Video Format: 1024X768_60 Video Format: 1280X1024_60 Video Format: 1366X768_60 Video Format: 1440X900_60 Video Format: 1440X900_60_RB Video Format: 1600X1200_60 Video Format: 1920X1200_60 Video Format: 2048X1152_60 Video Format: Unknown:%d Video Output mode: RGB444 Video Output mode: YCbCr422 Video Output mode: YCbCr444 Video Output mode: Unknown:%d Video DeepColor mode: 30bit Video DeepColor mode: 36bit Video DeepColor mode: 24bit Video DeepColor mode: off Audio Output: Enable Audio Output: Disable Audio input format: I2S Audio input format: SPDIF Audio input format: HighBitRate Audio input format: Unknown:%d Audio sample rate: %dHz HDMI Mode: DVI HDMI Mode: HDMI AVI Infoframe: Enable AVI Infoframe: @): Disable AUD Infoframe: Enable AUD Infoframe: Disable MPG/VendorSpec Infoframe: Enable MPG/VendorSpec Infoframe: Disable Gamut Metadata Packet: Enable Gamut Metadata Packet: Disable Generic Packet Packet: Enable Generic Packet Packet: Disable AVMUTE: Disable AVMUTE: Enable AVMUTE: Unknown:%d AVI Inforframe: 0x%02x, AUD Inforframe: MPg/VendorSpec Inforframe: (3D:FramePacking) (3D:Top-and-Bottom) (3D:Side-By-Side half) EDID Raw Data: %02x [HDMI] Version: [Hi3521_MPP_V1.0.0.0 ], Build Time[May 4 2014, 19:32:07] -----MODULE PARAM-------------------------------------------------------------- -----HDMI STATE---------------------------------------------------------------- %s%s%s%s DevId Open Start Eventny%6u%6s%6s%9s pstAVIInfoFrame->enOutputType:%d Error Output format ******* Active Format aspect ratio set to 0x1000:Same as picture aspect ratio error video timing mode:%d Get Video Code index:%d, Mode:0x%x, VidIdCode:0x%x Sepcail setting:change pstVidCode(480p_60 16:9):%d-->%d Sepcail setting:change pstVidCode(576p_50 16:9):%d-->%d Sepcail setting:change pstVidCode(576i_50 16:9):%d-->%d Sepcail setting:change pstVidCode(480i_60 16:9):%d-->%d do not need to change VIC Enter DRV_HDMI_SetInfoFrame enOutputType should not be YCBCR422, not support. Leave DRV_HDMI_SetInfoFrame Invalid param Luma is %d Invalid param Contrast is %d Invalid param Hue is %d Invalid param Satuature is %d Csc matrix should be rgb_to_601 gb_to_709 gb_to_rgb when rgb444 input! Not support config csc when input YCbCr444! Error:HDMI Attribute bEnableVideo Must be set to HI_TRUE! Same as before, do not need to setting! We do not need to update Video! The HDMI_VMode of HI_HDMI_VIDEO_FMT(%d) is invalid. The HDMI_VMode of HI_HDMI_VIDEO_FMT(%d) is %d. default u8VideoPath :0x%02x,0x%02x,0x%02x,0xA<: %02x HDMI Input RGB444, Output RGB444 HDMI Input RGB444, Output YCBCR444 Error output mode when input RGB444 HDMI Input YCBCR444, Output RGB444 HDMI Input YCBCR444, Output YCBCR444 Error output mode when Input YCBCR444, Output YCBCR422 HDMI Input YCBCR422, Output RGB444 HDMI Input YCBCR422, Output YCBCR444 HDMI Input YCBCR422, Output YCBCR422 setting video path u8VideoPath :0x%02x,0x%02x,0x%02x,0x%02x bVideoMode:0x%x out of siiSetVideoPath DE_CNTRL_ADDR:0x%x, Before RegVal:0x%x Neagtiv Polarity DE_CNTRL_ADDR:0x%x, change RegVal:0x%x Positive Polarity DE_CNTRL_ADDR:0x%x, change RegVal:0x%x From Jing:TMDS_CTL2[4]:term_en must be set to 1 for HDMI Eye-Diagram test High Bandwith 0x%x:0x%x low Bandwith 0x%x:0x%x default audio path: 0x%02x,0x%02x,0x%02x,0x%02x Audio input is HBR set audio path: 0x%02x,0x%02x,0x%02x,0x%02x bHDCPEnable:0x%x, bDebugFlag:0x%x SET hdmi video status Flag:%d SET hdmi audio status Flag:%d -->start: SI_Start_HDMITX -->start: SI_Init_DVITX Leave hdmi_SetAttr Enter DRV_HDMI_SetAttr Video should be enable Audio should be disabled when DVI mode Avi inforframe should be disabled when DVI mode Audio inforframe should be disabled when DVI mode Video mode should be RGB444 when DVI mode Video output mode should not be YCBCR422, not support. Deep color mode should be 24bit or off, other bits not support. Invalid param bEnableAudInfoFrame is %d Invalid param bEnableAudio is %d Invalid param bEnableAviInfoFrame is %d Invalid param bEnableHdmi is %d Invalid param bEnableVideo is %d Invalid param bIsMultiChannel is %d Invalid param bxvYCCMode is %d Invalid param enBitDepth is %d Invalid param enDeepColorMode is %d Invalid param enSampleRate is %d Invalid param enSoundIntf is %d Invalid param enVideoFmt is %d Invalid param enVidOutMode is %d hdmi_SetAttr Leave DRV_HDMI_SetAttr Error: input mode only can set YCbCr444/RGB444 Leave DRV_HDMI_SetParam Enter DRV_HDMI_SetAVMute, bAB?: vMute:%d Invalid bAvMute value %d Leave DRV_HDMI_SetAVMute Enter DRV_HDMI_SetFormat enEncodingFormat:%d HDMI have not start From EDID, sink can receive this format!!! Warring:From EDID, Sink CAN NOT receive this format******* change DISP Timing to enEncodingFormat:%d Set 1920X1080P_60000 enTimingMode:0x%x Set 1920X1080P_50000 enTimingMode:0x%x Set 1920X1080P_30000 enTimingMode:0x%x Set 1920X1080P_25000 enTimingMode:0x%x Set 1920X1080P_24000 enTimingMode:0x%x Set 1920X1080i_60000 enTimingMode:0x%x Set 1920X1080i_50000 enTimingMode:0x%x Set 1280X720P_60000 enTimingMode:0x%x Set 1280X720P_50000 enTimingMode:0x%x Set 720X576P_50000 enTimingMode:0x%x Set 720X480P_60000 enTimingMode:0x%x Set PAL 576I_50000 enTimingMode:0x%x Set NTS 480I_60000 enTimingMode:0x%x Set 640X480P_60000 enTimingMode:0x%x DVI timing mode enTimingMode:0x%x Force to DVI Mode enVidOutMode:%d ***hdmi_SetInfoFrame for AVI Infoframe ***hdmi_SetInfoFrame for AUDIO Infoframe hdmi_SetAttr in change TimingMode Leave DRV_HDMI_SetFormat enable xvYCC INF_CTRL2(0x%02x) is 0x%02x RGB2XVYCC_CT (0x%02x) data is 0x%02x Disable xvYCC end of HI_UNF_HDMI_SetxvYCCMode Enter DRV_HDMI_SetDeepColor Invalid param enDeepColor (%d) Leave DRV_HDMI_SetDeepColor Enter DRV_HDMI_Stop Leave DRV_HDMI_Stop Leave DRV_HDMI_Close Enter DRV_HDMI_DeInit g_HdmiInitNum:0x%x HDMI has been deInited! end HDMI Timer thread. ret = %d end HDMI CEC thread. ret = %d Leave DRV_HDMI_DeInit Do not register NULL HDMI callback addrr FromUser:HDMI has been inited! come to SI_HW_ResetHDMITX set CEC_SETUP ReadChipInfo HDMI: Id 0x%02x.0x%02x. Rev %02x create Timer task kThreadTimer:0x%x HDMI_kthreadUnable to start hdmi kernel thread. HDMI_kCECWriteDefaultConfigToEEPROM Leave DRV_HDMI_Init HDMI release green channel Before TX_SYS_CTRL1_ADDR:0x%x After TX_SYS_CTRL1_ADDR:0x%x HPD Callback detect new HPD HPD Callback with Auth detect new HPD try to open C*:HDCP Auth Enter DRV_HDMI_Start Leave DRV_HDMI_Start Output already --- MCE Get HDMI event: HOTPLUG. --- SI_GetHdmiSinkCaps err! SI_GetHdmiSinkCaps ok! No Connect ! Connect ! hdmi_ExtIoctl CMD_HDMI_GET_ATTR ok! ***Warrring:From EDID, Sink CAN NOT receive this format:%d*** hdmi_ExtIoctl CMD_DISP_GET_FORMAT err! hdmi_ExtIoctl CMD_DISP_GET_FORMAT ok! ***Error: Unsupport Video timing:0x%x ***hdmi_ExtIoctl CMD_HDMI_SET_INFORFRAME err! hdmi_ExtIoctl CMD_HDMI_SET_INFORFRAME ok! hdmi_ExtIoctl CMD_HDMI_SET_INFORFRAME err! ret:0x%x hdmi_ExtIoctl CMD_HDMI_SET_ATTR err! ret:0x%x hdmi_ExtIoctl CMD_HDMI_SET_ATTR ok! hdmi_ExtIoctl CMD_HDMI_START err! hdmi_ExtIoctl CMD_HDMI_START ok! HDMI EVENT TYPE:0x%x set Interrupts bit Unknow Event:0x%x callback finish wake up event g_HDMIWaitFlag:0x%x MCE HDMI event: HDCP_SUCCESS! Enter DRV_HDMI_Open HDMI hasn't been Inited! SI_HPD_Status():%d tempOutputState:%d Warring:Force to send out a HotPlug Event! Leave DRV_HDMI_Open cec disabled, can't get cec status. unkonw cmd:0x%x CEC is build up ***** HOT PLUGNO PLUGEDID FALHDCP FALHDCP SUCHDCP RST[Func]:%s [Line]:%d [Info]:MDDC_STATUS_ADDR regvalue:0x%x loop untill DDC to idle status regvalue:0x%x timeout is occur [Func]:%s [Line]:%d [Info]:abAudioPath setting auido path:0x%02x,0x%02x,0x%02x,0x%02x use SDIF set HBRA in Audio Path use I2S Set AUDP_TXCTRL_ADDR to AUD_MODE_ADDR:0x%x AUDP_TXCTRL_ADDR:0x%x [Func]:%s [Line]:%d [Info]: RX: HDR[0x%02X],OpCode[0x%02X], Count:%d, Oprand[0x%02X, %02X, %02X] Nex Status:0x%x A6A7Reg: %02X %02X !CEC_A7_TX_RETRY_EXCEEDED![%02X][%02X] Interrupt CEC Rx Status do not set! [%02X][%02X], bTmpRXState:[%02X] Receive Frame pInt->bRXState:0x%x CEC RX Overflow, Flush Rx FIFO TX: Dest[0x%02X],OpCode[0x%02X], Count:%d, Oprand[0x%02X, %02X, %02X] [Func]:%s [Line]:%d [Info]:Vmode=%d. VxH=%dx%d@%d. VxH=%dx%d@Custom. VxH=%dx%d@%d. VxH=%dx%d. D0: [Func]:%s [Line]:%d [Info]:***Specail doing for No HPD test Mode %i Mode %d wasn't defined! Hor Act pixels %i Aspect ratio: 16:10 4:3 5:4 16:9 Refresh rate %i Hz ID %i <--[Native mode] g_forceHDMIMode:%d Force to HDMI Mode Force to DVI Mode 2 set g_bHdmiEdidPrepareOk:%d to true Cable Out, g_stSinkCap.bConnected:%d! Green channel SI_GetHdmiSinkCaps g_bHdmiEdidPrepareOk:0x%x EIDI Parse Error, Need to force setting ParsingCEADataBlockCollection EDID AddrTag:0x%02x-->tag:0x%x ParsingVideoDATABlock %s BaseAddr:%x ShortTimeDescriptor CEA861 Modes: ParsingAudioDATABlock Audio Format Code %i: Liniar PCM AC-3 MPEG-1 MP3 MPEG2 ACC DTS ATRAC reserved Max N of channels %i Fs: 32 KHz 44 KHz 48 KHz 88 KHz 96 KHz 176 KHz 192 KHz Supported length: 16 bits 20 bits 24 bits Maximum bit rate %i KHz ParsingSpeakerDATABlock Speakers' allocation: FL/FR LFE FC RL/RR RC FLC/FRC RLC/RRC VENDOR_TAG in EDID IEERegId:0x%02x, 0x%02x, 0x%02x This is HDMI Device This is DVI Device, we don't parse it PhyAddr %02x.%02x.%02x.%02x u8HDMI_Video_present:0x%x, u83D_Present:0x%x, u83D_Multi_present:0x%x u8HDMI_3D_LEN:0x%x, u8HDMI_VIC_LEN:0x%x Use Extended Tag UseExtened Include Video Capability Data Block UseExtened Include Vendor-Specific Video Data Block UseExtened Include Reserved for VESA Video Display Device Information Data Block UseExtened Include Reserved for VESA Video Data Block UseExtened Include Reserved for HDMI Video Data Block UseExtened Include Colorimetry Data Block UseExtened Include CEA Miscellaneous Audio Fields UseExtened Include Vendor-Specific Audio Data Block UseExtened Include Reserved for HDMI Audio Data Block UseExtened reserve error data size Error to check BIT_HPD_PIN in SI_PrepareEDID:0x%x SI_PrepareEDID Read EDID 1 set g_bHdmiEdidPrepareOk: to %d Caution:Force to DVI! ------- EDID InfE%:o ------- Can NOT read EDID. %02x We need to read %d * 128Bytes of extern E-EDID -------EDID Extern Info index:0-------- -----------end of EDID Extern Info:%d-------- Error EDID Extension No:%d, Only read 4 externsions ------- other EDID Extern Info index:%d-------- -----------EDID Extern Infoindex:%d-------- EDID Debug Begin, Block_Num:%d(*128bytes): %02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X,%02X EDID Debug End DVI mode 1 set g_bHdmiEdidPrepareOk:%d to true Do not support GPIO:%d GPIO Direction is input, write can not operate. xx code:0x%08x<--0x%02x, 0x%02x a:0x%02x,w found:%d Enter SI_ParseEDID BasicParse ERR=%d/%d Read first block extension flag add offset:0x%x, data:0x%02x CheckFor861BExtension ERR=%d NExtensions=%d is too big, force to 3 SI_ParseEDID NExtensions=%d, there are %d E-EDID need to receive!!!! CheckCRCof2ndEDIDBlock error:%#x. 720 x 400 @ 70Hz 720 x 400 @ 88Hz 640 x 480 @ 60Hz 640 x 480 @ 67Hz 640 x 480 @ 72Hz 640 x 480 @ 75Hz 800 x 600 @ 56Hz 800 x 400 @ 60Hz 800 x 600 @ 72Hz 800 x 600 @ 75Hz 832 x 624 @ 75Hz 1024 x 768 @ 87Hz 1024 x 768 @ 60Hz 1024 x 768 @ 70Hz 1024 x 768 @ 75Hz 1280 x 1024 @ 75Hz 1152 x 870 @ 75Hz No established video modes Standard Timing: Detailed Timing: Descriptor %i: H Active %i H Blank %i V Active %i V Blank %i H Sync Offset %i H Sync Pulse W %i V Sync Offset %i V Sync Pulse W %i H Image Size %i V Image Size %i H Border %i V Border %i Interlaced Non-interlaced Table 3.17 for defenition Normal Display: Digital Analog Only one Externsion EDID occurs ParsingCEADataBlockCollection error:%#x. DTV monitor supports: Underscan Basic audio YCbCr 4:4:4 YCbCr 4:2:2 Native formats in detail descriptors %i More than one Externsion EDID occurs NExtensions:%d We do special setting for this format end of SI_ParseEDID setting index***F&:* index:%d, Format:0x%02x **** read edid failed [Func]:%s [Line]:%d [Info]:%s timeout _IIC_NOACK [Func]:%s [Line]:%d [Info]:SI_AutoRiCheck ON=%d RI_READING_MORE_ONE_FRAME RI_MISS_MATCH_LAST_FRAME RI_MISS_MATCH_FIRST_FRAME MASK_RI_NOT_CHANGED Ri interrupt asserted %d times ****Timeout(%d, %d, diff:0x%x ms) in get KSVlist, ReAuthentication*** Need to reAuthentication 1 %s SI_CheckHDCPDevice ERROR %s NO_DEVICE_WITH_HDCP_SLAVE_ADDR new setting to create HDCP Auth1 Need to reAuthentication 2 Need to reAuthentication 3 Need to reAuthentication 4 HDCP AKSV(5):0x%02x,0x%02x,0x%02x,0x%02x,0x%02x Need to reAuthentication 5 HDCP BKSV(5):0x%02x,0x%02x,0x%02x,0x%02x,0x%02x MDDCBlockReadHDCPRX DDC_BKSV_ADDR ERROR MDDCBlockWriteHDCPRX DDC_AKSV_ADDR ERROR MDDCBlockWriteHDCPRX DDC_AN_ADDR ERROR NO_ACK_FROM_HDCP_DEV BKSV_ERROR Need to reAuthentication 6 Need to reAuthentication 8 R0s_ARE_MISSMATCH. AreR0sMatch Error:NO_ACK_FROM_HDCP_DEV M0 MX_TX :0x%02x,0x%02x,0x%02x,0x%02x,0x%02x,0x%02x,0x%02x,0x%02x 5s is %d jiffers Enter Protocol step 2:repeater authetication Exchange KSVs ok. HDCP AUTO Check RI Sink is in standy mode RSEN is power SI_ReAthentication AuthState:%d Output is DVI mode, Call SI_Init_DVITX() 0x%x:0x%x Reload KSV from OTP HDMI receive is sink device, enter hdcp protocol 3 [Func]:%s [Line]:%d [Info]:-->SI_IsHDMICompatible. SI_ByteReadEDID Error=%d NumOfExtensions=%d SI_ByteReadEDID BLOCK_HEADER Error=%d SI_ByteReadEDID BLOCK_HEADER Data=%d SI_ByteReadEDID VERSION_THREE Error=%d SI_ByteReadEDID VERSION_THREE Data=%d SI_ByteReadEDID VERSION_THREE BLOCK_HEADER OK SI_ByteReadEDID MaxBlockOffset Error=%d [HDMITX.C](SI_Init_HDMITX): Sink is HDMI Compatible Set HDMI mode to %d. AUDP_TXCTRL_ADDR:0x%x Enter SI_Init_DVITX. SI_Init_DVITX to SI_SetVideoPath bVideoMode:0x%02x, abData[0]:0x%02x, abData[1]:0x%02x, abData[2]:0x%02x, abData[3]:0x%02x [HDMITX.c](SI_Init_DVITX): Call SI_TMDS_setup() G3: [HDMITX.C](SI_Init_DVITX): TMDS_SETUP_FAILED <=== SI_Init_DVITX: Done. HDMI_INT_MASK_ADDR:0x%x, CLR_MASK:0x%x NO_HDCP --> SI_SW_ResetHDMITX SoftReset TMDS is not stable!! TMDS_CTL2 set to:0x%x --> SI_HW_ResetHDMITX. Start HDMI TX Sink is HDMI Compatible! SI_Start_HDMITX to SI_SetVideoPath bVideoMode:0x%02x, abData[0]:0x%02x, abData[1]:0x%02x, abData[2]:0x%02x, abData[3]:0x%02x avi infoframe send no avi infoframe send audio infoframe send disable Audio inforfarme Begin to HDCP Authenication! NO_HDCP <==== startHDMITX: Done [Func]:%s [Line]:%d [Info]:After write Gamut Meta Packet data is: 0x%02x, INF_CTRL2:0x%x MUTE=%u. CP_Packet do not DiSable before setting Read AVI Data open AVI packet en/repeat open AVI packet en/repeat2 open AVI packet en/repeat3 open AVI packet en/repeat4 Debug AVI output: 0x%02x End of AVI inforframe force to set Infoframe buffer ready!!!!!!!!! Debug Info frame output length:%d End of Info frame 3D side-by-side Mode 3D Top-and-Bottom Mode 3D FramePacking Mode [Func]:%s [Line]:%d [Info]:GetSysStat():0x%x, ucNewStat=0x%x, uRSEN:0x%x wwGetSysStat():0x%x, jiffies:0x%x 0GetSysStat():0x%x, jiffies:0x%x 1GetSysStat():0x%x, jiffies:0x%x 2GetSysStat():0x%x, jiffies:0x%x BIT_INT_HOT_PLUG!!!!! interupthandler: %x %x %x %x, jiffies:0x%x BIT_INT_RSEN!!! Encrypt Disable!!! [Func]:%s [Line]:%d [Info]:MDDCState is BIT_MDDC_ST_I2C_LOW MDDCState is BIT_MDDC_ST_NO_ACK MDDCState is MASTER_FIFO_FULL Write MDDC_FIFO ucLen=%d Read MDDC_FIFO_ERR read %u/%u Byte. Debug hdmi DDC register: 0x%02x(0x7a, 0x%02x):0x%02x Finish %s SI_BlockWriteMDDCFifo Error=%d %s SI_BlockWriteHDMITXP0 MASTER_BASE Error=%d DDC read timeout, always in Progress! SI_BlockWriteHDMITXP0 MASTER_BASE Error=%d SI_BlockReadMDDCFifo error %s ConvertMDDCStateIntoErrCode Error=%d [Func]:%s [Line]:%d [Info]:Digest value:0x%x, 0x%x, 0x%x, 0x%x, 0x%x BSTATUS:0x%x,0x%x Repeater:enter hdcp protocolH3: 2 REQ_SHA_CALC BStatusReg[0]:0x%x, BStatusReg[1]:0x%x Reach Max device/deep, Reauthenicatin!!! KSVSize(DEVICE_COUNT*5):%d read KSV List SHAInit:0x%x,0x%x,0x%x,0x%x After SHAInit sha->Digest:0x%x, 0x%x, 0x%x, 0x%x orignal: 0x%02x, new: Begin GetKSVList debug Aux:%d 0x%x, Byte sequence in Sha->Data is: [%d]:0x%x, ***nEnd of GetKSVList debug*** Sha->Digest[%d]:0x%x, VPrime:0x%x CompareVi is Result 0x%x ***** SI_SHAHandler ok, enter hdcp protocol 3 SI_SHAHandler(hdcp protocol 2) fail [Func]:%s [Line]:%d [Info]:: Cable unplug **** Plug Out **** **** Plug In **** : Cable plugin - OutputState=check EDID : Cable plugin - OutputState=EDID OK : Cable plugin - OutputState=EDID Corrupt : Cable plugin - OutputState=HDMI Out : Cable plugin - OutputState=DVI Out Unknown %d duration:%u ms set OutputState:%d ---> OutputState=%d Call SI_Init_HDMITX() OutputState == CABLE_PLUGIN_HDMI_OUT, and TX is IN HDMI. Call SI_Init_DVITX() OutputState:%d, NOT processed. {AuthState}: No HDCPNo HDCP Dev with HDCP Slave AddrNo ACK from HDCP devBKSV ErrR0 ErrRi ErrAuthenticatedRptr Auth. ReqReq SHA calcReq SHA HW calcV ErrReauthentication ReqReq authenticationUnknown %02i come to here force setting SI_ParseEDID ok, DisplayType:%d, OutputState:%d finish SI_EDIDProcessing SI_ParseEDID err! SI_OutputProcessing GetSysStat():0x%x, jiffies:0x%x HDMI Isr set CABLE_PLUGIN_CHECK_EDID HDMI Isr set CABLE_UNPLUG_ HDMI Event finish, timer duration:%u ms force to set HDMI Status OutputState:%d, OldOutputState:%d SI_HPD_Status():%d need to reset g_bHdmiEdidPrepareOk to False in Unplug After SI_EDIDProcessing, OutputState:%d. Try to Begin to HDCP Authenication! force HDCP stop timeout to read KSVList Need to reAuthentication 9 Need to reAuthentication 10 hdcp protocol 2:come to SI_SHAHandler HDCP Flag is change, force to NO_HDCP! [Func]:%s [Line]:%d [Info]:Start... [TXVIDP.I&:C](SI_TMDS_setup): 0.5x tclk [TXVIDP.C](SI_TMDS_setup): 1.0x tclk [TXVIDP.C](SI_TMDS_setup): 2.0x tclk [TXVIDP.C](SI_TMDS_setup): 4.0x tclk SI_GetVideoPath SI_ConfigTXVideoMode in:0x%02x: out:0x%02x, TblVal:0x%x, RegVal:0x%02x [TXVIDP.C](SI_SetDeepColor): Set Deep Color VID_ACEN_ADDR bDeepColor:%d [TXVIDP.C](SI_SetDeepColor): Set Deep Color AUDP_TXCTRL_ADDR:0x%02x, data:0x%02x TMDS_CTL3 old walue:0x%x SiI_DeepColor_30bit SiI_DeepColor_36bit SiI_DeepColor_24bit(normal) SiI_DeepColor_Off TMDS_CTL3 new walue:0x%x SI_SetVideoPath bVMode:0x%02x SI_SetVideoPath setting video path:0x%02x,0x%02x,0x%02x,0x%02x [TXVIDP.C](SI_SetVideoPath): TMDS_SETUP_FAILED SI_SetVideoPath end [Func]:%s [Line]:%d [Info]:REG__CEC_AUTO_PING_CTRL:0x%x CEC Auto Ping Result:0x%x [%02X] TVRecDev1RecDev2STB1DVD1AudSysSTB2STB3DVD2RecDev3Res1Res2Res3Res4FreeUseBrocastMSG Send Ping cmd Selft Message, ignore Message is not sent to us CEC_RX_DEST:%d FEATURE ABORT Init:%d, Dest:%d, opcode:0x%x ABORT MESSAGE ACTIVE_SOURCE It should be source cmd, ignore! IMAGE_VIEW_ON TEXT_VIEW_ON INACTIVE_SOURCE, No supprot REQUEST_ACTIVE_SOURCE, return Active Source ROUTING_CHANGE, it should be brocast message ROUTING_INFORMATION, it should be brocast message SET_STREAM_PATH STANDBY! It should brocast message CEC_VERSION: %c%02x GET_CEC_VERSION, Response GIVE_PHYSICAL_ADDRESS, Response return REPORT_PHYSICAL_ADDRESS REPORT_PHYSICAL_ADDRESS Error oprand length:%d PhysicalAddr:%01d.%01d.%01d.%01d, LogicalAddr:%d GET_MENU_LANGUAGE, response SET_MENU_LANGUAGE:DECK_CONTROL DECK_STATUS GIVE_DECK_STATUS PLAY DEVICE_VENDOR_ID:%02x GIVE_DEVICE_VENDOR_ID, Response SET_OSD_NAME:%s SET_OSD_NAME:MENU_REQUEST Invalid OperandLength:%d Active Deactive Query Unknown, pOperand[0]:0x%x MENU_STATUS: USER_CONTROL_PRESSED Press RC:0x%02x USER_CONTROL_RELEASEJ%:D Release RC:0x%02x GIVE_DEVICE_POWER_STATUS, response REPORT_POWER_STATUS Power On Stand By GIVE_AUDIO_STATUS !Unsupported bOpcode:0x%x Feature! ! Unsupported Brocast Msg! response! ping bTXState:%d, SI_CEC_TX_WAITCMD:%d request ping %X NoAck Ack end of send command index:%d, result:%d end NoAck Ack %i frames in RX FIFO Deal with %i frames in RX FIFO We should ignore this message, it is sent from ourself [FROM][TO][OPCODE] (OperandLegth){OPERANDS}: [%02X] (%02X) {%02X}4$($`$`$``8$8 $ ` $ ` $ ` $ `$`$8`8P@PP8P@P P@ @P@ P@P8 ]8 ]8! a8"K0: !u8""0u8##$#$`%%P@ @    hi3521_hdmiGNUm+:t0b {܅A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (L*:Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rel.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 x)0D% X8t\4 0G#C hOX2xbk0Rg  w@Rs X ZpZ/Z4bglr L-  M?:  "$.8,>dOD\ a f@i$ n@ fsp xX } f\ .D fT< f xft x f   f  < \ f|  fhlf  f,8      8 f$X *x f,00 6 < fBN Tt Z ` f l r8 x\ ~|   D      @ d   |      d <    T ,   & , 2h 8D >  D J P( V \ c j q x     N<:     4 X |      0 T      8  ' . 40 :P @ F M TX [ a gx n@ ud | 4 8 `     $ H l    ( | P P   d L  $   8 % , 3 : A H O V ] d k/ }    f2(2f22f33h   l   0 f99   f;; 8 T t   fBBB(   $ +\ 2 9 @ G N U  \$ c j, qD x $ @ L     P t O):x   D fQQd h    p 0     \ ' . 5 <( CT Jx Q X _ f m tt {P ,   f]$]  f$_,_, T p f , f $fE  T c  r    4 L d |      " 1 0< 4K PV Te hp p { |   ,  < P d t    + : I X g v 0  < L ` x     4     * 1 ; G8 O  f g  v h l(   f f  f  ( ,, X h l ) < J Z f z xfX\- @a-  i<- nl- f@ @f  fQ:- L\- Ta- n- x- s. i- fT Tf- f\L. dah. i. n. }P/ s/ x. t/ f/ ffd d x fL. \/ a/ n,0 x<0 i0 ff  f/ \H0 ad0 0 0 i0 x0 s0 }0 0 0 n0 f(,,x1 1 ffĴȴ2 01 X1 l1 D1 f\`1 1 1 1 1 ft|CdL]|(2 H2 $h2 *2 02 t5 f`83 24 \4 <2 62 fh4 |4 4 :4 @5 H5 44 f 3 r43 xL3 >3 3 `3 Z3 T3 2 P2 N2 l(3 f<P4 L4 D4 @4 &R:84 ,04 [L7 V7 6 6 |6 D6 .5 5 5 7 3 3 3 x3 l3 `3 ~T3 3 D3 J3 3 f 7 f|7 7 88 h8 ap8 9 9  : <: T8  8 8 8 89 t8 l9 9 0: 7 ff0T'|: d: ff fff {H|: M: f$\: n; u; cX; jx; q; x; g`= |= F= = 8= $= = < < < < < < p< \< H< T4<  <  < ? ?  @ 8@ L@ h@ O> d? L= < f= = = = = > > 0> D> X> l> |> ,> 3> V> ]@? }d? t? ? ? HX? AS: > :> %> p@ f\f ,@`x &4BP ^4lH ~T `4   4 fH0 fD H0L>PlJSC`& f f^4\@ H a@ fH mH f@  {P\@ d a@ }XA s@A nA x$A i@ f  xA f   ` B B B PD C A A A DB tC C `B |B HC *C B 0 D $C C C <4D 6xD ND fpxD TD ZD  E f\E lhE `0E rE ffd d t      f f@ f  \E  aE F iE nF xDF sT:lF }F F G !TPG hG fD#H#G G H xH H H HH f''H H f) )I fh*l*I f++,0I $@I *\I 0I 6 J `J TlJ N$J <I P@J f1f ( 7 F U$ c8 qH \ fE f,111\J l aJ iJ nJ xJ sJ f77K } K 0K LK hK K K K f??@XK fLBPBL (L fF FW \W 4W W DW pW JW W ff8 s8 L \ t          fdR f4,48>C@ \X a4X nhX i@X sX xX }X  fX f̏Џ0_ 8D_ r] _ _ ^ $\ x] _ _ <\ N\ ` ` _ 8^ ` _ ` _ ffa a (b \b db pb a aa a pa a a VDa [Ta a ha \a fLf    ( 7FU4dLsd f  f [ fhp>>>>>Xftf f f f #   ! f  {0|) ,) 5JbHp+D8` cL`Gdb$+`u,$c 8N$FX:pHb`r  L|Px4@8G#4.$<lNcs$Xl"x>,L   !ȴH,500Kzp\hj ttK(pDa@(t>$K(T47$M\tmp(z2L$DX`L,B@&09@Nar8pl T F70@d T,';F[ Plvwhl$p$\jHt +Dz<@lHW n~ML@<8\$8) /ptAPPH+Dev<'<lX(l#<DOH#L(0): F~4R g$}tN8|t<,$]Y: 8 h h& 4? LK V  d Ԕtu +` ; Tt a  p ?l !l!&!05!DD!@dY!L z!Th!L`!L,!L !h! !P "L"]/"N?"0V"Xh"p"Dm"$T""" "0"" # !# 0#P hD#($4]#dr# ||##Ę4##PB|###v# @$$"$ 7$5A$HdS$ ^$vx$$$V`$v$@$>$ )$V%<%D&%X;%(R%c%|$w%ax % x%H#$%% %~0%b% q& &K&1&l*C&$U&LK(k&4xy& p&!&DW`&Oh&Pi@ &D&XH&,|',_'2/'\ 6'>' F'$NP^'u'^'$'@''hML'@(,4()('L:(J(l@^(,n( }(D( (<(4(( ((Hl($)Z: ,)')\4)QxH)p `)0{)))t[)K() )`)4)ML*$h(*`:*`M*Į$e*|**`5*v* *K(* <* +%+4+ЏD+`N+p!$Y+xdl+$+ + +TP+|T+(++h`+4,Ȟ<,x 0#,1,?,X$Q,g,sw,>,,W, P,,y`, ,|U,,9-L-$-<:-G- _-P?Do-Hy}-h- -H-$a.LANCHOR0.LANCHOR1.LANCHOR2HDMI_NotifyHDMI_QueryStateHDMI_GetVerMagicHDMI_ModExit.LC0.LC1$d.LC2.LC3.LC5.LC4.LC6HDMI_ModInit.LC7.LC8HdmiProc.LC9.LC10.LC11HdmiIoctlHdmiDevIoctl.LC12hdmi_GetInfoFrame.LC13.LC14.LC15.LC16.LC17.LC18.LC19.LC20.LC21.LC22.LC23.LC24.LC25.LC26.LC28.LC27HdmiStbProc.LC29.LC32.LC33.LC35.LC36.LC37.LC38.LC39.LC40.LC63.LC34.LC31.LC41.LC67.LC68.LC69.LC70.LC72.LC73.LC74.LC75.LC99.LC42.LC44.LC43.LC48.LC47.LC46.LC45.LC62.LC61.LC60.LC59.LC58.LC57.LC56.LC55.LC54.LC53.LC52.LC51.LC50.LC49.LC30.LC76.LC103.LC106.LC107.LC108.LC109.LC113.LC114.LC115.LC138.LC139.LC132.LC116.LC117.LC118.LC119.LC120.LC121.LC122.LC123.LC124.LC125.LC126.LC128.LC130.LC131.LC133.LC134.LC135.LC110.LC100.LC71.LC64.LC65.LC66.LC129.LC102.LC112.LC77.LC87.LC127.LC104.LC105.LC101.LC111.LC78.LC79.LC80.LC81.LC82.LC83.LC84[:.LC85.LC86.LC89.LC88.LC90.LC91.LC93.LC92.LC98.LC95.LC94.LC137.LC136.LC96.LC97.LC140.LC141.LC142.LC143.LC144.LC145.LC146.LC147.LC152.LC149.LC148.LC151.LC150hdmi_SetInfoFrame.LC153.LC154.LC155.LC156.LC157.LC162.LC161.LC158.LC159.LC160.LC163.LC165.LC164.LC171.LC166.LC167.LC168.LC169.LC170hdmi_SetAttr.LC172.LC199.LC200.LC201.LC204.LC175.LC177.LC180.LC187.LC188.LC189.LC190.LC192.LC195.LC196.LC198.LC202.LC203.LC191.LC186.LC176.LC193.LC194.LC178.LC179.LC197.LC183.LC184.LC173.LC185.LC182.LC181.LC174.LC205.LC210.LC206.LC213.LC207.LC212.LC211.LC208.LC209.LC214.LC215.LC216.LC217.LC218.LC219.LC227.LC226.LC225.LC224.LC223.LC222.LC221.LC220.LC229.LC228.LC230.LC231.LC232.LC233.LC234.LC236.LC237.LC254.LC257.LC258.LC238.LC255.LC256.LC235.LC239.LC240.LC241.LC242.LC243.LC244.LC245.LC246.LC252.LC253.LC247.LC248.LC250.LC249.LC251.LC262.LC260.LC261.LC263.LC259.LC264.LC265.LC266.LC267.LC268.LC269.LC270.LC272.LC273.LC274.LC271.LC276.LC277.LC278.LC279.LC284.LC285.LC275.LC283.LC282.LC280.LC281.LC287.LC288.LC291.LC290.LC286.LC289.LC292.LC293.LC295.LC297.LC299.LC300.LC301.LC309.LC310.LC294.LC298.LC296.LC311.LC308.LC302.LC303.LC305.LC306.LC307.LC304.LC312.LC314.LC316.LC313.LC315.LC317.LC319.LC322.LC318.LC320.LC321.LC324.LC323.LC325__func__.24899__func__.24296__func__.25710__func__.24884__func__.23080__func__.24624__func__.24415__func__.24335__func__.24194__func__.24147__func__.24709__func__.24668__func__.24594__func__.24103CSWTCH.410__func__.23032CSWTCH.413__func__.22816CSWTCH.417__func__.22673CSWTCH.400CSWTCH.403CSWTCH.406__func__.24312__func__.24252__func__.23361__func__.22692__func__.24166__func__.23270__func__.24124__func__.22644__func__.24457__func__.24493__func__.24436__func__.24356__func__.24233__func__.24084__func__.24031__func__.23963__func__.23648__func__.24212__func__.23769__func__.23922__\: func__.23904__func__.24057__func__.24811__func__.22565__param_str_csc_ct_mode__mod_version5417__mod_license5416__mod_author5415__mod_csc_ct_mode93__mod_csc_ct_modetype92s_u32HdmiStatestHdmiFileOps_stModules_stExportFuncsVideoCodes__param_csc_ct_modeg_stHdmiChnParams_stHdmiUserRefstHdmiDeviceg_stHdmiCommParamg_HdmiWaitFlagg_astHdmiWaitHDCP_FailCountg_UserCallbackFlagg_HdmiInitNumg_pCallbackAddr__key.23970OutputAlready.23768UCallbackAddr__func__.6341g_ulHdmiFileHandle__func__.6725__func__.6707__func__.6740__func__.6683__func__.6540__func__.6481DecodeStandardTimingParsingShortTimeDescriptorBlockSaveEdidToEepromCheckCRCCheckEDIDVersionParsingCEADataBlockCollectionT.235BasicParse__func__.8535__func__.7318__func__.7497__func__.8439__func__.8557__func__.7896__func__.7547__func__.7573__func__.7659__func__.7703__func__.7859__func__.7040__func__.8252__func__.7001__func__.6964__func__.6930HextoDecConverter__func__.8078IdManufacterCharCode__func__.8463__func__.7164__func__.7245__func__.7985__func__.7369__func__.7400__func__.7426__func__.8599g_forceDVIModeg_forceHDMIModeHDMIDebugOpeng_stSinkCapEDIDDatastVendor3Dg_au8EepromMem__func__.6423RepeaterBitInTXBlockReadHDCPTX__func__.9949__func__.9964__func__.9984__func__.10012__func__.10036__func__.9886__func__.10131jiffies_nowjiffies_orgInitTestCtrlReg__func__.10150__func__.10017__func__.10066__func__.9971__func__.9925__func__.9936__func__.10099GetInfoFrameMapAddrGetInfoPacketMapAddrWaitBuffReady__func__.6974__func__.6925__func__.6897__func__.6557__func__.6724__func__.7088__func__.7066__func__.7021__func__.6661__func__.9811__func__.9900ConvertMDDCStateIntoErrCode__func__.6479__func__.6532__func__.6510__func__.6436__func__.6608__func__.6564OldRiCommand.6409OldRiStat.6408SHSTransformGetByteBStatusMXGetBStatusMX__func__.9831__func__.9647__func__.9911__func__.9899__func__.9885PrintOutputStatus__func__.9942__func__.9869__func__.9840__func__.9982__func__.]:9917__func__.9884__func__.10034__func__.10009__func__.9903__func__.9958__func__.10055OldAuthStateOldOutputStateOutputStatetimer_flagpretickCSWTCH.140CSWTCH.141__func__.6756CSWTCH.144CSWTCH.145CSWTCH.146CSWTCH.147__func__.6720__func__.6598__func__.6645__func__.6696InfCtrl1.6694InfCtrl2.6695.LANCHOR3cec_msg_validate__func__.15352__func__.14768__func__.15329__func__.15072__func__.14821__func__.15279__func__.15237__func__.14794CurLogAddrbCECTask__key.15178bNewTaski.15277result__mod_srcversion23__module_depends__mod_vermagic5SI_TimeOutHandlerSI_BlockReadEDIDSI_hdmiPhyInitF_TxInitinYCMuxed12g_bHdmiEdidPrepareOkg_VirHDMI_PHY_BASE_ADDROutChangeFlagSI_ReadBlockHDMITXP1DRV_HDMI_GetCECCommandSI_IsEECfgDVDAudioSourceSI_CEC_RegisterModifySI_SetVideoPathSI_TX_SendInfoFrameSI_CEC_RegisterWriteSI_WriteBlockHDMITXP1HDMI_ExitSI_CEC_RegisterReadSI_HPD_StatusSI_Set_AudioInfoFramePacketSI_GetVModeDataSI_CEC_Interrupt_ProcessingDRV_HDMI_GetPlayStatusCMPI_RegisterModinRGB24hdmi_StartSI_TXAudioDRV_HDMI_CEC_ReadByteSI_BlockReadEDID_RealSI_Set_VSI_3D_FramePackingSI_PowerDownHdmiTx__this_moduleDRV_HDMI_GetParamSI_HdmiHardwareResetBlockWrite_8BASSI_Init_DVITXsnprintfSI_Region2_ReadByteSI_TX_SetHDMIModeSI_WriteByteEEPROMhdmi_cec_wait_queue_headSI_Get_Force_OutputModeSI_HDCP_SetHPDAuthCount__arm_ioremapinYC24HDMI_DEBUGHdmiOpenSI_EDID_Force_SettingSI_SetOutputModeSI_TMDS_setupinYCbCr24finish_waitSI_Set_VSI_3D_SidebySide_FullSI_SetEeprom__iounmapDRV_HDMI_PreFormatSI_ByteReadEDIDSI_GPIO_ReadBitget_cmd_counterSI_Set_VSI_3D_L_Depth_2Graphic_DepthHPDKernelCallbackCountupSI_IsTXHDCP_EEsettingSI_UpdateTX_DEDRV_ReadWord_8BAcec_cmd_poolSI_3D_SettingSI_IsSPDIFSelectedDRV_BlockWrite_8BAScleanup_moduleSI_SiI_CEC_SendPingDRV_HDMI_CECStatusAreR0sMatchprepare_to_waitSI_SetHdmiVideoSI_TX_SendInfoFramexDRV_HDMI_BoardExitmemcpyCMPI_UserCopySI_CEC_SendCommandDRV_HDMI_CloseSI_EDIDProcessingreset_hdcp_counterSI_CloseHdmiDeviceSI_Set_VSI_3^:D_SidebySide_HalfSI_SendAVIInfoFrameSI_VideoModeDetectionSI_DisableInfoFramedo_gettimeofdayISRC1SI_CEC_Closekthread_should_stopSI_Set_VSI_3D_TopandBottom_HalfSI_SetEncryption__wake_upDRV_HDMI_InitSI_CEC_AudioPingCMPI_RemoveProcWriteWord_8BASI_FApost_setupSI_GetAudioPathSI_WriteWordEEPROMinit_moduleDRV_HDMI_SetxvYCCModeg_stHdmiEventMutexwake_up_processSI_AssignOutputStateDRV_HDMI_GetCECAddressSI_ReadKSVList_TimeoutCMPI_CreateProcSI_Is_HDCPAuth_DetectHPDcsc_ct_modeReadByte_8BAg_stCSC_RGB2YUV601_tvReadWord_8BASI_AutoRiCheckschedule_timeoutg_astModulesmsecs_to_jiffiesSI_AssertHDMITX_SWResetISRC2DRV_ReadWord_16BAHDMIPlugInFlagSI_ReadBlockHDMITXP0get_hdcp_counterg_stCSC_RGB2YUV709_pcSI_WriteNValueSI_SetAudioPathSI_Region2_WriteByteSI_CEC_GetCommandSI_SetIClkSI_WaitPixClockStableSI_WakeUpHDMITXSiI_CEC_SetCommandDRV_HDMI_BoardInitDRV_HDMI_GetAttrSI_IsTXFPGAsi_time_nowSI_GetPixelsForHSyncincrease_hdcp_counterSI_InitDVIInterruptMasksSI_Set_DEBUG_FlagF_ResChangedN_ValSI_Proc_ReadEDIDBlockDRV_HDMI_SetParamg_s32VmodeOfUNFFormatSyncInfoSI_CEC_CAPTURE_ID_Setcmd_pool_rptrSI_MDDCTakeBlockFromFIFOHPDIsrCountinYC656_24g_stHdmiMutexDRV_ReadByte_8BASI_WriteBlockHDMITXP0hdmi_CfgCscMatrixDRV_HDMI_SetAttrSI_CEC_RegisterWriteBlockcec_enable_flagSI_ReadByteEEPROMSI_EnableInfoFramehdmi_ProcHotPlugcmd_pool_wptrSIN_TABLEHdmi_PinConfigSI_timer_startSI_DisableInfoPacketSI_HPD_SetHPDKernelCallbackCountMDDCBlockWriteHDCPRXget_buf_statusSI_HPD_SetHPDUserCallbackCounthdmi_ConverCscOffsetDRV_HDMI_NotifyEventDRV_HDMI_GetInfoFrameVModeTablesDRV_BlockRead_8BASSI_BlockWrite_MDDCSI_WaitNewVSyncDRV_HDMI_WriteRegisterSI_OpenHdmiDevicevprintkDRV_HDMI_SetDeepColorHdmi_KThread_TimerSI_UpdateCRC16WithByteSI_GetTimingParametersinYCMuxed656_12SI_CheckVersionIDCMPI_UnRegisterModSI_GetVideoPathSI_GetHSyncsPerFrameBlockRead_8BASMDDCBlockReadHDCPRXSI_ReleaseHDMITX_SWResetSI_AutoKSVReadyCheckSI_PrintAuthStatekthread_stopDRV_HDMI_ReadRegisterSI_Mpll_setup_ : SI_EnableInfoPacketprintkSI_IsHDMICompatibleSI_SetHDMIOldOutputStatusSI_WriteDefaultConfigToEEPROMMX_TXSI_CEC_Event_HandlerAuthStateDRV_WriteByte_8BAinRGBDVO12SI_GetHDMIOldOutputStatusSI_ResetEDIDBlockSI_BlockReadHDMITXP0SI_SetHDMIOutputStatusSI_DisableHdmiDevicecan_read_numSI_HDMI_Setup_INBootSI_BlockReadMDDCFifog_stCSC_RGB2YUV601_pcWriteByte_8BAHPDUserCallbackCountDRV_HDMI_CEC_WriteByteResChangeTimeOutSI_GetPictureAspectDRV_HDMI_SetFormatSI_Proc_writeEDIDBlockSI_IsTXInHDMIMode__memzeroSI_PrepareEDIDSI_GetSyncInfoSI_CEC_RegisterReadBlockDRV_HDMI_StopHI_LOGSI_SendInfoPacket__init_waitqueue_headSI_HW_ResetHDMITXSI_ReadWordEEPROMSI_Set_VSI_3D_L_DepthDRV_HDMI_OpenDRV_HDMI_GetDeepColorSI_SetHdmiAudioSI_BlockWriteHDMITXP0SI_HotPlugInOrOutSI_SHAHandlerget_cec_cmdSI_PoweOnHdmiDeviceDRV_HDMI_StartDRV_HDMI_SetAVMuteSI_SendGamutMeta_PacketinModejiffiesAudioCPSI_RiCheckInterruptMaskkthread_create_on_nodeSI_BlockRead_MDDCTransfer_VideoTimingFromat_to_VModeTablesIndexhdmi_CalcCscMatrixRiFailureCountSI_Is_HPDUserCallback_DetectHPDSI_UpdateTX_656SI_Start_HDMITXSI_GPIO_WriteBitSI_InitAudioPartSI_TimerHandlerSI_EnableHdmiDeviceDRV_HDMI_GetCscDefaultTXVPathSI_SetDESiIVidPathInIndexHdmi_KThread_CECSI_CEC_Opensi_absSI_ConfigTXVideoMode__const_udelaySI_timer_stopSI_GetRefrTypeHVPolcec_PrintLogAddrSI_BlockWriteEEPROMHPDAuthCountSI_InterruptHandlerSI_AutoRiFailureHandlerDRV_HDMI_GetSinkCapabilityseq_printfdown_interruptibleSI_SuspendAutoRiCheckSI_Set_VSI_3D_FieldAlthdcp_counterSI_BlockReadEEPROMhdmi_ConverCscCoefSI_Is_HPDKernelCallback_DetectHPDSI_ParseEDIDSI_GPIO_SetDirBitSI_GetHdmiSinkCapsSI_Set_Force_OutputModeDRV_HDMI_Force_GetEDIDHdmiHardwareResetSI_SendCP_Packethdmi_CheckGreenChnannelSI_MDDCInitReadBlockFromFIFOSI_Set_VSI_3D_LineAltSI_CheckHDCPDeviceCEAOnFisrtPageautoremove_wake_functionSI_timer_countSI_SetDeepColorTimerSrvFSI_SetMCLKSI_ReAthenticationDRV_HDMI_ReadEventSI_AuthenticationSiIVidPathOutIndexDRV_HDMI_SetCECC`: ommandHdmiCloseSI_SW_ResetHDMITXSI_Force_GetEDIDSI_FindFsSI_OutputProcessingSI_Set_N_FsDRV_HDMI_ReadPhyparam_ops_intstore_cec_cmdSI_GetVideoFormatCMPI_UnRegisterDeviceDRV_HDMI_DeInitbTXStateDelayMSSI_DDC_DebugDRV_ReadByte_16BACOS_TABLESI_GetHDMIOutputStatusDefaultAVIInfoFrameSI_BlockWriteMDDCFifostart_flagDRV_HDMI_SetInfoFrameHDMI_Initmsleepg_stCSC_RGB2YUV709_tvsuspend_flagSI_UpdateCRC16WithBlockDRV_HDMI_SetCscSI_timer_diffDRV_WriteWord_8BADefaultTXDVDAudioSI_PoweDownHdmiDeviceCMPI_RegisterDevice+ ,+,P+T,+,x+|,+ , +,$+ (, D+H,+,Y+,Y+, +,Y,+0,4YX+\,hYx+|,Y+,Y+,Y + , +$,@+%D,%Ht+x,Y+&,&Y+T,( +, ,H +L ,X Yh +l ,p Y + , Y + , Y + , Y + , Y Th t  7 + , + , Y + , Y( +, ,8 YH +L ,P Yh    + , Y +. ,. Y + , + ,( Y8 +< ,@ Y` +d ,p Y + , Y + , Y + , Y   4 +8 ,D YP +1T ,1X Yd +h , + , Y + , Y + , Y + , Y4D+H,TY`+2d,2hY+,Y+,Y+,Y+5,5Y+,0+4,@YP+T,XYx+|,Y+,a:Y+,Y+6,6Y4+8,DYP+T,XYh+,Y+5,5Y+,+,Y+, Y,+0,<YL+P,TYp+,Y+6,6Y+,Y+,Y$+(,T+,+,+,Y(+;,,;0Y4<t+x,+,+,+,$,h+l,xY|+<,<Y+,Y+<,<Y+, Y(+<0,<4Yd+h,tY|+<,<Y+,Y+<,<Y,04Lex+|,Y+?,?Y+,+,Y+,Y+,$Y4+8,@Yl+p,|Y+@,@Y+,Y+A,AY +$,0Y<+@,HYXdt+x,Y+B,BY+,Y+E,EY+,HTT+\,hYl+Ft,F|Y+,Y+,Y+,Y+, Y,T+X,dYp+It,IxY+,+,Y+,Y(+,,8Y<+JD,JLY`+d,pY|+K,KY+,Y+,Y+,Y+, Y,+O0,O8L` l+Pp+Qt,Px,Q| +R+S,Rb:,S+T+U,T,U+V,V+W,W$ +X,X$+Y(,Y,4+Z<,Z@T+[X,[\t+\,\+],] +^+_,^,_+`,`+a,a(+b,+c0,b4,c8 +d ,d  +e ,e 0 +f4 ,f8 H +gL ,gP ` +hd ,hh x +i| ,i  +j ,j  +k ,k  +l ,l  +m ,m  +n ,n !+o !,o! !+p$!,p(!8!+qL@>LT>L>L>L>L>L>L?L,?L@?Ll?+p?,?+?,?Y?+?,?Y?+?,?Y?+?,@Y`@+d@,p@Y|@+@,@Y@+@,@Y@+@,@Y@+@,@YA+A, AY(A+,A,8AYDA+HA,LAYhA+lA,xAYA+A,AYA+A,AYA+A,AYBHB+LB,XBYdB+e: hB,lBYBBBBBB+B,B+B,BYC+C,CY0C+4C,@CYPC+TC,\CYC+C,CYC+C,CYC+C,,D+0D,PD\DhDxDDD+D,DYD+D,DYEE+E, EY0E+4E,8EYLETEdE+hE,tEYE+E,EYEaEE7E+E,EYF+F, FYFF4F@FLF\FhFFFpF+F,FYF+F,FYFF/F+F,GYG+ G,,GY\G+`G,lGYxG+|G,GYGtGGG+G,GYH+H, HY(H4H+8H,LHY\H+`H,dHYtH~HH+H,HYH+H,HYHH+H,IYI+I,$IY8ILHI+LI,XIY\I+dI,tIYI7I%I7I+I,IYI+I, JYJaDJTJ+XJ,dJYJ+J,JYJTL+ L,4LYLL+TL,`LYhLxLL+L,LYL+L,LYLuLM(M+,M,8MYDM+HM,LMYPMXMlM+pM,|MYM+M,MYMM+M,NYN+N,NY8NLHN+LN,XNY`N+hN,tNYN+N,NYN+N,NYN+N,OYO+O, OY,OXO+\O,hOYtO+xO,OYO7O%O7O+O,OYO+O,OY PL P+$P,0PYg,>g+g,gYg+?g,?g+h,hYh+@ h,@4h+8h,HhYLh+AXh,Aph+th,hYh+Bh,Bh+h,hYh+Ch,Ch+h,hYi+D i,DiY$i+(i,0iY ,>$YD+6H,6TY\+?d,?hY|+6,6Y+@,@Y+6,6̱YԱ+Aܱ,AY+6,6Y+B,B Y(L+5P,5p+6t,6Y+F,FY+6,6Y+G,GY+5,5س+6ܳ,6Y+G,GY +5,5D+6T,6+6,6!TĴܴ+5,5'(@D+5H,5XTl+6t,6+5,5Y+M,MYȵ+6̵,6صY+N,NYF+6,6жY+O,OY+6,6Y +P$,P(YTF\t|+5,5TԷ+6ط,6Y+S,SY+6 ,6Y(+T0,T4+58Y@,5X+6\,6hYp+Ux,U|YT+6,6Y+V,VY,+60,6<YH+WL,WPY\;ltxԹs$Ddĺ,sP+6,6+5,5Y+]m:Ļ,]ȻYs+5,5@sdx+6|,6Y+^,^Y+6 ,6Y$+_(,_,Y<+6@,6LY\+``,`hYxs+6,6нYܽ+a,aYs8|ssTs|+6,6YĿ+bȿ,b̿Ys $(,048<@DHLPTX\l+6p,6|Y+e,eYs+6,6Y+f,fYL+6P,6\Yd+gl,gpY+6,6Y+h,hYs4s\l+6p,6Y+i,iY+6,6Y +l,lY T4sLp+6x,6Y+m,mY+6,6Y+n,nYx+6|,6Y+o,oYT+6,6 Y@+pD,pPY`+6d,6lY|+q,qY+6,6Y+r,rY+6 ,6,Y0+s8,s@YP+6T,6`Yp+tx,tY+6,6Y+u,uY+6 ,6Y +v(,v4Yd+6h,6tY|+w,wY+6,6Y+x,xY+6,6Y+y,yY +6,6Y$+z,,z0YD+6H,6TY\+{d,{hY|+6,6Y+|,|Y+6,6Y+},}Y+6,6Y+~,~Y $(,048H+6L,6XYd+h,lY+6,6Y+,Y+6,6Y+,n:Y+6,6 Y+, Y8+6<,6HYT+X,\Yt+6x,6Y+,Y+6,6Y+,Y+6,6Y+, Y +6$,60Y8+@,DYX+6\,6hYt+x,|Ys+6,6Y+,Y+6,6(Y0+8,<YP+6T,6`Yh+p,tY+6,6Y+,Y+6,6Y+,Y+6,6Y +,Y0+64,6@YL+P,TYp+6t,6Y+,Y+6,6Y+,Y+6,6Y +,Y4+68,6DYP+T,XYx+6|,6Y+,Y+6,6Y+,Y+6,6 Y,+0,4Y`+6d,6pYx+,Y+6,6Y+,Y+6,6Y+,Y$sLxT4hTLoL4+68,6DYP+T,XYp|+5,5TTTTT+6,6(Y4+8,<YX+6`,6lYx+,YD+,T+,+ ,+, (+,,08+<,@H+L,PX+\,`h+l,px+|,+,+,+,+,+,+,+,+,s4D+6H,6TYh+p,tY+6,6Yo: +,<Yd+6h,6xY+,YRRR R,R<LR\lR|RRRR R,R<LR\lR|R;+6,6Y+,Y+6,6Y$+(,,YT+6X,6dYh+p,xY+,T+,+,+,+,+ ,+, (+,,08+<,@H+L,PX+\,`h+l,px+|,+,+,+,+,+,+, +6$,6,Y<+@,DY`h+l,px+|,+,+,+,+,+,+,+,+,+ ,+, (+,,08+<,@L+P,X`+d,hl+p,tT+6,6+,+,+6 ,6,Y8+@,HYT+6d,6|+6,6Y+,Y+6,6Y+,Y048<@DHLPl7+6,6Y+,Y+6,6Y+,Y7 47d+6h,6tY+,Y+6,6Y+,Yp*:%% 7,%H+6L,6XYh+l,pY7% ,+70,7s s8+6<,6HY`+d,tY+7,7+6,6Y+,Y+5 ,5L+7T,7+7,7+6+5 ,6,5Y,+0,@YX 4+58,5`+6h,6tY+,Y+6,6Y+,Ys +6$,60YD+H,PY`+6d,6pYx+,Y+6,6Y+,Y+6,6Y+, Y8+6<,6HYX+\,hYs+6,6Y+, Y +6,6Y+, Ys8+6<,6HYT+X,\Yxs+6,6Y+,Y+6,6Y +$,(Y8s|+6,6Y+,Y+6,6Y+,Y+6,6Y +,Y,+60,6DYP+T,XYp+6t,6Y+,Y+6,6Y+,Y+6,6Y+, Y$+6(,6<Y@+H,PYd+6h,6tY+,Y+6,6Y+,Y+6,6Y+,Y+6,6(Y4+8,<YT+6X,6dYp+t,xY+6,6Y+,Y+6,6$Y0+4,8Y`+6d,6pY+,Y+6,6Y+,Y+6,6Y+,YL,+60,6<YH+q?: L,PY`+6d,6lY+,Y+6,6Y+,Y+6,6Y+,Y+6,6 Y4+8,@YP+6T,6\Yp+t,|Y+6,6Y+,Y+6,6Y+,Y+6,6Y$+(,0Y@+6D,6LY`+d,lY|+6,6Y+,Y+6,6Y+,Y+6,6Y+,Y,+60,6<YH+L,PYss<+6@,6LYT+\,dY|s+6,6Y+,Y+6,6Y+,Y ,sD`+6h,6xY+,Y+6,6Y+,Y+6,6Y +$,(YD+6L,6\Yl+p,tYs+6,6Y+,Y+6,6 Y0+4,8YT+6\,6lY|+,Y+6,6Y+,Ys+6 ,6,Y<+@,DY`+6h,6xY+,Y+6,6Y+,Y+6,6Y+,Y+6 ,6,Y0+8,@Y\+6`,6lYp+x,Y+6,6Y+,YsPsh+6l,6xY+,Y+6,6Y+,Y+6,6Y+,Y4+6<,6PYT+\,dYt+6x,6Y+,Y+6,6Y+,Y+6,6Y+,Y(+6,,68Y<+D,r<: LY`+6d,6pYx+,YU+5,5 (+6,,68YD+H,LY\t+/x,/+/,/|+/,/+/,/+/,/+/,/+/,/0+04,08+/<,/T+1\,1l+/p,/+/,/+/,/+/,/dt+6+7,6,7Y+8+7,8,7YJDTXLlLb+=,=+=,=+=,=0\LLLLL4+?<,?@+@D,@PY\+Ad,AhYLLL  L< h L +? ,? Y +B ,B +C ,C Y  4   +@ ,@0 D +?H ,?T YX +D` ,Dh Y| +? ,? Y +E ,E Y +? ,? Y +F ,F Y +? ,? Y +G ,G Y  0 +k4 ,k8 +B< ,BL  +? ,? Y +J ,J Y +? ,?  TD 1x T o 22|T# (L82`xLL+?,?Y+N,NY <H+?L,?\Yx+O,OY2+?,?Y+P,PY +?$,?0Y<+Q@,QHYXT+?,?Y+R,RY+?,?Y +S,SY8+?<,?HYT+TX,T\Yd|+?,?Y+U,UY+?,?Y+V,VY+? ,?Y+W$,W,Y<+?@,?LYX+X\,X`Yh+?s):,?Y+Y,YY+?,?Y+Z,ZY+? ,?Y +[(,[,Y4DHX\lp 0+?4,?@YL+\P,\TY\t+?x,?Y+],]Y+?,?Y+^,^Y+?,? Y+_,_ Y(@+?D,?PY\+``,`dYl+?,?Y+a,aY2+B,BL<LL+?P,?XYp+bx,bY4+k,k+?,?Y+c,cY +?$,?0Y<+d@,dDYHX`dpt+?,?Y+g,gY+?,?Y+h,hY +?$,?0Y4+@<,@D+iH,iLY\+?`,?lY|+j,jYS+=y7+?,?Y,=+k,kY(,+@0,@85T\mxa+?,?Y+l,lYLLL+? ,?,Y8+m<,m@YHd xLa+?,?Y+n,nY+~+,~, Y+, Y0|+~+,~,Y+,Y <|+~+,~,Y+, Y4\+~`+d,~h,tY+,Y+~+,~,Y+,Y+~+,~,Y + , Y( +~t3: , +0 ,~4 ,@ YL +T ,X Yl +~p +t ,~x , Y + , Y +~ + ,~ , Y + , Y! !8!+~Y>0>YD>YT>p>Y>Yv%:>>Y>Y>>Y?Y?0?YD?YT?p?Y?Y?Y?+?,?Y??@ @P@@@@ADAXAhA|AAAAAA+A,BYB+ B,BY8BDBLBpBBBTPCDLDL8DLLDL|DLD+D,DYD+D,DYDD+E,EY E+$E,(EYPE+TE,`EYlE+pE,tEYEEEEF(F+,F,8FYDF+HF,LFYpFTFFF+F,FYF+F,FY$G4GTG+XG,dGYpG+tG,xGYGGGT@HH4ILTILlILILILI+I,IYJ+J, JY$J0J+4J,DJYTJ+XJ,\JYJ+J,JYJ+J,JYJJJ KDf,>df2tf+'xf,'fYf++f,+fYf`i+@di,@i+'i,'iYi+/i,/iYiiTi2i+'i,'iYx0: j+0 j,0jY8r,>HrYdrtr+'xr,'rYr+>r,>rYrr+'r,'rYr+>r,>sY$s4s+'8s,'@sYTs+>Xs,>hsYss+'s,'sYs+>s,>sYs+'s,'sYt+? t,?tY t0t+'4t,'@tYLt+@Pt,@TtYXt`tdt\u+'`u,'luYxu+A|u,AuYuu+'u,'uYu+?u,?uYv+' v,'vY$v+B(v,B,vY,>Y+,ȽYܽ+?,?Y+,$Y0+$4,$8YTT+,Y+@,@Yؾ+ܾ,Y+A,AY+ ,,Y<+B@,BLY+,Y+C,CY̿+п,ܿY+D,DY +,Y,+D0,D8YH+L,TYh+Dl,DtY+,Y+D,DY+,Y+D,DY+,Y+D ,D(Y8+<,DYX+D\,DdYt+x,Y+D,DY+,Y+D,DY+,Y +D,DY(+,,4YH+DL,DTYd+h,pY+D,DY+,Y+D,DY+,Y+D,DY+,$Y8+D<,DDYT+X,`Yt+Dx,DY+,Y+E,EY+,Y+F,FY+,Y +G$,G(Y0H+L,XYd+Hh,HlY+,Y+I,IY+,Y+J ,J$Y,LPTh+!p,!+!,!V+ ,8D0\|+!,!$(+!,,!0+4,+, .+ ,$,0+4,8:@+,$+*:(+,,0,4H`+d,pY|+,Y++,,+,Y+,Y+ ,Y$+ (, ,Y8<+!@,!D:TX \ ` Bd h l vp ,t   $$08ltx|   3: hi3521_sys.ko9Y9Y9Y|ELF(z4( -L! -L -L -L@ 0S0"00 -L -L 3@ -L M0,S @!\@%*@ T3*K @@J @J p-L MPP`' Q @P  1 "Q Kp0  @ @@@J @@@J @@ @O4@@@@ -LP 00@4"R 00 @ J @J -LP @0S0C Q*04‚ @J @ J @J -L@@@82S<2 <2 Q* 0  M.   ! @<! J! x-L  @@` @`P @Pe @Pex -L@@@`p P?0/2 00@`?0C/2 -L@@op0S P P p  @Q PU P p P\ 0S P p@T@2PS@ qbp@ `@ P@ p`T0@@ -L$MB@0 ``@0` @ @0`0@@@ @4 Zb Q_  Z\ 04PpJpPU  @ 0P0PZCW 0qW 0 0@PZ+pX 8 8 : 00@QU 0 0"@PZ` @-V(K 0-L@P@@00@@ 0 -L  @ -L @ -L$M PD Q P< }<D0T2 !4 P\ <8 @ 0 0 R0 I 084p!"0qW< @T2 `D P` P? PU"*V P P2 PU*`QP P% P P PU:T@@p4000 0 P 4@ 0@ S8 <(KZ:D  0 @@< <J< D D @000 @J<  @00J<0  -L p-L MPP`! @P  1 "Q  QKp0  @ @@@J@@ 4@@@@, -LM@Pb P0 ( PP@p&1Sc Y 0S @@ZX  P00(K0  @  ?4 R @P P!   D•@D@P  @  J0  @ J0 @@ 3@@@@0 -LPP@ }뀀0 Hx @@?pXo81̀$Ӏ`p WV: ; O HH㐆x 0J670 0'` KЫ 0@ x-L`P @@@$VK>!x -L@ @Kn4րd ` R 0 0SR*  00 !ث 0-LM 90DQ H Q ) L Q[ 90LQ LQ P DQ %YQ\ D QT Y Q-  @]_OK0 HQ  HQ YPHQ PDQ,  DQ YPDQP@@@PU U 4Q @PPJ  :0PP @P PP@@@Q Q P. 2P) 2P$ 2P 2P 2P 2P 2P 2P 2P 22PP@”00\ tP t |"x" @PY00@PēQPM@PG PB90DQ7 P9HQ.P190HQ&P)  @# @PPPPK^$PP@P PPJP:•\00@(P0 0P3 Pt2-|Rx @RPP@Re02  @PT*PPJ @PPJ @P3@ -L! -L@p`0S  R P@@P 00PPpZW -L@@@][/0p!l!h1Z -LMP @`Qp K @@ @0@ -LdM@ 8 P 8 @ @00@P@P@PP@P@ PP@P@PP@P@P@ P0P`P 0@P0 `!R\ $0S ` @@P㜂.P@X@ TP `<` \@0 K40K(PXaL V@D@ P0P(2Sv @  tQ!$@P U,0@Q @@TM H ppT@@0PP(00R" Z @ 1,P4!@,Y  :  @ p   @008<  Z@@p@H THY,P4@00@8@@ T  < ` `D`LPU0D0 {\PX$0X S@d` ` -\J(K,P4`@@00`8 L -LM,QJC  P8 @ 1 @<0 4 (YN P$0<S(  r@ p@( 0 1aS@  P@ pV0@0(  Y 0@ (@4<80tA8 !(K@< 04 tP <4 0(8 !0 @8 ! J, , 8! J -L -L -LM0,SP  @ t!("R 0 S%* \3* K @J @J@ @J x-LPQ`' P% @ 0P !x @a(`, .!P  @!00Jx @00J -LMPP5 Q2 P*0``@t@(0! `aQ@ p V@  ?P 0 @ $K @J -L$M,P@PS PP8`K8@ PT4P 0 D DP ? 0S p @1@@ t1Se @!!0Xp @@P -?0P| !@T| Pm@?`P !0  3/ P: @R4P[ p 0,S!("R 0S 0 , 04Q8D D   @^ ! P @R0 @  ?0 \M ! J(K0 @  =?D@T  !4P O@@Z @ @J!@Z@ZD DPp@@@| 4pp@p@Z J@@< k4PP@P@@ 4@@ -L$M,P@PS0Sx PP8`K8@ PT4P 0 PY @t1Si p1嗅"qWM @ @P !P9 ` 0,S@PW0 , 1! P0 @@@ 3PP@P 0-L@4PPNOO@0@ -LDMPQi @P (K``@ZPNOO1(rWj 0 ,.,0!Q` @ D !DtH H( * L ! R=  Q 7 \ ^ ^ @` @`P0  P0RY L B  L!@0S @\B L @@:@J@@!2PP@PL!Z@0H 8KD80 4 0 P0S HD 3/D^H2S  H,  P0S0S  3/@@ 2@@@@@ -L$MPPk Qi @P (K@P@ZPNOOa(2,`t 'p10 SL  (0"140 0?S`0Q@k =? ^I PV 8 8P0Q  0㇡0`400  !P_  @@@J 0,R0`00@@2#0@0@ 0  @ @@JP 8 8 @ @@J0 @ @@J  ?0Y. @(P' < 8 < 8P0, < @0 8 0< @僡8o8 8P0S ` 3/0@(P < 8 8<  @ @@Jx@ -L MPP`Q 0p,X@Y t(^W -?4@T}00@P 0 0P@ @!0 0 Y$p0u ?0$0S0  0P( a0 0@Q (W0G`  0(`R (W0 ( `(  W  (0`(   ( `  00 tAY R P  ,XrJ(K@@@PK 0 0 @JY =:? 0 4 R 0P,5 0   W 00,P, W00   00(B @J@:0 @ J @ J ? `$^ 0 000@P a5 0 01 @( Jm -L  -L -L00@ -L 800@0pQ00@ 00b -L 800@0pR@ b -L@@@PPP -LM0K@$K(@$  @@KPK P @ -L -L -LP P P00@00"000@00 $000@00#0P00@00 !0 -LP P P00@00)000@00 '000@00(0P00@0 * 0 -L -L -L -L -L -L0P0 -LP00@DQ  0  %%   -LP00@0 $ -LP00@0 # -LP00@0? ?*  -LP@ !ʠ 0>0   -LP @#0 8@0$( -LP @#0  : 8@0$( -LP 00@0 $ @\ @0 8@0$(  -LP@ 000@S@0 8@ 0Ă( -LP @#0 8@0Q$( 0-LP0 @#0 8@@0SĄPȌ@A@@A$(@0 -LP @#0 8@0$(Q  -LP @#0 8@0Q$( -L -L -L -L00@P00  0 -L00@P00  0 -LP00@Q`0,, , -LP00@Q`0,, , -LP00@Q`0,, , -L00@P04  4 -LP00@Q04 4 -L -L@04 P 4 -LQP00@04,4 @R00@ ` 0 4 4 -LP00@04 *4 -L0@S00@Q`0,4 4 -L -L00@P04  4 -L00@P04 4 -L00@P0@4 @ 4 -L@0< P < -L00@P0<  < -L00@P0<  < -LP00@0@ Q : @ -LP00@Q0@ @ -LP00@Q0@+@ -LP00@Q0@+@ -LP00@0H QH -LP00@Q0H H -LP00@0P QP -LP00@Q0P P -L@0X P X -L00@P0X  X -L@0` P ` -L00@P0`  ` -L@0d P d -L00@P0d  d -L@0h P h -L00@P0h  h -L@0l P l -L00@P0l  l -L@0p P p -L00@P0p  p -L -L -L@0t P t -L00@P0t  t -L @0x Q x -L00@Q0x x -L@0| P | -L00@P0|  | -L @0 !" #0 0@ -LMP K@@ 2@ -LMP K@@ 2@ -LMP K@@ ?@8 -L -LA`Q"^[^^^^^^t^d^T^D^4^$^^^]]]]]]]]|]l]^^^^^^^^^^^^^^^\]L]<],]]^^^^ ]\\\\^\\\\|\^^l\^\\L\<\,\\ \[[l`\`L`<`,`` `________|_l_\_L_<_,__ _^ :  -LMQ 1 s! r  K0 @@@ L0@T -L -L -L M@@@T @@T 6@@ 0 @0@K x-L@@@`  `P0 4b 0 @0`PP`P@0pRh2P   @@h P   @4@@P  @% P"i@P  @  @@8 <@P  @x@@x@@xHGNUdG&$CWm6?63 SYS_GetMmzNameSYS_ModExitSysGetMemConfSysSetMemConfSysDdrOccupyCalProcessVALG_Ballocrrmodehrtimersys_spinlock_debugsys_ddr_rateSysGetDevChnByIdxSYS_BIND_ResetDataSYS_BIND_SendDataSYS_UnBindFwRegSYS_DRV_GetStrideSYS_DRV_ReadDdrReadStatSYS_DRV_ReadDdrWriteStatSYS_DRV_ConfigDdrOccupyStatSYS_DRV_GetMemIndexversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=rrmode:intparmtype=hrtimer:intparmtype=sys_spinlock_debug:uintparmtype=sys_ddr_rate:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 g_u32FuncIdg_benchmark_listModId:%d is invalid ! ModId:%d mod dev or chn is invalid, dev:%d, chn:%d ! pstChn is null! ppMmzName is null! mppchn para err:(%d,%d,%d) ! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/sys/sys_ext.cNULL != pMmzTblpstConf is null! system is not config :urated! system is busy! AlignWidth[%u] is illegal! not enough mem for spin lock! =====sys rec command===== echo arg0 arg1 [arg2 ...] >> /proc/vdectrl arg0: 0: show spin lock info arg1: physics address sysrecSYS_STATE_STOPPED == g_stSysCtx.u32Statesysremove sys.ko for %s...OK! Hi3521 -----MEM TABLE-------------------------------------------------------- %6s%18s%4s%4s%18s MODMODNAMEDEVCHNMMZNAME%6d%16s%4d%4d%16s [SYS] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:47] System State: %u (0: initialized; 1: exiting; 2: exited) sys mod exit ok! sys mod init ok! pstMemDdr is null! mppchn para err:mod(%d),ddrnamenum:(%d) ! pstMppChn is null! No memory for set memconf! No memory for MOD CHN MMZ table! Register system device failed! Register mod failed! Register proc failed! Register proc sysrec failed! to initialize hardware failed! load sys.ko for %s...OK! load sys.ko for %s...FAILURE! AnonymousNULL != g_astDdrOccupy[i].pDdrDataBuffDdr%d rate data buf address is %p. %d argc:%d argv: %x %x can't map addr %x map area's data error ============================================ MODE Name: %16s LockName: %16s RefCnt :%3d %30s %4d second param should be 1 or 0 disableenable==================sys rec addr phy: %#x vir %#x rec: %s ===================== unknown command <3>MMZ: your parameter string is too long! <3>MMZ: copy_from_user failed! SysRecMem[Func]:%s [Line]:%d [Info]:valg alloc mmz buffer failed! valg alloc mmp buffer failed! spin rec mem can't alloc! SYS_GetLocalCurPts hi_sched_clock error u64TimeNow=%llu,u64TimeLast=%llu sys init again! not configurated! to initialize modules failed! no mem! line:%d sys init ok! sys exit again! sys exit ok! SYS_VREG_GetAddr failed! ioctl cmd does NOT exit! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/bind/sys_bind.c:0 != pstBinderCtx->u32MaxDevCnt -----BIND RELATION TABLE-------------------------------------------------------- %8s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s FirModFirDevFirChnSecModSecDevSecChnTirModTirDevTirChnSendCntrstCntUnknow mod%8s%8d%8d%8s%8d%8d%8s%8d%8d%8d%8d nullMod:%d have not register ! ModId:%d is invalid ! ModId:%d(%s) is not supported ! Bind dev or chn is invalid, dev:%d, chn:%d ! Null point Dest have not bind any Src bind src(mod:%d,dev:%d,chn:%d) too many enModId < HI_ID_BUTTMod %d have not register ! Mod %d, dev %d, chn %d, have not bind ! HI_SUCCESS == s32Rethave not Binder ! pstSendBindSrc->astMppChn[i].enModId < HI_ID_BUTTenDataType < MPP_DATA_BUTTpstSrcBind->u32DestNum > 0HI_TRUE == bFindDest have bind Src:(%s,%d,%d) ! src bind max(%d) err! No memory for bind SRC! BIND_MALLOC err! Mod %d have register ! u32MaxDevCnt or u32MaxChnCnt invalid ! No memory for bind table! pa:%x, va:%x remap crg reg fail, line: %d. remap sys reg fail, line: %d. remap efuse reg fail, line: %d. remap ddr0 reg fail, line: %d. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/sys/sys_drv.cHI_NULL != pu32Strides32Index == 0pu32MemIndex != NULLu32PhyAddr err:(0x%x) ! d$l$t$$hi3521_sysA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc: 4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4@a %)ta% 8b4 lCc$Z$dV ddhleuf2ftu@ ,`u v$ lw wpw/wy~- \_   ,@,(l3|C H Mx Rd WP \0: a f p$ u@DxH }4 | h     $  u4D L x |  u8         udhhl!0 '| - 3 9 ? E u  K$ u  Q8 uWT u]isx y     $ uD x P  u  | t    H T     u8 D `   u|! ' - 3 9 ? Et Kd Q0 WP u#u ] l  { 0 @ X  d l t    ( :1 KB ^V rk!  u    u%: hh( Pu u)9 T0uiu4<@H,#H C( f W\ R| M \ a p } x  $ , 4 < D | L X uh)l)  @  ! '  l u22-, u55u559d 3H u89Ex ? ) K u<<W Q s$ u / > M \  u ukhy@ L A f C@ u u@ u   C R W Cp HP uP u XH C0  Wt R uYYuYYu0Z4ZuhZ[\ M u&: aau    #8 2T u u u u A# T e! u  u  ,LF@E`XU4M\( GD>O\+k$yR<<l)DM@ ,>  + ,   ^ T p +x ,  +A ,A  + + *: , , + ,      +  ,  + , +,4Dd+h,|+A,A+D,D++,,+, + , $4$L+GP,GTXXX + , p+t,x+U,U+U,UL+ T, \xhY[+,+h,h+V,V0+4,D+hH,hpx++,,+W,W+X,X+[,[8BtE+\,\+ , +],]+^+_,^,_+`,`+a,a +b$,b@`+cd,chl+ p, +d,d+e,eR(,+f0,f4LhT+g,g+ , E$+ (, L+jP,j`;pU+k,k+l,l+m,mB@P+kT,k`h+np,nt|c+ , +q(,q0P+ T, `jj+ , .+r,r$p|+ , +s,s+t,t  r + $ , < L P ` d t x             !!+ !!, !!=4!D!Xd!+uh!,ul!x!+ |!, !!+ !, !I! ","<"+vD",vH"T"+wX",w`"p"0"f"*: "j"+ "", ""+",#(#[8#<#+@#,L#+hT#,hd#l#+xt#,x##>#+#,##+y#,y##+z#,z##$+ $,d$X$X$+$,$$$(%8%L%+P%+T%+X%,\%,`%,h%+l%,t%%+%,%+%%+%+%,%,%+%,%+%+%,%,%+%+%,%,%+%+%,%,&+&+ &,&,&+ &,(&8&,h&+l&,x&+&,&'+','+','+',(p(+t(,(+(,(0)+<),D)+L),h))+),0*Xh*Xt*X*+*,*X +++,+8+Xp+?+?+++, ,+,,,0,+4,,8,L,+P,,T,+\,,p,,,+,,-+ -,-@-+D-,H---+-,-T.+(.,<.T.+X.,`../+/,/+/,X/Z`0Kl0+x0,|00K0+0,01+1,$1`11K1+1,11+1,11K1+1,12+ 2+2,2, 2+$2,,282KH2+L2+P2,T2,`2+d2,l2p2+t2+x2,|2,2+2,22233+ 3,`3ZT4+X4,\4h4+t4,x44+4,44+4,44+4,45+5+5, 5,5+5,$5(5+,5+05,45,@5+D5,L5P5+T5+X5,\5,h5+l5,t5x5+|5+5,5,5+5,5555Z5K56(6+,6,46?:X7X7K7+7,77+7+7,7,7+7,7 8K8@8Z8+8+8,8,8+8,889949T9`9+d9,l99+:,<::K:+:,:;+;,;+ ;,0;+8;,H;d;x;+|;,;;+;,;;+;,;$<T<`<Z<+<,<<+<,<<<,=+4=,x=+|=,==+=,=;>0>+8>,p?+t?,??+?,??@+@,@@+@,@@+@,@@XHAPA+TA,tAA+A,AAXAXAAA+B,B+ B,0B+4B,`B+dB,xB+|B,B+B,BBEB+B,C+0C,8CU\CBpCC+C,CC+C, D+D,4D+8D,dD+hD,D+D,D+D,E+E,@x 0-LM@P, PU& x R00X\ 0 @0 @ XQ0Q0S:K0@@ =@ -L M0@S,S 0 S SK0 S S 0 @80 @-0 @J80 @"0 @J -L M0@S TK80 @0 @J -L M@\ 0S 0  0RQ Q 0 \0<0 @ 0 : @JK -LM`@0PV:p W:V WQQ VK0 @0 @J `0 @H0 @ 0 @J -LM@PpP`LP$ <QV@QQDQ(HQ#0, SS:0SP 04S:8 SKX1 @n 0 @J1 @[0 @J0 @I0 @J0 @S0 @J80 @f0 @J p-L MP0@P` V P  V QQKp`0 @0 @J  0 @ -L M0@S TK80 @0 @J p-L M@Q` PK2P(!R \0S  R 00S7 T0SQ h RT |QW \Z 0S] R_ KpP P8LQ 2 @UΠ0 @J0 P8 AR 1 @d0 @JT4P h P |$P P <P 0D 0 @40 @J0 @- @Jx@@: < '5@@@@@@ &5@t 0-LM@QPl P` ,R900@ l QA Q 2Q*0S S3*K0\1 @;Π0 @J1 @0 @J0 @0 @J0 @0 @J@@8 3@@@@@@ ?@$ p-L MPP`Q @P KpP@@@T >@0 @@@J @@@J4 -L MP@P,Q3 pP  K `P. 0SP@ P `0S  00@PS!0C`0S0 @ppJ @ppJ@@ >@H -L\MP@PpvQ} R{ P (K x `Pu 00@PV tKHPKpW" @ 0!@+R ^ DP X L,Dpu!`p`pp0XWMt0@S@ tPK@P `0S 0t0@PSx0x!C`QtKH x0 !0 @J @J~@@ >@X -L M@@@KnDKFPp0 @3`ttplt|tx\唔嘔DT嬔4t4@$0 4X$T244$4hd$`4P4H$L$@4<44$0TT8$,4(4 4$$4$$ 4$4#: c3c3#布3#3倓dH`s吓Dl@shTPsL,(2##3#3|3x#t3p3\3X#<83430#$33SSRĒ 3333 3322222""2222b2b22匂2drrT84@PP@ Q@;S` \000 P4@PU`)VP`% p P0P` ` 0 ! PG! @2 0@ < (K(1 @0 @P @J0 @J0 @ 0 @XJ@@< =``@`@@ =@@@@$  0-LMSh Q\ PP,^CPU" @B`B"U*Q @Q*^$ $X ADP1^ 00K0@@!^7@@@ _7PP@P@@ a7@@@ [7@@@` Z7PP@P@@8 Y7@@@@@@ X7@ -LtM@`PG @K(0S? 0S< XpPD    S P  @e) a.0DDPP@\Q )0K$ X  PX  KX 0 Sᐠ (K@@ '7@t$ -LMR0O QC P7P P% P Pp<`D@P$ $  00K $00@@` 2PP@P@@8 .>@@@@@@ 2@4 -LM PP`**Q pPNOO@1@;S% \p@P  P,  @P K  : @@@J0 @@@J0 @50 @@l@J\0 @I@0 @@@@J$ L -L M PZ Ql 0S_0S/QQQ|Q0@@   $4 T0 <0@0 K@P0@ @$ T0 <0@0 @@@Jp`<0$PD@ $ @ @@` ~2@@@8 =PP@P@@ 2@@@@` -LlM Pp`*Qh Rf @TPP (K0 @PPJ0 @PPJhP^_O@1@Y| \T\ PP= UP9  PKX  PP PP PC p 0  !H @PPJ1 @]P0@ @@PPJ~0 @]P0 @P|PJk@@` =@@@@D0 @0 @PPJN$ x -LMP0'R Q P:P  400 K@@` ?@@@8 G2@@@ F2@ p-L M P@`%*Q pPNOO@1@Q4 \PUD ER @PKp @@@J0 @@@J0 @0  : @P@@Jl0 @0 @@0@J@@ 9@@@@$  -L MP ) Q 0SXYYX  @04K @00J0@@8 ?@@@@@@ 2@ -LdM PP*Q @TTpp@q$@kP^_ORV 0DS\TP@儠KX   PPB PP=l R rK_t#\I X P U` P  Pt p 0 P\ ! VP`P0 @PPJ(K1 @0 @PhPJPP ,0\ X 0 @PPJK @PPJ0 @ZP0 @@PPJ@@ H:``@`@@d )=@@@@H0 @0 @PPJ$ t p-L M@PI 0S< QP+ U0aQP` U Kp0 @6` @ J \0 @'@@8 6@@@@@@ 6@ -L MP@#Q* ,Q 0 @c2‚  K|0 @ 0 @J0 @J @J -L M@P. 0S!@,P P K0 @  : @ J@@8 5@@@@@@ 5@ -LtM P`@P*Q 0S-@JP^_O,@ p@;S \ R Pt@XpWp  PP @PPJ(KP K㐢*3Q*pX 0pK@PPS PPM @PK 0P P PP@@ሐ匀00P  l 0!) 1SE P 0 00!d2 @iP0 @PJP 01 @_0 @JPPJv0 @PPJm,K0 PP00SF P 1 @PPJZ81 @P0 @  PPJD0 @U0 @PJPJ10 @0 @ PXPJ@@< <``@`@@ <@@@@$  -LdM P4 p"*Q PNOOM4@1@kVT \P@ F KO@#!R TQ0PX0SK^&^J 0S 0\03:80 P0 0640\ 8,\:(@ T*  @@@J @@@J(K4\ 8,@\:(\40\ 8,@\:(8 Q0^dl Qh00`0 Ypt0`h  R8 5 @0 P @✀\=  R0*^ ^  0R*pW  :0 pWPpUXp\0p@8 000 R p㐀^ ]?@Pp P8 pP hA RP0R*P*0  @S0b000 5L L0Q`0L 5LQ 0hP@< ‐ <0H \ x8)0 T < 03^D T4  ZL@Py< TP PX d 倐\$ZL@Q0dH x8x x .!0  0 3R4 ZH @ x802 01!00 003S40  Z PUGpXD\AO꜀\ldtPx0'Cx0 4P  Q@0p8 08 00 R1TPXd hP2 吐 B 0†L2ࠠ吐@@P^!8p`@hW0 P,PP @p@4 0P  , 0@( ,@P  ! U@Pd0@Sdp0W Xp\ l@ l0ZV 0 @@@@Je @@@J_ Z l@ l0 @@@JM @@@JD Dl0 p l0pZ<@ l0 p l0p0 @@@J)2! 0h0NK@  @@J@@ !;PP@P@@ /=pp@p@@ ;``@`@@ ;@0 @@X@J@@@ ;pp@p@@ ;``@`$ t -L$M P0 `#*Q 0S PO0 @@KT. \PUJx:K#Q TPK0 R*0S10S Z 8\dl \ < p YXtp<@ X] 4 0p P40R x p0 S0 PS0! Z 1S40 8 ?  ?4px z 808P PR]4pQ*x  4 W)* 03\Z RIp4x  Q) *03^ D0 D0P54pQ8P@`<00p`,pVhp `0 0P|  ,0(,P{  !W`pd r3d(K  0 @J D0 D0P 8  03P Rp4x 808P P @J D DP K @J @J` @J0 @J@@ !:@@@@@@ :PP@P0 @J{@@ :PP@P@@h :``@`@@@ }:@@@ :@@@@$ t -LDM P@ :0 @J(K@PJ!@T 0L @[U \Z` !L` T p?p@-Hp @`Kp`P. `P 0H  <0 8 0 4  0c `\8P0S`0 `O0 HP X0 `VH p! @1\P 0@P0  PP_   POP `HQp\PTpL@`tpp@@ P 0@;X  !T: jX0!O\0 @Z0 @JI@@d b9@@@@@@< 9@@@ 9PP@P$ ( 0-LM@P pPU t0t0p0K0@@ 5@4 -L`Pr@ p@P  0S@   p 0T@P U``@-}@P@@-T-nVt p-L M`P@! Q) eP`PdP\hPlPpPtPxP0PP,P0P004Punload region.ko ....OK! [Func]:%s [Line]:%d [Info]:RGN register device failed. RGN CMPI_RegisterMod failed. <6>load region.ko ....OK! ioctrl order err 0x%x! [RGN] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:47] ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/region/region.cpstSrc != HI_NULLpstDst != HI_NULLpstChn != HI_NULLenType >= 0 && enType < RGN_TYPE_NUM_MAXpstChn->enModId >=0 && pstChn->enModId < HI_ID_BUTTpstChn->s32DevId >=0 && pstChn->s32DevId < pstModInfo->u32DevNumMaxpstChn->s32ChnId >=0 && %: pstChn->s32ChnId < pstModInfo->u32ChnNumMaxpstModInfo->ppstChnMng != HI_NULL -----REGION STATUS OF OVERLAY--------------------------------------------------- %4s%5s%5s%6s%4s%4s%8s%9s%9s%8s HdltypeUsedPiFmtWHBgColorPhyVirtStride%4d%5d%5d%6d%4d%4d%8x%9x%9x%8d -----REGION CHN STATUS OF OVERLAY----------------------------------------------- %4s%4s%4s%4s%4s%4s%4s%4s%5s%5s%4s%5s%3s%5s%5s%5s%5s%5s typmoddevchnbShXYAphFAphBlaybAQpQPbInvInvWInvHLumaChnMpstRgnChnAttr != HI_NULL%4d%4d%4d%4d%4d%4d%4d%4d%5d%5d%4d%5d%3d%5d%5d%5d%5d%5d -----REGION STATUS OF COVER--------------------------------------------------- %4s%5s%5s %4d%5d%5d -----REGION CHN STATUS OF COVER----------------------------------------------- %4s%5s%5s%5s%5s%6s%6s%6s%6s%6s%6s%10s%6s bShowFieldColor-%4d%5d%5d%5d%5d%6d%6d%6d%6d%6d%6s%10x%6d -----REGION STATUS OF COVEREX------------------------------------------------- -----REGION CHN STATUS OF COVEREX--------------------------------------------- -----REGION STATUS OF OVERLAYEX--------------------------------------------------- %4s%5s%5s%6s%6s%6s%10s%9s%9s%8s %4d%5d%5d%6d%6d%6d%10x%9x%9x%8d -----REGION CHN STATUS OF OVERLAYEX----------------------------------------------- %4s%4s%4s%4s%4s%6s%4s%6s%6s%5s%5s%4s %4d%4d%4d%4d%4d%6s%4d%6d%6d%5d%5d%4d 0pstRgnCtrl != HI_NULLpstRgnChnMng != HI_NULL[Func]:%s [Line]:%d [Info]:Rng have over! pixelfmt%d unique! bAbsQp:%d err! bAbs:%d;Qp:%d err! Alpha:%d err! PixelFmt:%d err! SIZE(W:%d,H:%d) err! SIZE(W:%d,H:%d), MaxArea=%d err! bInvColEn:%d err! For Enable InvCol,Point(X:%d,Y:%d) err! For Enable InvCol,Size(W:%d,H:%d) err! u32LumThresh:%d err! ChgMod:%d err! Point(X:%d,Y:%d) err! Layer:%d err! pstRgnComm != HI_NULLNot suport rgn type! bShow(%d) is not set! Point Y(%d) should be align to 4, when attach field is single field! Size H(%d) should be align to 4, when attach field is single field! &: mod:%d err! entype:%d,Mod:%d not register! dev:%d err! chn:%d err! RgnType:%d is err! PTR is NULL! pstChnGetInfo != HI_NULLppstChnMng != HI_NULLpstModInfo != HI_NULLhandle:%d is err! Region(%d) is unexist! Region(%d) type %d not support get attach field! Region(%d) invalid field value %d! Region(%d) type %d not support set attach field! Region(%d), Y(%d) and H(%d) should be align to 4, when attach field is single field! Region(%d) has been attached to someone, please detach first! pstSrcRgnComm != HI_NULLpstDestRgnComm != HI_NULLchange static attribute(layer) change static attribute(point) change static attribute(size) change static attribute(pixelfmt) change static attribute(FgAlpha) change static attribute(BgAlpha) change static attribute(GlobalAlpha) change static attribute(BgColor) change static attribute(QP) change static attribute(InvColInfo) pstDest != HI_NULLs32Pos != -1Region(%d) is not exist! Chn(Mod:%d,Dev:%d,Chn:%d) err! 0 == memcmp(&pstNode->stChn,pstChn,sizeof(MPP_CHN_S))pstCommAttr != HI_NULLpstDisp != HI_NULLRegion(%d) is not attached to Chn(Mod:%d,Dev:%d,Chn:%d)! pstDisp->enType >= 0 && pstDisp->enType < RGN_TYPE_NUM_MAXnot surport type(%d)! Region:%d is unexist! Region:%d,type is change! Region(%d) is not attached to chn(%d,%d,%d)! pstRegion != HI_NULLpstComm != HI_NULL((enType < RGN_TYPE_NUM_MAX) && (enType >= 0))Region: %d, type: %d is not support! HI_NULL == pstModInfo->ppstChnMngkmalloc faild! HI_NULL == *ppstChnMngChn attr's type(%d) didn't match Region(%d)'s! Chn(Mod:%d,Dev:%d,Chn:%d)'s RegionNum is too much! region(%d) kmalloc faild! pstChnMangTmp != HI_NULLrgn(%d) unexist! bitmap is not support! HI_TRUE == pstRgnCapacity->stPixlFmt.bCommHI_TRUE == pstRgnCapacity->stSize.bCommHI_TRUE == pstRgnCapacity->stBgClr.bCommu32BmpCnt invalid pData of bmp%d is NULL u32Stride of bmp%d is invalid:%d enPixelFormat of bmp%d is invalid copy_from_us3:er err:%d,h:%d bitmap is not support! bitmap h or w err! pixel format err! overlay copy bmp to kernel err(copy_from_user dest:%p src:%p)! HI_SUCCESS == s32Ret((pstRgnCtrl->enType < RGN_TYPE_NUM_MAX) && (pstRgnCtrl->enType >= 0))RgnPinPonvpp alloc coef mem failed! vpp alloc mmp buffer failed! malloc rgn bmp err! u32BytePerPix != 0Region:%d is exist! malloc failed! frametopbotmhi3521_regionGNUʵrV'ƣISA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rel.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 px:)$<% H8`4 0 GplC 0 O܄X2|(kg H  uL$q  p$): 0 p/Û   a   (<$( 2`,AK[<g l q8t$ @ ` q   q   1 q  h l( ! q q1@,N0g lX (   A4( _l d    qL P i oX u {` , L P h l p x |   <  @  8 D H L P T \ d h p t |  # ) / 5 ;@ AL G MX S Y _ e k q wl }  4 <:X    qq q q|0 L  q\ q p q q $ q  q@!D!t 4   \ qx#|#  q`$d$ q$$ < % + 1 q ((7 = C I q **O U [ q**q,,q.., a q44g, q55q4686mD sp yX q77 T   q ::    , P t      q? ?q?@qBB, qLDTD@ qGGl P  q$J,J qLLqMM q OO?: qPPqQQ&h -, qRR4 ; B qUUI P qVVW@ ^ qdXlXqXXqXY\Yq\\e lh q<^@^q0_4_s q0`4`z   8 qeeT  x  0 h  T   qHoTo    qDuPu qxxqTyXyqPzTzqH{P{ x    "0 q}}) 0 qq 7 F U0 d< oH~\ hx   # 2$A4PH_Xnh}x $"41L@`Ox^m |  *:  ( 4D !P0` q q4?0 q qD KD# ^h o|! q   TDXRG$ Pu 7p - lX; G P0S ] \ln q P  < 0       D!8 4_   " 2 P{PA M 4\ l 4@ y 0 h4   @  t *D t   O xt 4`. 86l@ ,pN Mf e8 s Tz X $, d d$    (4d  @^   $1 (@ K U $0b l P .l   30  }P 5 ? $  l  P# :2 = P a *t |# B Xy Lp  To ,J U \Yx V'1@$M*: $aRgnOpenRgnCloseRgnPollRGN_Notify.LANCHOR0RGN_QueryState.LANCHOR1RGN_GetVerMagicRGN_ModExit.LC0.LC1$dRGN_ModInit.LC2.LANCHOR2.LC3.LC4.LC5Rgn_ioctlRgnIoctl.LC6.LC7__func__.29063__mod_version402__mod_license401__mod_author400s_u32RgnStatergn_fopss_stRgnModules_stExportFuncss_stRgnUserRefs_stRgnDevicegs_u32RgnVersion.LC8.LC9.LC10.LC15.LC11.LC16.LC12.LC13.LC14.LC17.LC18.LC19.LC20.LC21.LC22.LC23.LC27.LC24.LC28.LC25.LC26.LC29.LC30.LC31.LC32.LC33.LC34.LC35.LC36.LC37.LC38.LC39.LC40.LC41.LC42.LC44.LC45.LC46.LC47.LC50.LC48.LC51.LC49.LC52.LC53.LC54.LC55.LC56.LC57.LC58.LC59.LC60.LC61.LC62.LC43.LC63.LC64.LC66.LC67.LC65.LC68.LC70.LC69.LC71.LC72.LC73.LC74.LC79.LC77.LC75.LC76.LC78.LC80.LC81.LC85.LC86.LC84.LC83.LC82.LC89.LC90.LC87.LC88.LC93.LC91.LC92.LC94.LC95.LC96.LC98.LC97.LC101.LC102.LC99.LC100.LC114.LC105.LC106.LC107.LC108.LC109.LC110.LC111.LC112.LC113.LC104.LC103.LC115.LC116.LC118.LC117.LC119.LC120.LC121.LC122.LC124.LC123.LC127.LC126.LC125.LC129.LC128.LC131.LC130.LC133.LC132.LC134.LC135.LC136.LC137.LC138.LC147.LC144.LC148.LC145.LC146.LC140.LC141.LC139.LC143.LC142.LC152.LC149.LC150.LC151.LC153.LC159.LC155.LC156.LC158.LC157.LC154.LC160.LC161__func__.23452__func__.22636__func__.25024CSWTCH.485__func__.22597__func__.22581__func__.23718__func__.23391__func__.22899__func__.22824__func__.22813__func__.22801__func__.22769__func__.22850__func__.22743__func__.22732__func__.23040__func__.22700__func__.24987__func__.24952__func__.24869__func__.23226__func__.23276__func__.24836__func__.24484__func__.24442__func__.22920__func__.23753__func__.23649__func__.23579__func__.24616__func__.23527__func__.23480__func__.22519__func__.24669__func__.22468__func__.24709__func__.22441__func__.24022__func__.22413__func__.24059__func__.23236__func__.24812__func__.23204__func__.24517__func__.24261__func__.24143?:__func__.23944__func__.23193__func__.23870__func__.23152__func__.23896__key.23874__mod_srcversion23__module_depends__mod_vermagic5RgnDelRgnFrmChnRgnSetDisplayAttrRgnDetachFrmChnRgnCheckChnRgnsOverlapCMPI_RegisterMod__this_moduleRgnDestroysnprintfRgnCmpHandleValueRgnSetAttachField__arm_ioremapRgnAttrToCommfinish_waitRgnCmpLayer__iounmapRgnMallocModInfoupRgnGetChnRgnAttrcleanup_moduleg_stRgnSpinLockprepare_to_waitmemcpyCMPI_MmzMallocCMPI_UserCopykfreeRgnCheckInvColRgnMallocChnMngRgnGetChnManage__wake_upRgnUpdBgColorCMPI_RemoveProcRgnAllocBmpMeminit_moduleRgnFreeModInfoCMPI_CreateProcg_aastModChnRGN_ExitRgnProcscheduleg_astModulesRgnCheckSetAttrRgnGetChnGetInfog_astRgnCapacityRGN_PutRegiong_apstRgnCtrlkmem_cache_allocRgnGetDisplayAttrRgnFreeBmpMemRgnAttachToChnRgnGetAttachFieldRGN_GetRegionRgnChnAttrToDisplayAttrRgnUpdBitMapRgnInitCtrlRgnCmpPostionRgnIsRgnCascadeRgnIsPointInRectRgnCheckLayerRgnCheckPixlFmtUniqueCMPI_UnRegisterModpanicRgnFreeChnMngmemcmpRGN_RegisterModprintkRGN_ProcRgnIsBmpCoverRgnRgnCheckMppChnRgnCheckQpRgnMemSetRgnCheckAttr__memzeroRgnDisplayAttrToChnAttrRgnCfgCapaHI_LOG__init_waitqueue_headRgnInitCMPI_MmzFreeRgnCreateRGN_UnRegisterModRgnCheckSetDisplayAttrg_stRgnSemRGN_InitRgnCheckAlphaRgnCheckSizeRgnCheckStaticseq_printfdown_interruptible__aeabi_uidivmodRGN_SetModifyFalseRgnCheckPointRgnUpChnAttrRgnExitRgnChnRgnsSortautoremove_wake_functionRgnSetBitMapRgnAddRgnFrmChnRgnCommToAttrCMPI_UnRegisterDeviceRgnSetAttr__copy_from_userRgnGetAttr__kmallockmalloc_cachesRgnCheckPixlCMPI_RegisterDeviceL+ P, l+ p, +,+ , + , X+\,` 4Xh|+ , + , 4@+D,X+ \, |+,t+0x+1|+2,0,1,2+3,3+0<:+1+2,0,1,2+4,4+5 ,5\+0`+1d,0h,1t+6x,6+0+1,0,1+7,7+0+1,0,1+8,8+0+1,0,1+9,9+0 +1 ,0 ,1 +: ,: $ +0( +1, ,00 ,1< +;@ ,;H L `  +> ,> +? ( +@, ,@0 +A4 @ +BD +CH ,BL ,CP +DT ,DX ,?\ ,Ah +Ep ,Ex +F ,F +G ,G +H ,H +I ,I +J ,J , +K4 ,Kx  +K ,K  +> ,> +L  +M ,M +N  +O +C ,O ,C$ +P( ,P, ,L0 ,N< +QD ,QL +RT ,R\ +Sd ,Sl +Tt ,T| +U ,U +V ,V +W ,W +X ,X +Y ,Y +Z ,Z +[ ,[ +\ ,\ +] ,] +^ ,^ d +_l ,_ +>,>+`,`+a+C,a,C+D,D4+b<,bHT+b\,bl|+>,>+c+d,d+e,e,c+f,f+C,C+g,g+D,D +2(,2H+h,h$+i,,iX+>,>+j,j+a+C,a,C+D,D+b$,b0<+bD,bTd+>h,>l+2t|+k,k+f,f+C,C+D,2,D x+h,h+i,iD+>H,>PX+l\,l`l+mt,m|+C,C+D,D+n ,ndt+n|,n+>,>+2+o,o,2+p,p+C,C +P): (,Ph+h,h+q,q,P\+0`+1d,0h,1t+rx,r+>,>+0+1,0,1+r,r+0+1,0,1+r,r+0+1,0,1+r,rX+5\,5+0+1,0,1+6,6+0+1,0,1+7,7+0+1 ,0,1+8 ,8(,+00+14,08,1D+9H,9PT+0X+1\,0`,1l+:p,:x|+0+1,0,1+;,;+0+1,0,1+w,wT+0X+1\,0`,1l+zp,zx|,+}0,}<H+~L,~P\+0`+1d,0h,1t+x,+},} +,\+0`+1d,0h,1t+x,+},}+},},@+D,Lh+}l,}x+,+},}+ , +},}+,L `  +} ,}  + ,  +} ,} +} ,}! !+$!,0!@!!!!!! "+}$",}0"@"+D",H"d"+}h",}t""+",""+}",}""+",""+}",}##+#,$#@#+}D#,}P#`#+d#,h#x####+}$,}$($+,$,4$D$+}T$,}`$$+}$,}$$+$,$$%%%+}&,} &&+ &,$&<&p&+}t&,}&&+&,&&&&&'0'D'+}3:H',}T'd'+h',l''+}',}''+',''+0'+1',0',1'+:',:''+0'+1',0',1'+(,( ((H(+5L(,5(+}(,}((+(,((+}(,}))+),)8)+}<),}H)X)+\),`)|)+}),}))+),))+0)+1),0),1)+:),:))+0)+1),0),1)+9*,9* *8*X*h*+0l*+1p*,0t*,1*+*,**+*,**+*,**+(+p++++,++++,+++0++1+,0+,1,+ ,,,,P,|,,,,+5,,5--(.+,.,4.H.+L.,T.`.+0d.+1h.,0l.,1x.+|.,...+.,.44+ 4,L4`4+0d4+1h4,0l4,1x4+|4,444455(5@5X5+0\5+1`5,0d5,1p5+t5,|555+55,555+}5,}55+5,66+ 6,$646`6+5d6,5t666+6,66+6,67+} 7,}7,7+07,87@7\7+}`7,}l7|7+7,77777+7,77+57,58`88+}8,}88+8,888+}8,}99+9,9 9<9+}@9,}L9P9+`9,x9+}|9,}99+9,999+}9,}99+9,99 :::;+} ;,};$;+(;,,;d;+}h;,}t;;+;,;;;+};,};;+;,;<,<+}0<,}&: <<H<+L<,P<<+}<,}<<+<,<<+}<,}<=+=,=@=+}D=,}P=\=+`=,d==+}=,}==+=,==+}=,}>>+>,>D>\>+}`>,}l>x>+|>,>>+>,>>+0>+1>,0>,1>+>,>>+0>+1>,0>,1>+>,????+5 ?,5H?l?????(@+5,@,5L@l@AAB,>+ ,$(+,,08+ , $+(,,@T+X+\,`,lx+|,++,,+,++,,+, <@D  $08ltx|  " :pinmux_hi3521_4X720P.sh9Y'X8Y#pin select muxctrl_reg0 himm 0x200f0000 0x00000000 #VIU0_CLK / GPIO12_0 / / muxctrl_reg0 himm 0x200f0004 0x00000002 #VIU0_VS / GPIO12_2 / VIU0_CLKA / muxctrl_reg1 himm 0x200f0008 0x00000000 #VIU0_HS / GPIO12_3 / UART2_RXD / muxctrl_reg2 himm 0x200f000c 0x00000000 #VIU0_DAT15/ GPIO0_0 / / muxctrl_reg3 himm 0x200f0010 0x00000000 #VIU0_DAT14/ GPIO0_1 / / muxctrl_reg4 himm 0x200f0014 0x00000000 #VIU0_DAT13/ GPIO0_2 / / muxctrl_reg5 himm 0x200f0018 0x00000000 #VIU0_DAT12/ GPIO0_3 / / muxctrl_reg6 himm 0x200f001c 0x00000000 #VIU0_DAT11/ GPIO0_4 / / muxctrl_reg7 himm 0x200f0020 0x00000000 #VIU0_DAT10/ GPIO0_5 / / muxctrl_reg8 himm 0x200f0024 0x00000000 #VIU0_DAT9 / GPIO0_6 / / muxctrl_reg9 himm 0x200f0028 0x00000000 #VIU0_DAT8 / GPIO0_7 / / muxctrl_reg10 himm 0x200f002c 0x00000000 #VIU0_DAT7 / GPIO1_0 / / muxctrl_reg11 himm 0x200f0030 0x00000000 #VIU0_DAT6 / GPIO1_1 / / muxctrl_reg12 himm 0x200f0034 0x00000000 #VIU0_DAT5 / GPIO1_2 / / muxctrl_reg13 himm 0x200f0038 0x00000000 #VIU0_DAT4 / GPIO1_3 / / muxctrl_reg14 himm 0x200f003c 0x00000000 #VIU0_DAT3 / GPIO1_4 / / muxctrl_reg15 himm 0x200f0040 0x00000000 #VIU0_DAT2 / GPIO1_5 / / muxctrl_reg16 himm 0x200f0044 0x00000000 #VIU0_DAT1 / GPIO1_6 / / muxctrl_reg17 himm 0x200f0048 0x00000000 #VIU0_DAT0 / GPIO1_7 / / muxctrl_reg18 #VIU1 muxctrl_reg19 himm 0x200f004c 0x00000000 #VIU1_CLK / GPIO12_1 / / muxctrl_reg19 himm 0x200f0050 0x00000002 #VIU1_VS / GPIO12_4 / VIU1_CLKA / muxctrl_reg20 himm 0x200f0054 0x00000000 #VIU1_HS / GPIO12_5 / UART2_TXD / muxctrl_reg21 himm 0x200f0058 0x00000000 #VIU1_DAT15/ GPIO2_0 / / muxctrl_reg22 himm 0x200f005c 0x00000000 #VIU1_DAT14/ GPIO2_1 / / muxctrl_reg23 himm 0x200f0060 0x00000000 #VIU1_DAT13/ GPIO2_2 / / muxctrl_reg24 himm 0x200f0064 0x00000000 #VIU1_DAT12/ GPIO2_3 / : / muxctrl_reg25 himm 0x200f0068 0x00000000 #VIU1_DAT11/ GPIO2_4 / / muxctrl_reg26 himm 0x200f006c 0x00000000 #VIU1_DAT10/ GPIO2_5 / / muxctrl_reg27 himm 0x200f0070 0x00000000 #VIU1_DAT9 / GPIO2_6 / / muxctrl_reg28 himm 0x200f0074 0x00000000 #VIU1_DAT8 / GPIO2_7 / / muxctrl_reg29 himm 0x200f0078 0x00000000 #VIU1_DAT7 / GPIO3_0 / / muxctrl_reg30 himm 0x200f007c 0x00000000 #VIU1_DAT6 / GPIO3_1 / / muxctrl_reg31 himm 0x200f0080 0x00000000 #VIU1_DAT5 / GPIO3_2 / / muxctrl_reg32 himm 0x200f0084 0x00000000 #VIU1_DAT4 / GPIO3_3 / / muxctrl_reg33 himm 0x200f0088 0x00000000 #VIU1_DAT3 / GPIO3_4 / / muxctrl_reg34 himm 0x200f008c 0x00000000 #VIU1_DAT2 / GPIO3_5 / / muxctrl_reg35 himm 0x200f0090 0x00000000 #VIU1_DAT1 / GPIO3_6 / / muxctrl_reg36 himm 0x200f0094 0x00000000 #VIU1_DAT0 / GPIO3_7 / / muxctrl_reg37 #VOU1120_CLK internal sync himm 0x200f0098 0x00000001 #GPIO12_6 / VOU1120_CLK / LCD_CLK / muxctrl_reg38 himm 0x200f009c 0x00000001 #GPIO4_0 / VOU1120_DAT15/ UART3_TXD / muxctrl_reg39 himm 0x200f00a0 0x00000001 #GPIO4_1 / VOU1120_DAT14/ LCD_DATA_G1 / muxctrl_reg40 himm 0x200f00a4 0x00000001 #GPIO4_2 / VOU1120_DAT13/ LCD_DATA_G2 / muxctrl_reg41 himm 0x200f00a8 0x00000001 #GPIO4_3 / VOU1120_DAT12/ LCD_DATA_G3 / muxctrl_reg42 himm 0x200f00ac 0x00000001 #GPIO4_4 / VOU1120_DAT11/ LCD_DATA_G4 / muxctrl_reg43 himm 0x200f00b0 0x00000001 #GPIO4_5 / VOU1120_DAT10/ LCD_DATA_G5 / muxctrl_reg44 himm 0x200f00b4 0x00000001 #GPIO4_6 / VOU1120_DAT9 / LCD_DATA_G6 / muxctrl_reg45 himm 0x200f00b8 0x00000001 #GPIO4_7 / VOU1120_DAT8 / LCD_DATA_G7 / muxctrl_reg46 himm 0x200f00bc 0x00000001 #GPIO5_0 / VOU1120_DAT7 / LCD_DATA_B0 / muxctrl_reg47 himm 0x200f00c0 0x00000001 #GPIO5_1 / VOU1120_DAT6 / LCD_DATA_B1 / muxctrl_reg48 himm 0x200f00c4 0x00000001 #GPIO5_2 / VOU1120_DAT5 / LCD_DATA_B2 / muxctrl_reg49 himm 0x200f00c8 0x00000001 #GPIO5_3 / VOU1120_DAT4 / LCD_DATA_B3 / m:uxctrl_reg50 himm 0x200f00cc 0x00000001 #GPIO5_4 / VOU1120_DAT3 / LCD_DATA_B4 / muxctrl_reg51 himm 0x200f00d0 0x00000001 #GPIO5_5 / VOU1120_DAT2 / LCD_DATA_B5 / muxctrl_reg52 himm 0x200f00d4 0x00000001 #GPIO5_6 / VOU1120_DAT1 / LCD_DATA_B6 / muxctrl_reg53 himm 0x200f00d8 0x00000001 #GPIO5_7 / VOU1120_DAT0 / LCD_DATA_B7 / muxctrl_reg54 #VGA himm 0x200f00dc 0x00000002 #GPIO13_0 / VOU1120_HS / VGA_HS / muxctrl_reg55 himm 0x200f00e0 0x00000002 #GPIO13_1 / VOU1120_VS / VGA_VS / muxctrl_reg56 #BT656 himm 0x200f00e4 0x00000001 #GPIO12_7 / VOU656_CLK / reserved / SDIO_CCLK_OUT / muxctrl_reg57 himm 0x200f00e8 0x00000001 #GPIO6_0 / VOU656_DAT7 / LCD_DATA_R0 / SDIO_CARD_POWER_EN / muxctrl_reg58 himm 0x200f00ec 0x00000001 #GPIO6_1 / VOU656_DAT6 / LCD_DATA_R1 / SDIO_CARD_DETECT / muxctrl_reg59 himm 0x200f00f0 0x00000001 #GPIO6_2 / VOU656_DAT5 / LCD_DATA_R2 / SDIO_CWPR / muxctrl_reg60 himm 0x200f00f4 0x00000001 #GPIO6_3 / VOU656_DAT4 / LCD_DATA_R3 / SDIO_CCMD / muxctrl_reg61 himm 0x200f00f8 0x00000001 #GPIO6_4 / VOU656_DAT3 / LCD_DATA_R4 / SDIO_CDATA3 / muxctrl_reg62 himm 0x200f00fc 0x00000001 #GPIO6_5 / VOU656_DAT2 / LCD_DATA_R5 / SDIO_CDATA2 / muxctrl_reg63 himm 0x200f0100 0x00000001 #GPIO6_6 / VOU656_DAT1 / LCD_DATA_R6 / SDIO_CDATA1 / muxctrl_reg64 himm 0x200f0104 0x00000001 #GPIO6_7 / VOU656_DAT0 / LCD_DATA_R7 / SDIO_CDATA0 / muxctrl_reg65 #SIO0 himm 0x200f0108 0x00000001 #GPIO7_0 / SIO0_RCLK / muxctrl_reg66 himm 0x200f010c 0x00000001 #GPIO7_1 / SIO0_RFS / muxctrl_reg67 himm 0x200f0110 0x00000001 #GPIO7_2 / SIO0_DIN / muxctrl_reg68 #SIO1 himm 0x200f0114 0x00000001 #GPIO7_3 / SIO1_RCLK / muxctrl_reg69 himm 0x200f0118 0x00000001 #GPIO7_4 / SIO1_RFS / muxctrl_reg70 himm 0x200f011C 0x00000001 #GPIO7_5 / SIO1_DIN / muxctrl_reg71 #SIO2 himm 0x200f0120 0x00000001 #GPIO7_6 / SIO2_XCLK / muxctrl_reg72 himm 0x200f0124 0x00000001 #GPIO7_7 / SIO2_XFS / muxctrl_reg73 himm 0x200f0128 0x00000001 #GPIO8_0 / SIO2_R: CLK / muxctrl_reg74 himm 0x200f012c 0x00000001 #GPIO8_1 / SIO2_RFS / muxctrl_reg75 himm 0x200f0130 0x00000001 #GPIO8_2 / SIO2_DIN / muxctrl_reg76 #SPI himm 0x200f0134 0x00000001 #GPIO8_3 / SPI_SCLK / muxctrl_reg77 himm 0x200f0138 0x00000001 #GPIO8_4 / SPI_SDO / muxctrl_reg78 himm 0x200f013c 0x00000001 #GPIO8_5 / SPI_SDI / muxctrl_reg79 himm 0x200f0140 0x00000001 #GPIO8_6 / SPI_CSN0 / muxctrl_reg80 #himm 0x200f0144 0x00000000 #SPI_CSN3 / NF_BOOT_PIN4 / CLK_TEST_OUT0/1/2/3 #I2C #himm 0x200f0148 0x00000001 #GPIO13_2 / I2C_SDA / muxctrl_reg82 #himm 0x200f014c 0x00000001 #GPIO13_3 / I2C_SCL / muxctrl_reg83 #HDMI pinmux -uboot #himm 0x200f01cc 0x00000001 #GPIO11_4 / HDMI_HOTPLUG/ muxctrl_reg115 #himm 0x200f01d0 0x00000001 #GPIO11_5 / HDMI_CEC / muxctrl_reg116 #himm 0x200f01d4 0x00000001 #GPIO11_6 / HDMI_SDA / muxctrl_reg117 #himm 0x200f01d8 0x00000001 #GPIO11_7 / HDMI_SCL / muxctrl_reg118 :hiuser.ko9Y9Y9Y ELF(T4(0?#80 #0B>>6P:O -L -L -L -L -LGNUbsW>˗Hvi@*hi_user_notify_vdec_eventhi_dma_map_areahi_sched_setschedulerauthor=Hisiliconlicense=GPLdepends=vermagic=3.0.8 mod_unload ARMv7 hiuserA*aeabi 7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.init.text.exit.text.note.gnu.build-id.rel__ksymtab__ksymtab_strings.modinfo.data.rel.gnu.linkonce.this_module.bss.ARM.attributes.note.GNU-stack.comment4 %0;$R$N 0\@nXLw$}   p+t% 4 L:B\*|     )!     p/$ =LLbn`$ahi_user_inithi_user_exit__kstrtab_hi_user_notify_vdec_event__kstrtab_hi_dma_map_area__kstrtab_hi_sched_setscheduler__mod_author169__mod_license168$d__ksymtab_hi_sched_setscheduler__ksymtab_hi_dma_map_area__ksymtab_hi_user_notify_vdec_event__module_depends__mod_vermagic5hi_dma_map_area__this_modulecleanup_modulehi_sched_setschedulerinit_modulehi_user_notify_vdec_eventhi_dma_inv_range|+( %*)'):hi3521_vou.ko9Y9Y9Y- ELF(x~4( -L@@@ 3  0 R\ -LMP@@@8 e΁ `L-p` 0 p f P`@pQP0 bE8@20@bp de0H8pPDL6(K -LP0Dp2S Q22"022 -L -L -L -LP00@   -L@x7S0"00 -L 3@ 0-L@0SJ0@8P@@?0υ<00@?0C/20 -L -L@@@QY hPP@P PC P@\ Q P@ UF \ Y@P0<S  D00@ 0 @|  H0@Qx L儐 t XT ,^Qp 4吀@(0 ĀZ |0^,@x 00lh tp儠$( 0,48@  @ !@ @  @ @ 1@ @ b@QL—@@@ @P`P@TP\00 PPP@pb hPl`B@|$ P:@l@ pp@l@ ``@l@ PP@l@ @@@l@ @@ l00@l@ J P{ P@0l0@ 0@ ]P0<S00@p   0 @0@@t ZDx H| L  XT ,YQㄐ @4(@^0p0@Y|0 倐t x0匐儠, 00 P$(0,lh 48 Uh唐h \─ l@ h l@l @ @00@@@pp@`p`@ `@@@@pp@ ph`p`@p@p` ``@h0SV p@劃Ô\ PU \ P@ ^  Q P@ U? P@\ Z_ P@ U0 \ ^@Z X0PRl  S 00^008 hZh l@pl@`l`@`@ 0 @0@`@@@@ @h :^g hP冣Õ\  R QH  RP@ \  R P P@ UJ pp lhP@\  0R S P@ U2 \  0R SR 0$ n@ 0`ianaobRu $ n0 @P`@ianaob Upp `l h `|Vl@pl@p@pp`l`@` @` 0 @0@``@``@@@@ @@弐 @$@(: hp @p P HhPy p@sÔ\ PU 0SP@ \ pW P@ Ub  P@\ `V P@ US \ 0S0S d^hlx |0`{ @ 00`p l$r(p@Z X0PRl  S 00^00쫜8 t ``hV,h vl@ l@pl @ @00@p@`p`@`@@ @@pp@`p`@`@ @$뤐`p`@p@@@ PP P<PP@Px S@@ 堐 @P Tl R 0S0PHSL’0Y\ P ’Q  \| Px ’ Qt \p  Sh 0  0 4P@Qt@ p Sl @0 0 0@ℐ$(倐|,0 xtph唐 吐4 T0Y ul@l@븀l@ 0 @0@ @$@pp@`p`@ `@@@@@p(p@`,p`@p0`@pp @㔠 嘀 PP  p3p@ @@@㓠&|XR CPhp  P@R Yl P@ U R P0S ě(0t S`p`p |px|p x d    p \ Xl@p0p|x 匠t删儐倠h  $(,0p0S5 d^h: l x|0pk1  @0 0p` l$œ(0S ī0堠 S`| `pp xpp | (" d  x \㴐  t Xp |0x@P‐@lh 儐$(刐,0p 匐吐堐t URhpppWlp` $l@l@@@$@l @ @0p0@p@`p`@p `p@`p`@p `p@ `,p p@@@@@(0@0@p h0 4 PF pP凃Õ\ @T PP@ \ X1 P@ U/ \  R, P@\ 0S hR 0 Āl@ 0 0P@ `$`(`,` UpWl@l@l @ @00@@@@@p p@`p`@`@@Pt l@ll@l@`嬠㰀@p l @00@`@ pP 00@〓Y P 0&00@R xP 00@〙Y P 0,00@R ~P 00@〟Y  P `J00@P tsP pV͠00@ Q zl@pl@l @ @00@p@p@@@ @뜀00@sW 00@Q 00@ P 0,00@R p00@Q J͠00@ Qk V-00@\p l@(K0hS帀  0 :@  00l吀 `$`(`,`ꐀĀU㌠ H P* Pb 0dhlx |0`{dx|0pkp{(p `| `倐 x | 00 d吠 @t x ī(t `0`0 |x| x d  @ ohP^ 0 P@P @0 0@P@l@ `$`(`,`) 0@P@PS 00T 0@@U@lPPR P ^K@8 .R $ N@l 0@؉NAOB 0@P㠀夐S 00X 0YlR   \ ˞8 h Q 0 t t0@ 0l R $ ؎@l 0؉Ў؏\0S d^hl x@|0儀[  @0 @0P l$B(@0S d^hl0x |儀{ 0@ 0 p l$(HH\D@K  @P`dht8hp(`0@P@l  P`mEU0`@`@S@uP0 0Tp@ @UP PW (p pX Q `Q@  Q@$ Q@ l@Pr㜠?``@p@O "X_ S0 0T@ @UP PWp pQ `Q@ "l @꜀`<`@ @LS\ :00T㜐@@UPPW ppXP`P@  l@R 0`@`@S@rP0 0Tp@ @UP PW %p pX Q `Q@ %l @mHϓ\D@K  @`0ᜠl@d_ hO`ptoP`bHɓ\D@K  @0ᜠl@dY hI`ypɚtiP` P`ԑP @` p HP`0@l @p P` @!4@(@S@@@o@M@7@@ !͆i && & 则,   -=Ά 2 刜,. 9 > ̆̆> ,"㈟E=E͆G //J 4, "Q=Q͆J-2S V 7,㈅V⠅]͆%]=%_ B ̠ J?V Π  ^?p TP p :` 0x00x`QQx00@S xlR`SCTUIVWXYZ[\]^_4PQQQR I=̆,8 < 8 Jm (08J 0 000MMXM}0@0p `   0 R\PF@ ![  0@@PD@@@``` l0 p\ Xp P`KP@TP PP@PP 1/P@lLKH Dp L`  2/PA\1S P <` 0P @8 @<K4 @4/P8h0@@;0 @ @,0 @ @@@h :@@@@ :@@@ :``@`x p-L MP@P` @4CCFF!Kp00 @0  @  -LM@0Sp`p@ #熣R  RP@ \  P P@Q P@ U`VP P  P P P P P P P P P P P P P P PW PP PI PB P; P4 P- (@ @@[l0 ;P42P$!PP PPP@@ %;@@@@@@ *;``@`@@X &;PP@PDDD D DDD0X0 -L@P@pP` `P% WpX@" P   h@POT0PHT ``"  -L M5?0DQh0@pSd& !8LQ7 F/ LQ  LT wLT p0/ LT8 D?0LT P&fT N-/ DT8 m{_T <m T kT l?T > @fYP0 @]_O K@DT CDTM %?0DT c/ DT #_PDTPP @^ 0T 7BTW ??Tl 1T 2TPP@Ď3S 0gDTg IDTO w7/ DT >_PDT P/T _T }O TE  TzP(?0LQ M_PLQ =L Q HLQd PnL T 9XDT oXDT "XDTLPWxDT vDT 3?0DT:PPE @4P> 08XLT R  LT : @LTP&Q T ET F?T PP 00@Q 0 o?0DTQ ciDT9 jDT PP @Ď3S 0T hT /TP / DT fYPDT D TP_PLT 9L T LTPd/ LQ 6?0LQ G_PLQ PP PPPPP PP~PyPtPoPkPfPcP`P[PV PPPLPGPCP>PP9@4P2 0,P'P"PP0@^ 0P PPPPPP PP @Þ\ 0PPPPP PP@Þ\ 0PhPPPu/ DT '_PDT tD TPP,LT .LTsP}_T  TgPtPpDT +?0DTXPcP^ D T /DTFPQPLRT eT6PBP=@/T A_T'P2:P-LD T ODT PP$L Q0 &LQ+ T ?TPPnT zTPP @@ 1 @}0  @P0 @0 @@@@J0 @~L@ @@@JD0 @0 @B@@@J| p-L M@P( P0 @ @JKp`@PPO00@do@40 @ @J p-L MP1 @] @JKp@`POPP@BT @  Tb!@@0 @e @@ p-L MP\1 @3 @JKp@`POp@0S @@@2S$ P 0: 0D"!@t0 @; @@ J(0 @B  @ 0-LP@0SX  Q 0 -LMPR@pS 00@ЄaK\KC X/()0X#KSR(*P%< @LP웊0;  <  0 @ @@ @@JD0 @H@0 @@@@J ( -L MP`@P+U@Pp*: p@1S; @@P$ NOO82 @G@0 @@@J(K1 @0  @PQPT  4!@@0P1 P/ @4  1 t“<@8>@LP웊0;  <  0 @ @@ @@JD0 @H@0 @@@@J~8( -L MPp`@PU|W' @P@1S+ @@P\ NOO(K 2 @0  @1 @ @@@J@0P; PJ  00@41-t“<@8@0L<P0 ;+  <  P@0 @G@0 @@@JH0 @ @@ @@JvP( -LM`pP@PDVP GPJ@P1 @QU @@P"` {!@0GSt2 @G@0  @@ @JNOO(K2 @0  @1 @0 @@@`@p@J @0PD PB 00@  1͉t2 < @80@L P0 ;+ < 0p?:0 @_M@0 @@@JH0 @ @@ @@Jwh( -L MPp`@P.UW9 @P @1S= @@P 1^k  Q !@NOO(KL2 @60  @2 @8 @@@J@0P3 PW  00@41-t“<@8@0L<P0 ;+  <  0 @UM@0 @P@I@@J0 @7E@0 @@@J|T0 @ @@ @@Ji_( -L MPp`@PUW' @P@1S+ @@P\ NOO(K2 @"0  @1 @$ @@@J@0P> PM  00@41-t“<@8@0L<P0 ;+  <  P@0 @#E@0 @@@JH0 @ @@ @@Js( -L MP`@P+U@Ppp@1S; @@P$ NOO<2 @C@0 @@@J(K1 @0  @qPT  !@@<:0P1 P/ @4  1 t“<@8>@LP웊0;  <  0 @ @@ @@JH0 @C@0 @P@@@J}( -L MP`@P6U@P,pp@1S7 @@PP1 !@1 @B@0 @@@J(KNOO`1 @0  @@0P1 P/ @4  1 t“<@8>@LP웊0;  <  H0 @ @@ @@J( -L MP`@P<U$@P2pp@1S= @@P#P1   \8 !@1 @B@0 @@@J(KNOO`1 @0  @@0P1 P/ @4  1 t“<@8>@LP웊0;  <  H0 @ @@ @@J( -L MP`@P6U@P,pp@1S7 @@PP1 !@1 @B@0 @@@J(KNOO`1 @0  @@0P1 P/ @4):   1 t“<@8>@LP웊0;  <  H0 @ @@ @@J( -L MPp`@P'UW2 @P@1S6 @@P P8\@nNOO(K1 @0  @1 @ @@@J@0P3 PB  00@41-t“<@8@0L<P0 ;+  <  0 @A@0 @@@JH0 @ @@ @@J~( -L MPp`@PU|W' @P@1S+ @@P\ NOO(K 2 @0  @1 @ @@@J@0P; PJ  00@41-t“<@8@0L<P0 ;+  <  P@0 @@@0 @@@JH0 @ @@ @@Jv( -L MP@`Pr@@@1S @@P: O(K@0P; P9 0@ĉ  1 t2<@80p.@LP웈0; <  @@): D0 @ @@ J( -L MPp`@P*UW5 @P@1S9 @@P P\T@NOO(K1 @0  @1 @ @@@J@0P3 PB  00@41-t“<@8@0L<P0 ;+  <  0 @N@0 @@@JH0 @ @@ @@J~ ( -L MPp`@PUW' @P@1S+ @@P\ NOO(K2 @0  @1 @ @@@J@0P> PM  00@41-t“<@8@0L<P0 ;+  <  P<@0 @M@0 @@@JH0 @ @@ @@Js ( -LMp@`P P V2 @QU 40 @040Q+ ?W(X9 ,^p$pWI ` +(R, < 7!(K2 @0 @W`2 @0 @J2 @0 @`! AP P<: pBt p0 8XY#< KD0 @< D@<  zX`  X ap  @ D0 D0@ \pBpt 0[8 @@ 8PP@Pxh p-L M@PTdt@PPB PH  00@pR6$ E$0PF P = Q`I L( 0`KpP Em$`0P6 ``@`!$ Ḯ( 0 @l03/@@ 2@@@` 2PP@P@@8 2``@`@@ 2@@@@ -L,M0Pp` @SH A $$K0\ ԄK 0YX H0 笐.YC ԄK@XČKɟ4 |œ0 #KԃK()#KXK#K SR)Qp 1P< P pX  ᰀ|0| qt 0$.(KH ԄK 1 !؍0 @&: ^ ؍x $$K1 @0 @p 00x؍XЄKu1 @0 @p0 @0 @p0 @0 @pH0 @0 @p0 J| -L$M`。`@P@p100 P 4 004 P R-0b ApĠ`p (\! Y.#p c` P_ Q[VY*WW*( .PD P8 ,8.08 .P5:0f0\l \5*(,2 @,000 @@(K g Y@@!3PP@P, 0 @1 @v0 @@PJR`Xp`0刀{0 @Z4 40 @J@@\ 3@@@@<0 @ 0 @J -LM`P@P T1 @ 0 @K@PNOO @t4S$ VVQb@0 @0  @@`@@JD0 @F@0 @B@@@J -L$M@pSp%@`PE0SPP 0  SD SRHR Q \ :P^:0\:^B*3 @3:8i`0` p H @D@@@p @JF?P0  }SaD S^R\HRYQW QUPSPQ0\N: ^K:Qy2 @o0` @HD@@ `@(K @4"BQRl “\i0  i 1 @YP 0P @)1 @[i`0H ` @ @DP`@ PJ81 @KYP0 P @ PJ0 @b0 @J0 @' 0P @X0 @ 0 @Jo  0 @A 0-LM @@p00 $%P(K11(0 PP 00@K l40SL 0SI  00 K 0! P0S> 0S;   00̆00+ R0 0S BR0@@ :@@@@+ R0 0P BR00 0<00/ 00 /0@@ ;@\@ -L MP`p@P5UV@ @P'@1SD @@P ^r P \P!@NOO(K@2 @a0  @2 @c @@@J@0P3 PW  00@41-t“<@8@0L<P0 ;+  <  0 @kE@0 @P@I@@J0 @bE@0 @@@J|H0 @ @@ @@Jip( -L MP@PP 0@S#K 0 CSRS 0 @x0 @lP0 @J<0 @ 0 @J| -LM@`0"0@TPpA] +^-* P@ Pa pX 0S 00 尀| 0|0qt0$.$KP<1 @S"&: p0˔ @0J0 @[0 @pOJ 0 @K0 @pH0 @d0 @p J00 -LM`P2 P @pAc p 00@$R  LQ2 Pe*Pw P pX 0S 00 尀|0 | qt0$.$KPH0^LP 2 @0 @`pH L 1 @0 @pH1 @p0˔ @J 0 @0 @pOJ000 @ 0 @p0 J @@8 ?@@@@@@ ?PP@P -L MP`2 P @pA' 8 0lP8 Vp 4< S04<`P  0|2 @0 @p(K80Y48X 0Q 4Pt X  RB RK1S.SR. .P7  0.$. P1 @0 @p||0 t  00, / Q XX  R00 @0 @ J@@8 ?@@@@@@ ?@ -LMP`2 P @pA> 0lV5 4 #3:P4  `P4 0Q  4 @d0 @p(K|4 @[0 @p 00, / P X Q| 0SY Q}  P@p # PP0 K+0 R'0 P 4^  @3 @6 0 @p0|$|.0t  2 @+0  @p0,4 R 0,P4  82 @0  @p Q XX {1 @0 @p  00;x1 @ @0p  0OJ!  0  @=0 @pJ0 @ 0 @ l0 @0 @p J@@ R?@@@@ -L,MpH @PrWH R `‡`@ QU   0S3 @@@0 @p ! !I@@J(K L,0L HDKDLPJ @H (0S !AH(@P@ H@N&Te2 @0  @(H @PH R( +R& R* 1 @7H 0 @DQ ! !D K ! !@w$): D KD K@D K@<0$)0 @@@0 @@@JOx0 @0 @p@>40 @ @@@J. -L|MP`p@P)UV4 @P@@@1S8 @K@X 08@ @00 40 < D@ @PZ NOO(K2 @0  @1 @ @@@J@0P: PI 0@ĉ  1 t2<@80.@LP웊0;  < < K@@0 @A@0 @@@JH0 @ @@ @@Jw( -L@PpT` 0S R @0 1 0 R -LM`p`@@Ap#P`#Z00 Qd P1Q P: `PY  1  0`(7 @0  @p(K0 P@ 0 Q /QP 0Q: P_  0 P6  @s0  @p6 @ 0 @p0\;: P  0  l5 @5T5 @0  @pꤠZh 5 @0  @p4 %<: @:0  @pP2 0 P 00 ^0P4 @ 0 @p PJ 0 D 3 @z0  @ps3 @0  @p l0` `P 01=  0`夀 3 @0  @p= 0P 0 2  @U0  @pD2 @`0  @p 1 @0  @p0 R 1 @0  @pR \1 @m@1 @.0  @p0 @l0  @p0  @0 @J0 @p 0 0 G -LMM   K00@1 pC$`0SEm$`PP  Ppp} @! QH 0S \ ^  00@00 p  8KH $8  1 R0E 0S BR=  0p03<<< 8 @0 @ @S<Q 0,^@<0B8 @0 @ @o<, <,8h0@ @ @ 0 @P<@@ :@@@@H\ -L$Mp@< @aV 0S000 0(K+ @ @P PРZ 0@ @PP P@8 $L2SX ,K !0 R50S 0S   2 @E0 @80LXR 000X 80hpLQ2 + R0 0S BR0@@!:``@`4P<0 Q hP @@!4<PP@P4 R< ^XpX ȀZ4X< 0S1  @0 @<0 @ (Р0 @'  X0 @ @@8 ;@@@ .<@@@@d\ -L,Mp@< `AT 0ST 8@ ˞8 @ @P| PАY1 0@ @P=P P00@ LQ 000^ 406 Q @.40 @LrWg 000X phpL™\J (K @0 @0P8  0,8RPW X5 @0)?:  @Z < Q8 X 봠1S 00\-  0$KK $8Q. 80 04P<0 QXpX p40S<  0SPK,K 0!0Q7 +΄ P0_ 0P BR0V S^  0 0<0d3 @4\?< R; hP5 @@#;PP@P0S5 0,K80!0Q0Sb 0S_ Z    $0 0/+> R0 0S BR0@@4":``@` 0/0 01 @'1   @0 @  А @h10 @ 000/0 0 0 @0 @0 0 0 @0 @@@` :@@@8 :@@@@@@ V;@x\ -L M@`PApT\ 8̔\" 0,R 4̔\ 000 X1 @ 0 @P K 0\! @̔\P@ Q8 08 00 @~0  @PX0 @k0  @P@@ a=@@@@ -L4MP`@P  AT< P pW ЄK h ܄K 0YX 0笐.YE ܄KXK@@?<0 |80 ԄK#K " 0#܃K R 0$KԄK *<:0YX*Y4Q  1pPE 0^g 4,Rd P0S 003 @ 0  @`$Kఐ.Y1  ! P  0P(K؍ @Ă0SG x- 0-ЄK0 KP R ˔0\0Qq 4<Sn 2   @0  @`P0S9 P  0H2 @0  @`xœ؍ X$$K=P  0   @10  @`P  0 0X1 @\D1 @  @0`+P  00 @0  @`SP  0PJ p0 @(0  @`90 000 @_@@ =@@@@ -LM@`PApT 0S@ 0SV ( K (0P0Q 4,R 0 00  @2;0  @P 0P2 @4( 0 @ x x K0 P- 4Q*   1 @0  @P0^C 4̔\@ 00p1 @N0  @P 01 @0  @P 00 @)(0  @  0\0 @H0  @P@@ =@@@@ -LM`PpPXV8 +): U&  @AT 0 00  0Si P P 0S(0 X0(^ !(040 40P) Qv    84 @ 0 @P) L,^$\hlhlQ pQ 000 3 @  @0P P 0S$)d0d0 !0000! 3 @I @0 !0000! (K2 @80  @0C&SN[[[[[[[[[[l[l[[[[[[[[[[[[[[[[[[[[[[[[[[[l[1 @S 0 @1 @㉮ 0 @ 0w 0q @1y 0 @^0 @90 @Jv0 @y0 @eT0 @; @JU  0 @: 0-LMP@P, PN T @PPO K0PP( P@1 @2 @J0 @, @J0 @;P0 @@OJ80 @10 @J p-L M@PP) P5 U @`PO Kp@ @@100 @ @Jx0 @ @J80 @0 @,3:J p-L M@PP) P5 U @`PO Kp@ @@H000 @ @Jx0 @ @J80 @0 @J p-L MP@P, P8 T @`PO Kp@T4P @ 0 @ @Jx0 @{ @J80 @b0 @J -L$M@`P| P Vf @PO (K脐00@ qP; ]?P@ w@K  0 @4 < 8  P  0P 1 @0 @@J ZP PC X !@ 1 @ @J0 @ @J0 @0 @JnH0 @0 @!@JY -LM@PP UlP @PO $K1 @0 @J@00@qoU(U& pHpP' @ !@XW P P p !@P p !@XQ@0 @g @@ J|0 @0 @PJ40 @-&:  @J{( -LM@P P  pPP# $K2 @  @PPJ2 @%YP0 @PPJ@P^_O`@d(0Sp Z  H0!@,QD0Shrl S 1 @MYP0 @P@PJ@p#㒇,@ @``J0 @8 @``J0 @=h`0 @``JD0 @W0 @A`@`Jql p-L M@`PP%TR P=P9PP% L1 @P0P @POPPJKp0 @0  @@P^_O P@x0 @0 @PPJ40 @UP @PPJ| p-L M`P@P%P 0 @E@ @ @@JKp@PNOO@@00 @YΠ0  @ p-L M`P@P3VP P<PP@PNOO @p  @ Kp0 @k0 @ @@J0 @c0  @t0 @g @ @@J40 @O@ @@@J p-L M`P@P/0:&P 0 @A@ @ @@JKp@PNOOP @@p2000 @}Ϡ0  @ p-L M`P@P5VV <V2VRP@PNOO@4$R_ ^N "R&b@pbKp1 @ @ @@JL1 @0  @1 @yϠ @0@@@@J0 @A@0 @@@J|0 @A@ 0 @D0 @0 @B@@@J p-L MP`@P2U? P@PNOO00@d!n @Kp0 @ @ @@Jp0 @0  @40 @mO@ @@@J -L |X}  |PU  Pp P  X !@P4 @0 @@@J(K4 @0  @P E$Ph ?I}8p@K d 00 0@@@ < 80 4 @K PK 0 P@K3 @0 @N@@@J 0?I8@K d0 0 @@@ < 8 4   L0 |L0Qs 0P  (2 @@KY0 H0 PP= pP Ph   X H0H0!Ex1 @0 @E@@@JE(1 @E@1: @@@J50 @E@ @@H0H0!N@@J L0 LPʏ@@` 5PP@P@@8 5``@`@@ 5@ -LMP`p@PUV' @P@1S+ @@P\ NOO(K7 @0  @6 @ @@@J@0P P  00@41-t“<@8@0L<P0 ;+  <   P <^ @p㑉,P0S{ S*PQ R0SP 0SX R 0S00P p@p(\ < P L(, *^  Q0 *0 Q :!@Bk4 @D@0 @@@J/3 @ @@ @@JS P Q0PH R0S0  0 BRCPx2 @0@ ` @@PP@@J `@ PA `00@,6,bVq  }0S R  0 BR0CS/1 @@  @0 `@P@@JP `O JPD H1 @@ 0 `@ @@P@J0 @ 0 @2:G@@@Ja0 @0 @@P@@JJD0 @D@ @@@@J7 ( -LM0 00pp@@s P<Q P@pU` ;S* PK @p T PU P Z˕\^k0  0Px P00  ^PP =<Z\^<00  40 Pi P40 0 TPPP 1 @Q+R;0  40 P9 P40 0 ^PP 1 @0  @ R{`Vx<`0  0P Pm00  TPPPd (KP0 @0  @  0 @Π, -LM@P ,6 @ 0 @ (K@POp@t0SFQW P  R @ㄓ`T`@P@4` 8P `0 P PPP0S +Rm ̓\ P0  R P' ̒\ 0 QM R P*<^7  0R ^ ̒\ P^0 0 ,b&<P\^0H0 L b&^˒\ P0 0 ,b&\P0H0 L b&P 0Q4p#%`|<^ R\0 H0 L0c&80V2 @ܖ0 @`@J)````0 PP@0PQ @3: `0  P P/ n2 0 PPP!@Q.^+0 ,0 UVI @P0@1SM @@P! ,^{ PP P P 1S  P ! , @NOO(K3 @0  @2 @ @@@J@0P3 PW  00@41-t“<@8@0L<P0 ;+  <  x1 @B@0 @P@ @@J`1 @B@0 @@@J|$1 @ @@ @@Ji0 @@0P @ @ O@@J@P.>X0 @B@0P @O@P@@J2 ( -LMPp`@PMUWX @P?@1S\ @@P0 ^ ,P  0S P040 0 P RP 4 0P X , !,@NOO(K3 @90  @X3 @; @@@J@0P3 PV  00@41-t“<@8@0L<P0;ˉ  <  i,2 @CB@0 @I@@@J1 @:B@0 @@@J}1 @7: @@ @@Jj N81 @q4@00 @ !@ @@JM0 @bB@0 @ !@@@J80 @S0 @ !D0 @J0 @@@@J ( -LMP`p@PUV @Pv@@@1S @0KX 0 < 80 \ 4 A@PXQ  PP @p #PR@Y, P ˔\$: `?1`PK 0P 0@@ L H0 D  0  ˔\ +Q* @P \ < K@P@NOO(K4 @0  @4 @ @@@J@0P3 PW  00@41-t“<@8@0L<P0 ;+  <  2h3 @A@0 @P@I@@J3 @A@0 @@@J|2 @ @@ @@Ji2 @*0  @PSD2 @ @0P0@ O@@JA1 @ 0 @1 @!B@0 p1 @0 @PNOO ` P ˔\*: ?PK  1  0@ 0@D L H0  8:˔\ +Q: 0``P VH0 @ B@0 @P@@JnoO ( -LTMP@P&U p0p@aVF @X Y# Q-47 @ 0 @P (K6 @0  @P ˖\S P0;0`0 0  P,YB !@!L,RW ?0\0 >PKd p P @ @L H D h \PK L̖\ 0 `pP\PK5 @د0 @PJ!,\ P% P} †`PJ ,Q 0, \T0CT !x3 @㪯0 @JX 0˜\ \\L<(, ^ \0 0\ 0` l lP\ f  !\Q˖\\L H02nH2 @ @JhPK\ pp l dplQ>O0PM p㑇'X 夂Xtqq  @@@@$ -LM@P2 @ @JKp@POPU `Pep#00@PQ Ph 00@ Qt @4 Px1 p@0S1 @0 @@x1 @#0 @@CJ(1 @ 0 @@ J0 @  @0 @, @@BJeX0 >: @4  @@@ =8@@@@4 -L4MpPPPp``@@0S  TPP @4( RA P P" P P< \ P8 ?I0H d@KL P 0 @00 40 < @ 8 H@K \2\ PPPH@K PLh6 @Q  @0`0S6 ?I(H d@0KL P  0 @@ < 8 4 H@K `\X 0PPPH@K PL t5 @Z  @P |P E=|$|P 4 @ 0 @ (KPT"P Pf h 0S h# P !  0x00@S x 0T0223456789:;<=>?111@PS @0S00\  PR  S3 @0  @@PiP rPY PT gD0SP2 @, @FJT@0S P@Q <^ 0S H0 P 0 @T 彖T 0  @ &PH00 0P0 >40 @~ @ Jh -L MPL1 @@?: @@@JK@@PNOO@p#$0S @P@@0 @H@ @@D@@JD0 @ @@ @@Jx -L@@PNOO@@ -LM@p0 P ` 0 0@㈁0pp p@\@ @ @ p 00z P !!(KT^ P E$ P8 h 0 @0l@ < 2/84 80< \2€H!!l` 0 $P5/P ` \I 0 0l03/p0 0 40plrWr0  4P4 `04 4/.ƒ=Q0'7@4@"bP/020H0 @# @d d s0z -LMP@PjZ PPp#pp@`0S @Q  P7PV@@tpxPUPP PM ,0 PP54 @L2 @+0 0 0 @ (K1 @0  @Pp#t 0S p# p' p 0@1 @  @ J1 @$0 @@J0 @0 @Jx0 @ A*: @J80 @0 @FJz 0-LM@PA T P@PNOO@p#%0S P @@K00 @H@ @@@J0 @ @@D@@J40 @ @@@J 0-L@@PPNOO  @@0 p-L M`@PP VM P)P5PP Kp@@0S0 @0  @0 @ @ PPJt0 @ @ PPJ40 @TP @PPJ p-L M@`PC PP0V] PIP@P^_O @D%N@Kp41 @0 @ PPJ0 @0  @0 @;Π @PPJt0 @Ϡ @ PPJ40 @SP @PPJ p-L M@`P$ PPVj P*P6PPB Kp1 @0  @d1 @ @PPJ$1 @ @ PPJ0 @0 @ PPJ@P^_O@@Č%Ό@40 @SP @PPJ -LB): M`@PPVg PP*pPP2 (K1 @-0  @1 @1 @ PPJL1 @50 @ PPJ@P^_O@pᙇ.@   0,@0S @x0 @.SP @PPJᙌ(  ,0  -L MP@PaP 3 @O@ @ @@J(K@PNOOᅀpp@dP60SqPPY Q P> PQ"R2 Pj P @0S2 S†^2227@(2 @%Π0  @1 @ć0 @@!P @ @`%dH1 @b0 @@@@@Jd0 @Ӑ0 @  00 @j0 @@@@J7D0 @B@0 @B@@@J# -L -LMPP P\3 @J@0 @@@J(K@PNOO`0`@0 DTf 80 <` 0$80< Pn ps@p4@ TQ !@PF@PA40@@@@,@(@0@$@H@0 8Pd%C<:  0x00@S x 0T0223456789:;<=>?111@(1 @0 @@p< 80P 0 @ @@ @@JX0 @ @@@JHD0 @ @@H@@J5 -LMP@PbP 2 @O@ @ @@J$K@PNOOp#00@Q p`p@dQF (Ph 됢ZU P QT P/ H )‚岯,(0$ć8 %@l1 @Ϡ0  @ 0S1 @B@ @@F@@J02220 @ @@i@@JeD0 @0 @F@@@JQ8 M- LA 0Q(4```````(4 8͠ @4  lhƒK-̠2Πˠ̠VZΠ2̠K͠iΠK͠ ͠S -Π-Π -L,MP`@P?U P'@PNOO/ @t4S P5P{ 0 Sr         |2 @Y @ @@J(K42 @U0  @1 @gA@0D&: @@@p    !·  @。pp2〢p<02p20S x  0r0 @VA@ @@@JD0 @_0 @B@@@JlD -L00@ppcP1&P@@Po xP%  R ^00@ s 0S <^R  p RV 0 S <P“\Q @ s0 S <\“ƒ0S <P p Rx R@ s0 S <^0S @@ $BTL@ P8 `XE4K$ 4 R P 4^|P || 0 @0@k0 @]fP  E3:Ls -LMP@,P @( Pp(0SP` ˜\00@QPPp3,  K(K,KP( R ,0SPPl0 @ @00 @ @d -LtM Š @@P P@  P p P 0ST `P! @p ( 8 < <0@S40 4 \0 0  @R@h#Q2 h (K0SV 0< K< 80 \4 4 0Q0 00 (0 , P P0X``h ^ @h3< K@( 0, P p}pzꌐK  0P ` -LMp` p@ @PP P P P0S SP% H04`KD<@ @4@ ^, , R( (0 0@ $K2 @ @4000 40 4KPD H0< @0, (0 P.< DR@H Q& H @<0DP T2P" P0S= S@PP^H @`D<0P ``P`* `PpUPNYm L0 @nP2T | -L M ˆ @@ qPPB U@F0:pc & PPP1  (KP"0S%   <PE]$P@P 0S0, |P ||A|1S0 Sx0 @ @|Pd0d0@@ 0@@@@ -LpP@``@DP" 02S*P (0S YL000L0 0b2 @@l03/ QP: 0pdx– 0 -L4M0H @ 40 P @@<K8KPj @Pa @P@P(K@0@@D"R "Ro ARp BQP @@PB@@D 0SV ``@@L pXrD`@PP @@0\;T @PP,QI  0@KP <P8Q @@D 4Y @DP @@@ 40T*T LP@D$^r HPYP@`4KD`L@ Pp SXpS @@2QU X00\0 40S PA @@"QU Xl 0 40S QG @@ TP^ 0KH0Q@ D4PPRL00@ @D0$ QY Xp@0S~ <2 @uTP @@ 40 R2s 1 @u @@ 40@0^0@L0@ PG%:  @pS@@PP T^ 0@ 4K40S 0 @ @@ 40@XP@d0 @H0  @"@0"@0@s -L0 0 00 -L0 0 00 -L0 0 00 -L0 R -L0 R -L0 R -L -L -LMQ 00 K @@ @c?@ -LMQ 00 K@@ _?@ -LMQ 00 K@@ m1@ -L M00@@Q 0S !c0 -P20K\0 @0 @@@ 4@ -LMp`  @@QU LXM H2Spc@!@㆏o0` Č`ps P`pHp(b`p(p`,`0ppp ```ssssp ``dLœ\ < cR cT !8" <PcXQ/ ]< 000(K 3 @10  @2Se 2S0 2 @8  @0Qz 2S0 l2 @8  @0Pt 2S0p 2 @8 @01 @v0 @p1 @80  @2S@1 @1  @0H%: pςp$bh`,rlp ```pXpp \ ` d i>0 @1  @0L0 @1  @@@ )4@ -LM0PC K00 @1 @ -LM0PC K00 @FϠ @, 0-LM 0R P@@" @C@P 0B0K000 @ @< 0-LM 0R P@@" @C@P 0B0K000 @ @L 0-LM 0R S @@" @PC@0A0K0X0 @ @P@@ 0@@@@\ -L M00@pCp1$Pav9 !01RZ 1P 00@ਁ嘁L堁P !^S 01P @$LQ !01RK P @4LP ܁ !XC3 @0 @ K3 @  @0^\3 @  @0!R3 @  @0 X 0 2P' P@$L Q 02 PZ "X2@SP I „„„ P "1@PX n P] "1@VP4 > I0:P- "@1@&P P #0@ P #0@ P #0@ P #L0@80 @0 @ Jl -LP@P 0S hP hP h!<0@ PP !0@ -LM00@"`pAT @pS%P0S>D0壯ʠL@0 X' ^ /8 @ „嘁. 1 (!0"08  P000@ăL"R L"R 1S '8 @T„!D00.X!0: `h08  P0Q@āLX+ 2 ""Rd 1S 媏8 @„!D00.!0: 08  P0"@āL"R 2 ""RF XS\4 @ 0 @(K4 @㡃 0 @"R|3 @  @ 0"R3 @  @ 0"RL3 @ 0  @•.~@D„". 2" !220  P`@4L"RK „ 02p2 @㡃 0 @o42 @㡃 0 @11 @  @ 0SbD0@0D!$ 0:#,24„P @0D!•0:*ԢJ3:P 8 H$1#@$/@0D! 0:#2„P  @0DT!\ 0:#d2l„P @@8 3@08C$# 0@  0-LPPP 0S @0hP h@P h!<0@ P@P !0@ 0-L@P PP 0 P0P00 PP j#0@ -L MpC00@44# ImE}`$p8H,V PP < 0  0  V<28(K@@ I5@ -LMpC00@44$ E}Im$p I<,8 0 V PP 0   0 VI D2``(K@@ -5@ 0-L@T P0dP00P0 P0 -L MR `@000  S VLWP\ 0 p CX, VOP \0 p/pV!P0PP Pp\0 pؠ V  00 4 400 00 4 4000`00(K 00 4 400 00 4 400 -LM``@pSpa%p@@(Kl`q 0D3/w) p4 PpDH@H( B# 0(((,D@@@H0P####D0 K|0 @20 @ J80 @90 @J K&: -LM``@pC a$ @`l(Kq 0D3/w" Q pP 00@LQ (0H 1"P!t pP @āLQ (0H 1"01P!d pP @āLQ (0H 1" 01P!T pP `@$LQ{ ( HPa"b„02!Q2 !   K2 @  @0P`2 @  @0P2 @  @0 P1 @0 @p< (H0 !8p0 (H0 !Mp$ (H0 !bp (0H 2&bw0 @0 @Jy0 @Ϡ0 @ Jb80 @*Π0 @ JQ -L`p@@@PCP 0P@S Q P@ U 0S  RP<0S \<^ P U@ 0-LM0ƒ@ AT @Pp#,!R QeAP2S MP@K0 @@ 4@@@@ -LMB@PpAT @`p3,1S afA "R MQAK@@ 4PP@P4 -LM00 0@"4 AT5 n | `V PP L<:P P ˔ V; +kk(K  Q 040 @@ <@L -LM0`0@"PpATP L02P P2L2 P 00@LQ <„ „(„0„H„@„D„8„2S T""XP @L\ 0 t2X2T"`2h22x2|2p2P8 P @ĎL2S ^,3 @Ϡ  @0@p#Q K3 @Ϡ  @0^ ""P 00@LP) "2 @  @02 @  @0\PV „„„ P: /2@3$Pf 4$,0 XTP@ X/1@9T\PB l„\„d„6 PF /\1@?P 0222< Py /1@r P $0@ P $0@ \TP \$d0@ $P $$00@@@ 3@d -LM00@pS@1%(@ p(`K4 @P( R@  P(Q @TpP'$KHx0 @(0  @x0 @b 0 @80 @Ϡ 0 @M): Jt -LM00@pS@1%(@ p(`K9 @P(0S@  P(Q@Tp0P, 11!$KHx0 @-(0  @x0 @ 0 @80 @Ϡ 0 @J -LM@pS@%pav 0 @G0 @K 0P <0a @O0 @ J -LM@pCp$P`!r@$L PaPP0PqQK0 @0 @40 @0 @ J -L -LM`@@@@@P @ @00@@@@@ P@4SP @4S% @4S2 @4S? K $p@(0p P @4S l`@dph\0 @  @4S @p0 @  @4S P@@0 P@ p-LM@QP K`P @QP Kp 0 @0@U0  @ 0 @0@%Π @``J p-LM@Q`) KPP PP KpP@a`  Pp0 @;0  @40 @6 @PPJ -LMK@PN*: @"1K80 @*0 @hJ -LMK@P 0@" !0 0@K80 @0 @hJ p-LMP K`@P 00@1 R 00@ 4Q& h" lKp0 @0 @hJt0 @Ϡ 0 @40 @Ϡ 0 @ p-LMP K`@P  0@1`P!Kp! 80 @0 @hJ4 -LMK@P  0@1! K!80 @͠0 @hJP -LMK@P@  00@1Q @@Q !K! !0 @ 0 @fJ!0 @0 @AJ80 @0 @hJh -L0@ShJ -L p-L M`@PPPKp00 @0  @ p-L M`@PPPKp00 @~0  @ -LMP(Kp@PY` (00@1 R, @00@ ē\ p2 pO ! K!!01 @(0 @AJ!0 @ (0 @fJ!0 @0O?: @X0 @0 @hJ!  0 @ -LMp(K,K0K@ PP@0S P!@ H``@P!@ ``@PT!@ ``@P'!$KL\ P^(0S, R 0ZpQ Dtx| 0 0 Pk p\ ^(0S, R 0pWQ ̀!1  0 PF p\ ^(0SY, RV 0ZSQ  0 0 P! 봠 Qr( R/,`V, 0`V),\f 048 <0@ 0 P/!0 @YϠ0  @`T0SL !X3/H0S< !3/80SD !3/@0SD !3/@,`# -LM@0KPP  0``@1 p!(Kp ,Kp (X5 p p (`VR,pW- p p p p p K, R 0a,`p p pH3 @0 @p p p@2 @0 @|2 @0 @hJ82 @0 @1 @0 @{1 @&0 @kx1P: @0 @[81 @0 @K 0 @+ 0 @ 0 @AϠ0 @ 0 @& `0 @ D0 @ (0 @  0 @Π1 -L -L -L -L -L -L -L -LM K -LM  K -L -L -L -L -L -L -L -L -L -LM K -L -L 0-L0 P0P@@ @@P0A00 0-L 0R0P@@" @@P 0L00 -L -L -LM0P  00  K 0 @0@ @J -LM0P Q    KT0 @X @J  0 @Y -LM0P Q 0  KT0 @8 @J  0 @9 -LMP  PP K\0 @ @J@@ 0@$ p-L MP` @PPPKp P @@P 0@@@@40 @ @J4 -L MQ@i`PJq Vp@P @U Y 0CK  Q: ZLU= PV= U00L3  Z'3 U 0@0 PV U B  Z PV@@ 0@(KD -L MpP6 \@# \ `% @ @㝐U` 0 @@P0 @W@P(K@@x 0@@@@\0 @ @J@@ 0PP@PT -L M00@P @P `@@K@,0 @+  @h -L@t !0S00@$ 2 -L -L @1 -L @1 -L @1 -L@t !0S@ 1@d 1$ -L@!40 0-L@ P P0 -L -L @1 -L -L -L @1 -L -LQG P ` p0ⴀ\紀@p@B@ p@'C@@p@A@@  $r@psp p@@$p@'A@(@,@0 `:RP@Z ZJ1Q -L\M @0 Pp`@t t 0 p l l0h0 h d ` X 0\ X pTp TpP qL ppH H 'bPR :p PD @ (KPP@np0p ` @bp W0p `p u$ qEL (ȏ4 L \Z@ ( \ < ,4 8 0` @4 4d L T 8@D P $ ʒh<(8,4000T4P 8 \ 0@0@4V !Ӎ bAd0`F0L``0 0L 00T0 0@0 0d0 0j&00000 4 $ @0:)6@ 4`0 4o4` X0 ɟD@`H0 0F`D X`4F`0 `H`FiX D@` 04 h 0 Ɵ4`H 圖4`hP ih`D Ɵh `H4 0 BfiP `I`D hBfi` `XP@Z`e4咚j o%0` o*/IbLT 0 EShJfd oL` /o4 0` !ᜩů@ 嗨a ïe#0`LȂf4`I`@CjrfEVlpP `8 ,dd -L20; 0 00 x-LP@`J$J H@x -L00@ |# -L00@ |# -L -L -LJ -Lt00@ -Lt00@d -L -L -L -L0P0J -L@t #P -L@t #P -L@t #p3 -L@t #P -L@t #P -LP00@|P -LP -LP00@|P -L -L@t # -L@t # -L -L -L -L -Lp3 -L -L@t # -L@t # -L  -L -LJ -LJ -L -LJ -LJ -L00@t0#` \ 0-L M00@t 0#QG$4PK0 4 PT:?,,0000000,,ܠ@,$ȡpD0 0 0 Q0@$0  (@ @@@$ Kl4p (K  W@t .P) KT$K` `!p0P !Qt9PP@8  @@@@ 0-LMP@$K  0K0 -L x-L@`0P 0x -L -LM K K p-L Mq@P` K 0U  Kp -LM@$K  $ K [:-LMK  K -LMK  K -L@ t,0S 1@Ğ 2Q  -L -LM K00! K -L -L -L -L -L -L -LP P PQ -L -L00@@\q -L!@14S S -LP P 0-LMQ@P *EQ K0AR R 40 @Ϡ0  @P -L -L -L -L M@K0S00 S00K -L p-L$M<@KPP@BjM`HdddKp -LlMpp@t`@p"P8P < 4 D 0S aPP@ 4 *O]T1ē\\(|0bI%c"@* 0Kq,"Zȁ0.-KZ$. K*/K 4 4  @y K0  4Q0  0Rb0 x0KD  Q0  0Rtt#\: ^#0PK |Ptt'0S# | R! `'[Q4cq(KQ  Q00 x0K,#`[Q`|20 04z 04 o  AR04d < 4[ X0K:@DK4 Kl9@ 8K03/l >03/l B03/@@@ DKl;8 K8/QL QW QU @QA < AR=@PK P@DK8Kl=@@ 0 3/l0 ?:/  4  4@@ DKl8 KB8/Q  QL  xKQQ  x K 0TH< -L -L -L@ -L -L -L -LP -L=b0A/L3r:A Q#:A Q C -LM @  H  00 K -LM00@,0   K -L@,0 -L@,0 -L@,0 -L@. 0 -L -L -L -LM @ 0      00 K -LM @ ?0     0à 00 K -L@$. 0 p-L,00@$. \k `(k\ [ P$[ \$K @$ K) 8(. \k `4] :k \[) P0[\$K @K (N  PbA@,. d VϠ`TA|bA ʠAɠQe_,ʠAɠQʌC , AcujAiQbA&jAiQjC( P0. @d VϠ `TA|bA ʠAɠQe_,ʠAɠQʌC 0 AcujAiQbA&jAiQjC( P4. @d VϠ`TA|bA ʠAɠQe_,ʠAɠQʌC 4 AcujAiQbA&jAiQjC( P8. @d VϠ`TA|bA ʠAɠQe_,ʠAɠQʌC AuAQ!AQC(8  - b A0< Bp<. ʠAɠQ,ʠAɠQʌCp -L@ . 0  -L@ . 0 -LM00@  0 K -L@>   -LM00@  0 K -L@,0 -L -LP0T" 0@ P00@T$ QrQdQVQHQ002468:0 -LP P@1+0 @,0  -L -L -L -L -L -L -L -L -L -L -L -L -L -L00@ @@ R@. 0 -L@T>   -L -L -L M00@"@0A@@ @@@  K -L -LR P&H(((R RPv P5 Pp @@+Pj P P @@Q+@@ +@> 0Q*8 @ > 0Q+ld^:\ttt@0246 0420@@3+6024  0420@@+ @> 0Q024 0420@@r+@ 0-LP0,0@ P P00@ . P0@8400000@. P*@0x -L00@. P0   P   @* -L00@P. 0  P!Q"  Q Q l@Q*Q   Q ,@7*@* -L00@P@. 0 QQQ QQ@   PQQQ@ Q\@  @ -LMQP0d@00@. 0   K|@-00@. 0  00@. 0  00@. 0  00@. 0  00@. 0  00@. 0  00@. 0   -LP P@1+0@,0e'@ -L@P @0̃10I'@ -LP00@" 01'@ -LP00@,0'@ -LP00@@  A@R@. QQ _: 0@ -LP@x>  X%@4 -LM0PQ``@,K@p L:⼐ Pᄀ@⸀ RPPℐ儠,pK:, !:℠ 儠BȠ 崨\pĐ 簐K⴨L0⼐!S 縐 ᄠ崨P紨@ᰠK@ Ȁ$@儐焐R AB!Ġ !(K@<%L -LM00@ P0  P # À    K    @$d -LM00@ P0   P ,     K ,   @#x -LMP P x@/ K00@. 0  00@. 0   -LMQ P! P @# K00@. 0  P P d@#00@. 0 ā 0. 0@0. 0@ -LM0P  @    00 KSD@c#00@ 0  #   -LP 8/@@. 0 -LMQP :P @! K00@. 0  00@. 0  00@. 0   -LMP  P,@E/3@%C  K  -L MP@ @  0 20K@&  -L M0P@  CR@*  0`: 30K00@ @&< p-L MP@P` L\@ *  0 4450Kp00@ @&X 0-LM0P@P  CR@*  0080K000@ @f&p -L M@PP`  DR+pp@0*( ( (0* ( ( ( Kpp@ ( (0( 080 @H& p-L MP@P` L\@ *  0 06:0Kp00@ @& p-L MP@P` L\@ *  0 06:0Kp00@ @% -L M0P@  CR@*@  0?0K00@ @% -L MP@ @  0 70K@#% -LM0P@ C\$00@*   00 0   K00@     0  @ % -L M0P@  CR@*  0K00@ @$ -L M0P@  CR@*  070K00@ @M.( -LM@PP`9 D\lpp@*@0 0 0 (0 (0?(0 (0:(0 (( (( 00(  *D0 0 0 ,0 ,0:,0 ,, ,, 00,  Kpp@a : @0 0 0 0 0? 0 0: 0    00  D0 0 0 $0 $0:$0 $$ $$ 00$  @K.@ -LM0P@ C\$00@*@   0?0   K00@ @    0  @z$X -LM0P@ CQ" @*   000 K00@     0  @#p -L M0P@  CR@*  0K00@ @" -LHM`P@  FRPP@*@ @ $0 00(300 00, 200 00 00 00400 00 @000t *@ @1 C0Lr\ s0K5K@ \*; @ @ @|0` 6K@ `0*@ @ 0B Lq40  B40r 040 44 40:40 @4 *;@ @ 0B Lq80  B80080 80r680 80:80 @8  *;@ @ 0B Ls< rK:K@0<K*@ @1!0 B0CT rsKK@ T0*˃ @ @ 0CX pK@0X  PP@ @ @ $  p(s p 0,p2 0 #    @0  p0pw  @ @!1B0C| L s$KK@L  0 ʃ @ @!1B0C| P s$KK@P0 @ @ 0B Lq$0  B$0r 0$0 $$ b:$0:$0 @$ :@ @ 0B Lq(0  B(00(0 (0r6(0 (0:(0 @(  :@ @ 0B Ls, rK*K@0,  70 @ @!0 L0CD rsKK@ D0  @ @ 0 @CH rpKK@0H  @" -LM0P@  CR@*  00 K00@     00@)" -LM0P@  CR@*  00 K00@     00@" -LM0P@  CR@*  00 QK00@     Q10@! -LM0P@ CQ @*  00 / K00@     ?0@! -LM0P@ CQ" @*   0?0 K00@     0  @!  -LP < @  #@B8 -L M0@@S@   00    K -L M0P@ S K00@ 0 @ -L MP@00@   Q60K@k,H 0-LMPP+@@@U   0   U K02  + c: 2 % @V,` -LMP@Pp``@ (  P ( 0,$( ($ rK(0$  K@,x -LMP@Pp``@ (  P ( 0, ( ($ rK(0$  K@+ -L MP@00@    0  K@+ -L M0@@S@   00    K@* -LM@@\P`8pp@8 80( (P 8 (08 8 , ,` 80, ̂8 8000 0 8 0<8 8 4 4 804  K@* -L M0@@S@t@  0 AK  K@) -L M0@@S@@D  00    K@) -L M0@@S 00@   K@m)4 -L M0@@S 00@   K@V)P p-LM @( RQHq`QT@   0 8400Kp ?9@l -LM0@@S8 < QhR8qQtrPR@@0 0 0008400 @0 00 0($ (K '9@ -L M @@R@  070K 9@ -L Md: @@R@  070K 8@ -L M0@@S00@   K@( -L M@@\P`$pp@ ( (0SS&  :( ( \0 *0( (Q, K@( -L M @@RPp>``@ ʎU( (0(60  ( (0 (Ă0 ( ( (0 K  ( (0(<0 ʂ( (0( <0@( -L M0@@S 00@   K@q(4 -L M0@@S00@   K@](P -L M0@@S 00@   K@H(l -L M0@@S 00@ ʎ   K@.( -L M0@@S@  0 AK  K@( -L M0@@S 00@ ʎ  K@( -L M0@@S 00@ ʎ  0@K@' -LMPP @^P @  0 K00@ 00@ @@' -LM@P @DTL0$KPP@0( ( `Vo( (P/? ( ( pW*j`( e: (0\v *p" ( (`(0`` ( (@(0@@@'0 -LM0P@ CQS!00@t@    AK 0K @t@   AK 0  @M' -LM0P@ CQS!00@t@    AK 0K @t@   AK 0  @&'0 0-LMP@QQ K0@P\   0 0480@&H 0-LMP@P%QQ @DTK0@@DT 0 00@X 0 00@&` 0-LMP@P%QQ @DTK0@@DT 0 80@X 0 80@&x -LMPP@`<QQ @DT"Kpp@@D0  0 048<0T  0 00@@T  @0 0480@w& -L MP@QQ K00@  0 080@J& 0-LMP@P%QQ @DTK0@@DT 0 40@P 0 40@0& 0-LMP@P%QQ @DTK0@@DT 0 80@P 0 80f: @& -L,Mx1`@DPK PK4K TPU T00@( ( $ $$ (0$ @TPU( (   (0  00@( (  (0  @( (0$ $ -$ ($ @$@ -LM0P@ CQS#00@    090 K00@    0  @U$ p-L MP@PQ``QQ? Q= T`VI TG T``TTS TQ T`V] T[ Kp@QPT``TTw Tu T`Vc Ta T``TTM TK T`V T @5@T`V 0 ?0 @ 0 `/ T``TT00@T`V   @  0 ?0@<  @<  `@ 0 / {@#e p-L MP@PQ``QQ? Q= T`VI TG T``TTS TQ T`V] T[ Kp@QPTh:``TTw Tu T`Vc Ta T``TTM TK T`V T @5@T`V 0 <0 @ 0 `+ T``TT00@T`V   @  0 ;0@<   @<  ` @ 0 , {@##e p-LMP@PQ``QQO QM T`V` T^ T``TTq To T`V T Kp@QPT``TT T T`V T T``TTy Tw T`V T00@0 0 , ,, ,0, 0 ,@T`V0 00   00  @0 0`  0? 0 ł 0 ``T``TT00@T`V0 0 $ $$ $4$0 0 $| 00@0 0 $ $$ $0%$ 0$j00@0 0 , ,, ,4,0 0 ,r@0 0`0(0 ( /( (( 0(``U00@ 0 0( (( (0$( 0(:@"$, -L M0P@ Q Q3@̎H SQ Q! @\ 0@K00@ D00@,X<!@$!@ !@D -L M0P@ Q Q2@̎H SQ Q  @\ K0i: 0@ D00@,X<s!@$m!@ C!@\ -L MP@P @^@  0K00@4 @4@!t -LMP@P" @\/@ $ $0 0 @K$  K @4$ $ @K$0  00@4$ $  @K$0@  M-LM,PP@(0P 40p`040 :PT @QpPP@I 8 8A0 0 @& ʂ$0 40@60 *,0060 *0pG`F0060(KPP@8 (8A 000@600` dPP@ 8 (8A0 00@600- 0-$@  p-L MP@P$P" 0@S!``@ $  0Sʠ ,: *,  0\ *"Kp@K  p-L MP@PP 0@SPG@ 0 0B L060Kp``@ $  0 0B A060 :,  0 060 0 0 0@ 0A60  @ -L MP@P @^ @ ʁ  0 0B A060K00@( @(@/ -L MP@P @^00@ ʁ  0j: =0K00@@ @ p-L MPP@P  @Rj``@  ,(\ 0 $ Q0 R+04+90 * 84\ 0 0 Q0 R+04+90 *=b0A  0bABp $ A QϠ A Q C0A#| *A)Q"*A)Q*C80 *=b0A   0bABp $ A QϠ A Q C0A#| *A)Q"*A)Q*C80 *=b0A  0bABp $ A QϠ A Q C0A#| *A)Q"*A)Q*C80 *=b0A  0bABp $ A QϠ A Q C0A#| *A)Q"*A)Q*C80  =b0AĠ Cq  A Q A Q CKp``@ ,(\ 0 $ Q0 R+04+90  84\ 0 0 Q0 R+04+90=b0A $ / 0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80=b0A $ /  0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80=b0A $ / 0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80=b0A $ / 0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80&PP@ ,(\ 0 $ Q0 R+04+90- 84\ 0 0 Q0 R+04+90 =b0A $ k:/ 0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80  =b0A $ /  0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80 =b0A $ / 0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80 =b0A $ / 0@r -b A A Q A Q C 0B#q*A)Q"*A)Q*C80-]@c/j -L MP@P @^@  0| K00@ 0 @@.0 -LMP@P# @\1 @t@ $ $0 0 @K$  K@$ $   $0  00@$ $   $0@.L -L MP@P @^@  0ϠK00@ @@h.h -LMP@P$ @\2@ $ $  0? 0 $  K@$ $   $0  00@$ $   $0@E. -LMP@P&P1@ k`  0 @ &  0@ @0L 0A60K00@bA~p  0@ - 0-LMP@PP@ @DPE 0 060K0@ ;@. -LMPP@  0 K00@l: @, 0-LMP@PP"@ 0  D@K0Q00@ 0    D@,@,@x, 0-LMP@PP)@ U$ $00 0@0P 0  P $0 K0Q@+U $ $ 0DD @ ,@T,@1- -L MP@PpP%``@ ( ( P ; ( ( 0(80 K@b  ( (0P@ ,0 -LMP@PpP5``@ 8 ,P 8,0 + 8 84 sK804  K@b 8 (P 80(  8 80 sK800  @+L -L MP@ @A 0 90K@+h 0-LMP@P@ 0 ??0K0@+ p-LDMP`@>PP@ 2[02K,0 5,0 [K,  0E 2[02K(0 5(0 [K(  0F 2[02K$0 5$0 [K$  0$ 3[(03K80, 580 [K8  0I0 3[403K408 540 [K4  0J< 3[@03K00D 500 [K0  0H 4[L04KD0P 5D0 [KD  0MT 4[X04K@0\ 5@0 [K@  0N` 3[d0m:3K<0h 5<0 [K<  0l 5[p05KP0t 5P0 [KP  0Qx 4[|04KL0 5L0 [KL  0R 4[04KH0 5H0 [KH  0 5[05K\0 5\0 [K\  0U 5[05KX0 5X0 [KX  0V 5[05KT0 5T0 [KT   0 Kp@}+ p-L MP`@PP@0   0 :500A  0 500Kp@:+ -L MP@ @ 0 :0K  +@ -L MPP@`QppQQ T  R5TpW]@DT K@( (00 :<0( 2570( (0( 02 570T  R @Tp( (00 :<0( 2570W( (00(  2570 pp@@D( (00 :<0( 2570T( (00(  2570y@@@( (00 :<0( 2570( ( @0( 02 570O@*H 0-LM00@@PP0# 0TTo\o0oooP>>?? 0K0?<@t*>>@}*  0-LMP@P@P-0  n :P0 8400K000@p@.$ p-L MP`@'P7PP@0   0 060=$  0 @0L 0A60KpPP@`  0 060d@)< p-L MP`@<PfPP@  0 080=   0 080=  0 080=   0 080KpPP@  0 0800a   0 0800b  0 080c@)X -LMP@P!00@     0K@    0  @)p -L MP@P @ 080K00@@) -L MP@P`ᴀ'PGpp@@ 4P @4  0ʃ@ 8` @8  0ʃ$@ @ < 弣KẃK@0<$Kpp@@ (P @(  @ ,` @0, $@ @0 尣KᾂK@00  @( -L\B 00@ 0-LM0@ B0 PP0 4 T/  8   0  00 K08   0   00 @ -L00@ -L00@P -L]B 00@ -Lo: @@ ˂(`0+  ; ; @ @ @0@@ @0@@ A0A  A0!A A0A0A ((1!0 5  -L@@ ;(`0+  00ˁ0 ˂ @ 0@ @@0@ @@0@ AA0  A!0A AA0A ((A!0 5  -L@(0@ˁ0 ˂ ` 0+@;  ;@ @0@@ @0@@ A0A  A0!A A0A0A ((1!0 5  -L@@ ˂(`0+  ; ; @ @ @0@@ @0@@ A0A  A0!A A0A0A ((1!0 5  -L0P0J -LP}}}} 00 -L@P8~(~~~ 00hJ -L -L -L@@ @ @00@00@ R  0@ @ -L M@0AS dR 0dS,dQ; dRIK 0 @0@0 @J 0 @0@0 @p<:J 0 @0@ 0 @J 0 @0@#0 @J 0 @0@Ϡ0 @J p-LLM0@`S S  XPKPKp80 @>0 @J -L M@P K40 @Ϡ0 @ -L@@@D`pDD0 pP0`DDPPP`L`DP`  20`Pp0P0 0$0(0\P`0d0h0l0P0000000 -L MP@ l1 @0 @hJ K` PP@0S!pW P, @؀!!!0 @kϠ 0 @eJ!|0 @i 0 @gJ!40 @ 0 @ p-L MP@ 0 @0 @hJKpP @@@`V 0`0!!!80 @ 0 @eJ$ -LP -LP -LP -LP -LP -LP -LP -LP -LP -LMP K -LP -LP -LP -LP -LP -LP -LP -LM P K -LM  P K -LP -LPq): -LP -LP -LP -LP -LP -LP -LP -LM P K -LP -LP p-LM`  @$` @@@0PKXl(` $ K,` 50 03/l6 K03/@Kp -L Mpp@8K`lP(` 6,P ( K4` 0` 8 @0@@3/lPq5, K 03/ 8 0 @0@ TWLwP 0 @0@ @0 @@P 0 @0@ @h@P  0 @0@ @@$KGNU@d~.˽/='|>1LmJc&6S7bVOU_ModInitVouInterruptRouteVouReceiveSysCallBackVouExcBatchCmdVouPrintMux $,4@LXdlt@H08 ((PX`hpVouAllocCoefSpaceVOU_InitVouDisableSoftVOU_ExitVouDevIoctlcsc_ct_modedetectCycleVouCheckCascadeAttrVouGetPlayTolerationVouSetPlayTolerationVouSetChnFieldBatchVouCheckDispPosVouGetLayerAttrVouCheckAcmNeighBlkVouCheckAcmBoundVouCheckAcmAttrVouCheckCascadeIntfAttrVouDisableFrameRateMatchVouEnableFrameRateMatchVouGetDispBufLenVouGetVtthVouSetVtthVouGetCascadeAttrVouDisableCascadeVouEnableCascadeVouChnPlayFrmRtControlVouDisableSdTdeBypassVouEnableSdTdeBypassVouDisableChnDoubleFrameVouIr*: nitChnCtxVouEnableChnDoubleFrameVouGetChnDispThresholdVouSetChnDispThresholdVouGetChnPtsVouGetZoomInWindowVouSetChnRefreshVouSetChnResumeVouSetChnStepVouSetChnPauseVouGetChnFrameRateVouGetChnFieldVouGetChnDispPosVouGetChnAttrVouCascadePosUnBindChnBatchVouCascadePosUnBindChnVouCascadePosBindChnBatchVouCascadePosBindChnVouGetCascadePatternVouSetCascadePatternVouSetAttrBeginVouEnableCascadeDevVouSetCascadeAttrVouChnCalTotalLeaveDisplayVouWbcReceivePicVouWbcUpdateAttrVouWbcPutBufBlkVouWbcProcSendFrmVouWbcProcessVouWbcProcPrepFrmVouWbcStartCapVouDsuJobDoneVouChnSdVdecSendVouZoomInCalWindowVouSetDispBufLenVouCheckChnAttrVouChnCheckDispRgnsOverlapVouChnCheckImgRgnsOverlapVouChnRgnsSortVouChnDealSwitchForBypassVouQueryPreVoBlkVouQueryChnVouCheckVbVouChnSdViSendVouChnSdWbcSendVouChnHdVdecSendVouChnHdViSendVouChnVpssSendVouUsrSendFrameVouGetChnValidDataVouChnDsuProcessVouClearScreenVouChnDsuVouChnDsuBypassProcessVouQueryLayerIsSwitchPreVouChnDealRefreshVouChnDealSwitchVouChnDealPauseVouChnHdVdecQueryVouChnHdViQueryVouChnVpssQueryVouReleaseWbcFrameVouGetWbcFrmDepthVouGetWbcModeVouGetWbcAttrVouGetWbcFrameVouSetWbcFrmDepthVouSetWbcModeVouDisableWbcVouEnableWbcVouSetWbcAttrVouReleaseScreenFrameVouGetVideoLayerAttrVouGetDevCSCVouGetDevFramerateVouSetDevFramerateVouGetPubAttrVouChnClearBufVouGetScreenFrameVouSetZoomInWindowVouCheckRgnsOverlapVouSetAttrEndVouGetPipAttrVouSetChnFrameRateVouHideChnBatchVouShowChnBatchVouReleaseChnFrameVouGetChnFrameVouUsrSendFrameTimeOutVouDisableChnBatchVouEnableChnBatchVouSetChnDispPosBatchVouSetChnAttrBatchVouPipUnBindDevVouPipBindDevVouDisableLayerVouDisablePipLayerVouEnableLayerVouEnablePipLayerVouVirtDevTimerFuncVouSetLayerAttrVouSetPipAttrVouSetDevAcmVouGetVgaParamVouSetVgaParamVouSetDevCSCVouEnableVouLoadDetectInitVouDisableCas?:scadeDevVouDisableVouSetPubAttrVouIsDevWorkingVouGetCascadeDispDevVouDispLayerConfigVouDispGetValidDataVouDispProcessVouBufGetUserLenVouBufGetBusyLenVouBufGetFreeLenVouBufUserGetChnNodeVouBufGetChnNodeVouBufQueryFreeVouBufQueryBusyVouBufGetUserVouBufGetFreeVouBufGetBusyVouBufClearLayerVouBufSubBlkVbVouBufFillChnVouBufAddBlkVbVouBufClearDispNodeVouBufFreeDispUsrListVouBufFreeDispBusyListVouBufFillDispNodeVouBufFillLayerVouBufUserReleaseChnNodeVouBufReleaseChnNodeVouBufFreeChnBusyListVouBufClearChnVouBufFreeSdTdeVouBufFreeHdVpssVouBufMallocSdTdeVouBufMallocHdVpssVOU_GraphicsGetCSCVOU_GraphicsSetCSCVOU_GraphicsSetCscCoefVOU_GraphicsGetDevStatusVOU_GraphicsGetIntfSizeVOU_GraphicsSetVoCallbackVOU_GraphicsCloseLayerVOU_GraphicsOpenLayerVOU_GraphicsUnBindDevVOU_GraphicsBindDevVOU_GraphicsGetDevModeVOU_GraphicsIntProcessVOU_GraphicsSetDcmpInfoVOU_UF_BUF_InitVOU_UF_PutBusyVOU_UF_PutFreeVOU_UF_GetVbVOU_UF_PutVbVOU_UF_RlsBusyVOU_UF_BUF_DeinitVOU_UF_AllocNodeVOU_DRV_CheckLayerAttrVOU_DRV_GetDefDispBlkNumVOU_DRV_DevCapabilityInitVOU_DRV_CheckCasPattenVOU_DRV_CheckWbcAttrVOU_DRV_CheckWbcModeVOU_DRV_CheckDevCscVOU_DRV_CheckVgaParamVOU_DRV_SetDevVtthVOU_DRV_VtThd2DevVouDrvCheckHdIntfVOU_DRV_CheckDevPubAttrVouDrvCheckSdIntfVOU_DRV_LoadCoefVOU_DRV_GetInterruptDevvlph(`D <$xTXD<D H|VOU_DRV_SetLayerCoefAddrVOU_DRV_ZoomConfigVOU_DRV_DateSetting 22 @@@@@@@@@HAL_CBM_SetCbmMixerPrioHAL_CBM_SetCbmBkgHAL_CBM_ReleaseCbmAttrHAL_CBM_SetCbmAttrHAL_LAYER_SetVouPowerDownEnHAL_DISP_SetDateCoeffHAL_DISP_GetDateCoeffHAL_DISP_SetDateCgainHAL_DISP_SetDatet%: ScartHAL_DISP_SetGammaAddrHAL_DISP_SetGammaCoefHAL_DISP_SetCvbsGcHAL_DISP_CvbsDacEnHAL_DISP_SetBt656MuxSdSelHAL_DISP_SetBt656SelYcHAL_DISP_SetBt656MuxHdSelHAL_DISP_SetHdmiSelHAL_DISP_SetVouPowerDownEnVou_GetChnAbsAddrHAL_DISP_SetIntfBitWidthHAL_DISP_SetIntfSyncModeHAL_DISP_SetPlusPhaseHAL_DISP_SetPlusWidthHAL_DISP_SetHSyncHAL_DISP_SetVSyncPlusHAL_DISP_SetVSyncHAL_DISP_SetIntfClipEnableHAL_DISP_SetGammaEnableHAL_DISP_SetVtThdHAL_DISP_GetVtThdModeHAL_DISP_SetVtThdModeHAL_DISP_SetIntfClipHAL_DISP_SetIntfDfirEnHAL_DISP_SetIntfDataFmtHAL_DISP_GetDispIoPHAL_DISP_SetIntfSyncHAL_DISP_GetIntStateVbackBlankHAL_DISP_GetIntStateVblankHAL_DISP_GetIntStateHAL_DISP_GetIntfEnableHAL_DISP_SetIntfEnableVou_GetAbsAddrHAL_WBC_GetWbcOutFmtHAL_WBC_SetWbcOutFmtHAL_WBC_SetWbcCAddrHAL_WBC_SetWbcAddrHAL_WBC_SetWbcEnableHAL_GRAPHIC_SetGfxDcmpInterModeEnHAL_GRAPHIC_SetGfxDcmpAddrHAL_GRAPHIC_SetGfxDcmpStrideHAL_GRAPHIC_SetGfxDcmpBankHAL_GRAPHIC_SetGfxReadModeHAL_GRAPHIC_SetGfxUpdModeHAL_GRAPHIC_SetColorKeyMaskHAL_GRAPHIC_SetColorKeyValueHAL_GRAPHIC_SetGfxKeyModeHAL_GRAPHIC_SetGfxKeyEnHAL_GRAPHIC_SetGfxPalphaRangeHAL_GRAPHIC_GetGfxPalphaHAL_GRAPHIC_SetGfxPalphaHAL_GRAPHIC_GetGfxPreMultHAL_GRAPHIC_SetGfxPreMultHAL_GRAPHIC_SetGfxExtHAL_GRAPHIC_GetGfxStrideHAL_GRAPHIC_SetGfxStrideHAL_GRAPHIC_GetGfxAddrHAL_GRAPHIC_SetGfxAddrHAL_LAYER_SetRegUpHAL_LAYER_SetZmeRatioHAL_LAYER_SetHorRatioHAL_LAYER_SetVerRatioHAL_LAYER_SetTiGainCoefHAL_LAYER_SetTiSwingThdHAL_LAYER_SetTiCoringThdHAL_LAYER_SetTiHpCoefHAL_LAYER_SetTiHfThdHAL_LAYER_SetTiMixRatioHAL_LAYER_SetTiGainRatiovlHAL_LAYER_SetTiDefThdHAL_LAYER_SetTiEnableHAL_LAYER_GetZmeOResoHAL_LAYER_SetZmeOResoHAL_LAYER_GetZmeIResoHAL_LAYER_SetZmeIResoHAL_LAYER_SetZmePhaseHAL_LAYER_SetZmeVerTapHAL_LAYER_SetHfirOrderHAL_LAYER_SetZmeMscEnableHAL_LAYER_SetZmeFirEnableu0:HAL_LAYER_SetZmeEnableHAL_LAYER_SetCoefAddrHAL_LAYER_GetCoefAddrHAL_LAYER_GetLayerGalphaHAL_LAYER_SetLayerGalphaHAL_LAYER_SetLayerRectHAL_LAYER_GetLayerOutRectHAL_LAYER_SetLayerOutRectHAL_LAYER_SetLayerInRectHAL_LAYER_SetCscCoefHAL_LAYER_GetLayerDataFmtHAL_LAYER_SetLayerDataFmtHAL_LAYER_GetLayerEnableHAL_LAYER_EnableLayerHAL_VIDEO_SetMultiAreaRectHAL_VIDEO_SetMultiAreaResoHAL_VIDEO_SetAllAreaDisableHAL_VIDEO_GetMultiAreaEnableHAL_VIDEO_SetMultiAreaEnableHAL_VIDEO_SetMultiAreaCAddrHAL_VIDEO_SetMultiAreaLAddrHAL_VIDEO_SetLayerAccRstHAL_VIDEO_SetLayerAccCtrlHAL_VIDEO_SetLayerAccTabHAL_VIDEO_SetLayerAccThdHAL_VIEDO_SetAcmTestEnableHAL_VIEDO_SetAcmCoefHAL_VIEDO_SetAcmEnableHAL_VIDEO_SetLayerBkgHAL_VIDEO_SetLayerDispRectHAL_VIDEO_SetIfirCoefHAL_VIDEO_SetIfirModeHAL_VIDEO_SetLayerUpModeHAL_VIDEO_SetLayerAddrGRAPHIC_DRV_CheckCscCoefGRAPHIC_DRV_SetCscCoefGRAPHIC_DRV_EnableLayerGRAPHIC_DRV_GraphicBindDevGRAPHIC_DRV_GraphicUnBindDev<@CGKNRUY\^b}eziwlunrr*@Vlx,f@SS-037:=AD|GyJvNsQoUlXi\f_bb{v r#m&iv3:*d-`0\4W8S<O?KCGGyr k d ]WPJD>8 2 -(#j^j`_uU^L]B\9Y0V'SOJD>70( axaVymKyy@x6v+t!qmhc\VME<2(( "/?Pcwt^H0~zrjc[RJB:2*!skd\UNG?81*#g_XQKD=70*$w&:  ^WPJC=71+%  YRKE?93-(# #fuf#$Zuq"%Ns} &Bq &7m &-j &"f&a&Z%T%M $F#>"6!-% , = Obv    p\ I33 %)- 1x&: 5:>C}GyLtPpUlYg^bbBqqB AprD ?osF >ntG<lvI:kwK8jxL7iyN5gzP3fzQ2e{S0c|T.b}V!-a~X"+_Y$)^[&'\\'9DOSOD98DOROE97DNROE96CNROE:6BMROE:5BMQOF:4BMQOF:3ALQOF;2ALQOF; 1@KQOG;"0?KQOG<#/?KQOG<$.?JQPG<%->JPPH<',>IPPH=(+>IPPH=)*=IPPI=*{ vpke`Z!U%P)K.E2A7y3:<< $3BSewuaK6   ((6DTdt       v g XG%66 , = O b u o \ H 22 YbhbY$XagbY&W`gaY(V`faY*T_faY,S^faY/R^eaY1Q]eaY3P]daY5N\daY7M\daY9L[caY;J[cbY=I[cbZ>G[cbZ@EZbbZBDZbbZDPitiPOhtiQMgsjQLfsjRJesjS!IdrjT#GcrkT%FbqkU'DbqkV(CaplV*A`plW,z0:?_plX.>^olX0<]omY2:]omZ39\nnZ57[nn[7BstB @rtD?quF=ovG;nwI9lxJ7kyL5iyN3hzO1f{Q/e|R-c}T,b}U*`~W(_Y &]Z#$\\$ z uojd!^&X+S1M6G<BB  #}&y*v.r2n6j:f>bB^FZJVNRR {v!r%m*h.c3_8Z=UAPFKK67788y7q{%: 7j5b3Z1S.K+C( <#5 -&&vj^RG<1&~x qjb&Y1P<FFKK#=Y$/h$"w#$ $#"! xmaU H-;;tRtjR}aQXPPMGK?G7D0?(:"5/("   77*(F,V. e0u123333 2v1i/\-O+!A$(%33%KK#=Y|?:$/h$"w$$ $##" xmaU H-::aaSoF}9,  y p eZ)O6CC LL @X 4e )r      | t k c W LA4))mkmckxYhOgEe <a 3] +X "T M G A:1*",~+}*: v+n)g'`&Y$R KD>82 ,&!   ~z!v%q(m+h/d3`6[:W>SBOFJJNN BZ 6g +t !    ~ vmbYMB 5((hjh^jrTi}KgBd9a1])X!SMG @81' )z*s)l(e~): ']&W$P!IB<60 *  %    |wso!k$f'b+^.Z2U5Q9M=IAEE88 ,F S b p       t g Z L > // NNCY8f.s$ ztne^TJ? 3''MMBX8d/p&}|x smf^VLB7+jNjaNtWN~NMFJ=I5F-C%?:5. *"  <:gOg\OpTOyKNCL;I3F+C$?94- ' <<1I'Ucq xlaUI :,,p3pg3x_3X1P/I-B*;'4#.("  xxqjc\UOHB =82 , ("\dlu~xndZOE9.# s{}umd[SJA8/% ng_XQJC<5.(!  <:0@P`pp`P@0 ? U % fUD^3 v_I5"}tld\UNHA;5/*$ ~}|{zyxwvuutsrqqponnmlkkjiihggfeeddcbbaa`__^^]]\\[[ZZYYXXWWVVUUTTTSSRRRQQPPPOONNNMMLLLKKKJJJIIIHHHGGGFFFFEEEDDDDCCCBBBBAAAA@@@@? U % fUD^3 v_I5"}tld]UNHA;5/*% ~}|{zyxxwvutssrqpoonmmlkjjihhgffeedccbba``__^^]]\\[[ZZYYXXWWVVUUTTTSSRRRQQPPPOONNNMMMLLLKKJJJIIIHHHHGGGFFFEEEEDDDCCCCBBBBAAAA@@bl+KrTTf>qHv0<y+CrKc +:JZiy0ARdu#4FWhz$5EVfvbks{): {skbversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparm=csc_ct_mode:1: apply new csc contrast adjust mode.parmtype=csc_ct_mode:intparmtype=detectCycle:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 vo<6>unload vou.ko ....OK! %s[Func]:%s [Line]:%d [Info]:VO register failed VO PROC register failed VO Mod register failed <6>load vou.ko ....OK! unknow dev:%d Null ptr! Vo device ID %d invalid! Vo channel ID %d invalid! VoChn(%d, %d) hasn't been enabled! VoChn(%d, %d) has been disabled! [dev%d}:can't use sys,please check bind relationship! ERR IOCTL CMD %#x! [VOU] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:48] -----MODULE PARAM-------------------------------------------------------------- %s detectCycle%6u -----DEV CONFIG---------------------------------------------------------------- %s%s%s%s%s%s%s%s%s%s%s%s DevId DevEn Mux1 Mux2 Mux3 InfSync BkClr DevFrt DispFrt DoubFrm Toleration Vtth CVBS YPbPr VGA BT656 BT1120 HDMI LCD BT656H BT656L ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vou/vou.ci <= 3-NY%6u%8s%8s%8s%8s%14s%8x%8u%8u%8s%11u%6u -----DEV VDAC STATUS---------------------------------------------------------- %s%8s VDAC%6u%8s -----DEV VIDEO STATUS---------------------------------------------------------- %s%s%s%s%s%s%s%s%s VideoEn PiP PixFmt ImgW ImgH DispW DispH bTdeBypass%6d%8s%8s%8u%8u%8u%8u%8u%8d -----DEV VIDEO STATUS 2-------------------------------------------------------- EnChNum Matrix Luma Cont Hue Satu%6u%8s%8s%8u%8u%8u%8*: u%8u%8u -----DEV VIDEO STATUS 3-------------------------------------------------------- %s%s%s%s%s%s%s%s%s%s SetBeg SetEnd WBCEn bCasCfg bCasEn bCasSlv CasRgn CasMode CasPatn%6u%8s%8s%8s%8s%8s%8s%8s%8s%8u -----GRP STATUS---------------------------------------------------------------- GrpId OnDev ChNum FulFr TgtFr Start Resrv GrpGap BasePts-----CHN BASE INFO------------------------------------------------------------- %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s ChnId ChnEn Prio DeFlk ChnX ChnY ChnW ChnH DispX DispY bSnap Field bCas CcPos bRcvMatch%6u%6u%6s%6u%6s%6d%6d%6u%6u%6d%6d%6s%6s%8s%6s%6d%8d -----CHN PLAY INFO------------------------------------------------------------- %s%s%s%s%s%s%s%s%s%s%s Batch Show Pause Step Revrs Refsh Thrshd ChnFrt ChnGap%6u%6u%6s%6s%6s%6s%6s%6s%7u%7u%7u %s%s%s%s%s%s%s DisplayPts PrePts CurrPts ScalePts SetPts%6u%6u%20lld%20lld%20lld%20lld%20lld -----HD CHN STATUS1------------------------------------------------------------ %s%s%s%s%s%s%s%s%s%s%s%s%s QCnt NewDo OldDo LCnt SCnt ChRpt BusyN ShouD Dsped Area AreaT%6u%6u%11u%11u%11u%11u%11u%11u%6u%6d%6d%6d%6d -----HD CHN STATUS2------------------------------------------------------------ Buf1 Buf2 Buf3 Buf4 DBuf Stat1 Stat2 QNodeAddr SNodeAddr DispAddrUseEF%6u%6u%5s%1s%5s%1s%5s%1s%5s%1s%6u%6s%6s%10x%10x%10x -----SD CHN STATUS------------------------------------------------------------- %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s Job Task LCnt SCnt ChRpt DRpt CBusy DBusy b2Scl ChnAddr DispAddr%6u%6u%6u%9u%9u%9u%9u%9u%6u%6u%6d%6d%6s%9x%9x -----CHN OTHER INFO------------------------------------------------------------ %s%s%s%s%s%s%s%s%s%s%s%s%s%s bZo?:om ZmTyp ZoomX ZoomY ZoomW ZoomH SrcW SrcH FltTp HFlt VlFlt VcFlt%6u%6u%6s%6u%6u%6u%6u%6u%6u%6u%6u%6u%6u%6u -----WBC INFO------------------------------------------------------------------ WbcW WbcH PixFmt FrmRat RealRat Mode DataSrc Depth NotFin0%d/10%d%6u%6u%6u%7u%7u%8s%8s%9s%7u%8u -----VGA PARAM----------------------------------------------------------------- Gain%6u%8u%8u%8u%8u%8u%8u -----DEV Int Status---------------------------------------------------------------- IntRate IntTime MaxIntT TimePrM IntGapT MaxGapT%6u%8s%8u%8u%8u%9u%9u %5d.%-2dCoef memory has allocated! Apply for MMZ memory failed! ioremap coef buff failed VoCoefAlloc Coefficient Stroage Memory failed! VOU Interruptrequest_irq for VOU failure! HI_SUCCESS == s32RetHI_SUCCESS == CALL_SYS_RegisterSender(&stSenderInfo)HI_SUCCESS == CALL_VPSS_Register(&stVpssRgstInfo)HI_SUCCESS == CALL_SYS_UnRegisterReceiver(HI_ID_VOU)HI_SUCCESS == CALL_SYS_UnRegisterSender(HI_ID_VOU)HI_SUCCESS == CALL_VPSS_UnRegister(HI_ID_VOU)PALNTSC1080P@241080P@251080P@30720P@50720P@601080I@501080I@601080P@501080P@60576p@50480p@60800x600@601024x768@601280x1024@601366x768@601440x900@601280x800@601600x1200@601680x1050@601920x1200@60640x480@60USERtopbotmbothendingsetedbegin64Rgn32RgnSingleDualNormalDrpRptPrg2InMixerVideo[Func]:%s [Line]:%d [Info]:Set cascade attr bslave %d, failed! Set cascade attr enCasMode %d failed! Set cascade attr enCasRgn %d failed! Vo device ID %d invalid! Null ptr! Vo(%d) hasn't enable! Vo(%d), invalid toleration %dms, out of range(1, 100000)! Vo channel ID %d invalid! The enField %d is illegal! Channel disppos(%d, %d), w/h(%d,%d) exceed disp rect(%d,%d)! Channel disppos(%d, %d) doesn't aligned! The offset of acm block(%d, %d) and block(%d, %d)'s pub grid should be same!%: ACM bound block's offset should not overstep the bound! Illegale acm attr param 'bAcmBlkEn' %d! Illegale acm attr param 'u8UIndex'%d! Illegale acm attr param 'u8VIndex' %d! DHD0's intface(%d) should be BT1120 while configed cascade! DHD0's intfsync(%d) should not be 1080I60/1080I50/PAL/NTSC while configed cascade! Invalid dev id %d! Only HD dev support this MPI Invalid dev id %d! Should set vtth for physic vo dev Can't set dev(%d)'s vtth after vo enabled! Current chip doesn't support cascade! DHD0 has disabled cascade! DHD0's video layer hasn't enabled! DHD0 hasn't set cascade attr! Vo Dev ID %d invalid! Only SD device can support this function! VoDev%d video layer has not been enabled! In SdTdeBypass mode, only one chn can be enable! Alloc channel ctx failed! Not support dev %d! Only HD or cascade Dev support double frame Vo(%d, %d), u32Threshold %d should be in [%d, %d] range! VoChn(%d,%d) has not been enabled! VoChn(%d,%d), sd & virt dev not support refresh! Vo cascade device ID %d invalid! Illegal u32Pos %d! Chn (%d, %d) hasn't bind pos! Chn (%d, %d) hasn't bind pos %d! Vo %d hasn't been disabled! VoChn(%d, %d) has binded pos! Set begin already on dev %d! Clear old cmd list! Set end not finish on dev %d! Vo %d has been enabled! DHD0's video layer must enable before enable cascade dev! DHD0 must set cascade attr before enable cascade dev! VoCasDev must be VO_CAS_DEV_1 while cascade single mode! Vo dev %d init pool failed! DHD0 can't set cascade when vo is enabled! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vou/vou_chn.cNULL != pstChnCtxNULL != pstVoNodeWbc's frame depth is 0! Wbc no space to receive this frm! NULL != pstNode0Vou sub vb 0x%x fail, line is %d, fouc is %s vo wbc lost bottom field int! stop wbc in interrupt WBC get vb fail,w:%d,h:%d WBC not cap(0) VOU_DRV_IsPhyDevSD(VoDev) || (VOU_DRV_IsVirtDev(0:VoDev))VOU_DRV_AssertLayerTde(VoLayer)Send pic to voChn(%d, %d) failed! Channel(%d,%d) reject dummy frame(pts=-1)! Channel(%d,%d) gap is 0! Channel(%d,%d) doesn't receive this frame! Channel(%d,%d) doesn't have free node! Zoom Ratio underflow, calculated w/h(%d, %d) < (%d, %d)! Clip window x/y(%d,%d) error, source frame w/h(%d, %d)! Invalid source picture format %d for VOU! pstOutVFrame->u32Width >= u32ChnMinWidthpstOutVFrame->u32Height >= u32ChnMinHeigh(%d,%d,%d,%d) VoDev(%d), display buffer len should be set before vo enabled! VoDev(%d), display buffer len %d out of range(%d,15)! Set channel priority %d error! Chn rect is(%d,%d,%d,%d). When timing is interlaced and YUV420, XY and W must be 2 aligned, H must be 4 aligned. Channel rect(%d,%d,%d,%d) must be 2 aligned! Channel %d rect(%d,%d,%d,%d) smaller than mix value (0,0,32,32) or exceed image size(%d,%d)! Channel rect(%d,%d,%d,%d) doesn't aligned! Channel rect(%d,%d,%d,%d) smaller than mix value (0,0,16,16) or exceed image size(%d,%d)! Set channel bDeflicker %d failed! %d,%d,%d,(%d,%d,%d,%d),%d,%d There is overlap between chn %d (%d,%d,%d,%d)and current chn %d (%d,%d,%d,%d)! The pip layer should only enable %d chns! The vhd layer should only enable %d chns! NULL != pstPreVoNodeInvalid VB, pool %d, addr 0x%x! Unsupport input pixel format %d! Channel(%d,%d) Buffer Overflow with busy(%d) waterline(2)! Channel(%d,%d) received bad video buf! HI_INVALID_DEV != VoWbcDevNULL != pstWbcDevCtxwbc frame size(%d, %d) is not match with voChn(%d, %d)'s size(%d, %d) when RGB mode! Vo(%d,%d) not bypass! HD(%d) VDEC don't support bind to vpss bypass chn! Vo(%d,%d) send invalid picture! Channel(%d,%d) doesn't have free chn buf list! Vo(%d,%d) query + send, not bypass! VoChn(%d, %d) pause,not receive picture! Channel(%d,%d) received unmatched PixFormat video buf ! Vo(%d,%d) bypass, normal status! Vo(%d,%d) bypass, overflow threshold, deal switch! Channel(%d,%d) 's display waterline 3:is full! Vo(%d,%d), vi send invalid picture! VoChn(%d, %d) hasn't been enabled! VoChn(%d, %d) has been disabled! VoDev%d is SD, it can't receive pic from Mod(%d) through Vpss non-bypass chn! Vo(%d,%d) fist show! Vo(%d,%d) fist show when layer can switch! Vo(%d,%d) fist show when old list not empty! Vo(%d,%d) return last! Vo(%d,%d) return last when get busy failed! Vo(%d,%d) return last, last node still need to show! Vo(%d,%d) release last node when layer can swich while get busy failed! Vo(%d,%d) return last, layer can switch! Vo(%d,%d) return last, layer can't switch, show setpts! Vo(%d,%d) return last, layer can't switch, show old busy list but failed! Vo(%d,%d) return last, layer can't switch, show old busy list! Vo(%d,%d) return last, layer can't switch, quick show lastnode! Vo(%d,%d) return last, get busy failed! Vo(%d,%d) return last, step status! Vo(%d,%d) return last, pause status! Vo(%d,%d) return last, shoulddisp > disped! Vo(%d,%d) return last, lastnode still need to show! Device %d can't add dsu job again, there is a processing dsu job now! Vo(%d) query free display list failed! Vo(%d) get disp vb failed! VoDev %d: g_astModules[HI_ID_DSU].pstExportFuncs is NULL! VoChn >= 0 && VoChn < VO_MAX_CHN_NUMGet channel valid data failed! HI_INVALID_VALUE != pstProcVbBlk->u32BlkIdAdd vo(%d) clear screen task failed! Set chn(%d,%d) zoom in failed, use source frame to do dsu! pInImg->stVFrame.u32Width >= 16pInImg->stVFrame.u32Height >= 16pInImg->stVFrame.enPixelFormat == PIXEL_FORMAT_YUV_SEMIPLANAR_420 || pInImg->stVFrame.enPixelFormat == PIXEL_FORMAT_YUV_SEMIPLANAR_422 || pInImg->stVFrame.enPixelFormat == PIXEL_FORMAT_RGB_420 || pInImg->stVFrame.enPixelFormat == PIXEL_FORMAT_RGB_422pOutImg->stVFrame.u32Width >= 16pOutImg->stVFrame.u32Height >= 16NULL != pstDetNodeVo(%d,%d) switch layer not prepare, not showing! Vo(%d,%d) switch layer not prepare, showing! VoChn(%d, %d) bNew 0 + undo + update! VoChn(%d, %d) ha&: s been queried before! HI_SUCCESS == VB_UserAdd(pstVoBufBlk->stVFrameInfo[0].u32PoolId, pstVoBufBlk->stVFrameInfo[0].stVFrame.u32PhyAddr[0], VB_UID_VPSS)HI_SUCCESS == VB_UserAdd(pstVoBufBlk->stVFrameInfo[1].u32PoolId, pstVoBufBlk->stVFrameInfo[1].stVFrame.u32PhyAddr[0], VB_UID_VPSS)VoChn(%d, %d) bNew 0 + do! VoChn(%d, %d) bNew %d + do! VoChn(%d, %d) hide + bNew %d + undo + update! VoChn(%d, %d), no free node, bNew %d + undo + update! VoChn(%d, %d), no free buf, bNew %d + undo + update! NULL != pstQueryInfo->pstSrcPicInfoVoChn(%d, %d) old + undo! VoChn(%d, %d) change to old! Channel(%d,%d) reject dummy frame(pts=-1), new+undo+notupdate! VoChn(%d, %d) invalid picture! VoChn(%d, %d) new + undo + notupdate! VoChn(%d, %d) play ctrl failture, deal switch! VoChn(%d, %d) play ctrl success, deal switch! VoChn(%d, %d) pause, deal switch! VoChn(%d, %d) pause, old + undo! VoChn(%d, %d) total leave disp %d < disp threshold 3! VoChn(%d, %d) total leave disp %d >= disp threshold3, deal switch VoChn(%d, %d) new + undo + update! VoChn(%d, %d) invalid picture, deal switch! VoChn(%d, %d) bWaitQrySd, don't answer query now! VoChn(%d, %d) new + do! VoChn(%d, %d) can't malloc buf for vpss! Current chip doesn't support wbc! Vo device %d doesn't support wbc! ERR!!! Wbc invalid VB, pool %d, addr:0x%x Vo(%d), get wbc frame time out Vo(%d), busy list empty vo(%d) wbc frm depth(%d) must less than 8! vo wbc kmalloc node failed! WBC has enabled, please diable wbc first! Vo(%d), DataSource only can be VO_WBC_DATASOURCE_MIXER or VO_WBC_DATASOURCE_VIDEO! Vo(%d), image size(%d, %d), dev size(%d, %d), wbc scale rate can't larger than 8X(include 8X) while pixformat is 422 and WbcMode is VO_WBC_MODE_PROG_TO_INTL! Vo(%d), image size(%d, %d), dev size(%d, %d), wbc scale rate can't larger than 4X(include 4X) while pixformat is 420 and WbcMode is VO_WBC_MODE_PROG_TO_INTL! Vo device %d has been disabled wbc!!! Disable Dev:%d wbc timeout 500ms!!! Vo dev %d release wbc this b&: uf Vo dev %d release wbc next buf Vo device %d doesn't enbale! Vo device %d has enabled wbc! Vo device %d doesn't configured wbc attr! Vo%d video layer hasn't been enabled! Vo%d dev hasn't been enabled! Vo(%d), hd dev can't get&release screen frame! Vo(%d), invalid VFrame block, pool %d, phyaddr %d! Vo device is a virtual cascade device! Vo %d is a virtual device! Vo %d only support 25/30/50/60 framerate! Vo %d doesn't disabled! Vo %d doesn't set pub attr! Vo %d doesn't set user IntfSync! Vo(%d, %d), bClrAll flag %d err! Channel(%d,%d) wait vpss send after query time out! Vo(%d), this dev can't get screen frame! Vo dev %d havn't enable video layer! vo(%d), wait display frame time out! pVoScrBlk != HI_NULLHI_TRUE == VB_IsBlkValid(PoolId, PhyAddr)vo(%d) can't get screen frame, user list is empty! Current chip don't support pip layer, the u32Priority should be 0! Vo(%d)'s video layer has not configure! Vo(%d,%d) zoom in window rect(%d,%d,%d,%d) invalid, should align 2 and larger than (0,0,32,32)! Vo(%d,%d) zoom in window rect(%d,%d,%d,%d) invalid, should align 2 and larger than (0,0,16,16s)! Vo(%d,%d) zoom ratio(%d,%d,%d,%d) should smaller than 1000! Vo(%d,%d) zoom in type %d invalid! There is overlap between chn %d and other chns in vo's image! There is overlap between chn %d and other chns when display! Set begin not yet on dev %d! Set end already on dev %d! There is overlap in layer %d! Vo(%d), pip layer's total size %d can't be lager than D1! The pip layer should only enable 8 chns, now enable %d chns! Current chip don't support pip layer! VoChn(%d, %d) hasn't been configed! Set framerate(%d) > full framerate %d *64! VO frame rate is equal to your setting! VoChn(%d, %d) video layer has been hided! VoChn(%d, %d) video layer has not been enabled! VoChn(%d, %d) video layer has been showed! Vodev(%d), pip layer's total size %d can't be lager than D1! HI_SUCCESS == s32RetVoChn(%d,%d), user has relea3:sed frame, can't release again!(or user didn't get frame ever) VoChn(%d,%d), invalid VFrame block, pool %d, addr 0x%x! VoChn(%d,%d), invalid VFrame block, addr 0x%x, snapvbblk's addr is 0x%x! Vo channel %d not enable! Vo channel %d can't get frame again! Vo channel %d doesn't have last image! Vo hd channel %d doesn't show! Vo channel %d add vb(pool %d, phyaddr 0x%x) failed! Channel(%d,%d) received user frame time out! VoChn(%d, %d) maybe receive sys_send frame while receiving user frame! NULL != pstChnCtx->pstLastNode->pValuevou chn(%d,%d)'s frame not released yet! VoDev(%d) has been set cascade, can't use it's chn! VoChn(%d, %d) has been enabled! In sdtdebypass mode, only one chn can be enable! Pip layer's total size %d can't be lager than D1! Vou chn attr hasn't been configed! Only hd pip layer's chn support! Vou channel(%d, %d) don't need set! Vou channel(%d, %d) parameter illegal! Vou layer hasn't configed! PIP video layer has been unbinded! Pip layer still enabled! pstDevCtx->u32LayerNum != 2PIP video layer can only bind hd, present dev is %d! PIP video layer can't bind while dev set cascade! Pip layer has binded to dev %d! Pip layer has enabled! SD5 and pip layer can't be used in the same time! pstDevCtx->u32LayerNum <= 2Vo%d 's video layer has not been enable! Vo%d 's some chn is enabled! Vo wbc doesn't disable! Disable layer, virt dev %d sys_send time out! Disable layer, Dsu task time out! Vo pip layer has been disabled! PIP video layer hasn't been binded! Vo device %d not open! Vo%d's video layer has been enabled! Vo%d's video layer hasn't configured! While dev set cascade, video layer 0 can't zoom! PIP video layer can't enable while dev set cascade! Display busy buffer empty! Vo dev %d can't set layer attr when the pip layer has been binded! Vo%d video layer doesn't disabled! Vo%d video device doesn't configed! Vo%d's video attr is illegal! PIP video layer has not been binded! Vo device is0: a virtual device! Current chip doesn't support VGA! Vo device %d doesn't configured! Vo device %d can't enable when the pip layer has been binded! Vo device %d has enabled! Vo device %d has enabled in uboot! detectCycle (%u) is less than %u,set it to default (%u) ! Vo %d has been disabled! There is vo %d's chn still enabled! Vo %d's video layer doesn't disable! Vo pip layer doesn't disable! Vo%d's pub attr is illegal! [Func]:%s [Line]:%d [Info]:VoDev %d:DHD Timing is in V-blank! missing img_id Invalid cascade img_id from master chip! Slave chip is dual mode while master chip is single mode! Unsupport pixel format! Display busy buffer empty! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vou/vou_disp.cNULL != *ppstBufBlkVouDispProcess! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vou/vou_buf.cpLen != NULLNULL != pstChnCtx[Func]:%s [Line]:%d [Info]:Vo channel %d illegal chnbox index! VoChn(%d, %d) chn box=%d has been used ! VoChn(%d, %d) chn box=%d didn't fill! VoChn(%d, %d) has no free buf ! free list empty busy list empty user list empty plist != HI_NULLVo layer %d hasn't creat vb pool! Vou sub vb 0x%x fail, line is %d, fouc is %s Vo layer %d 's box hasn't been filled! Vo chn %d 's box has been filled! Vou add vb 0x%x fail, line is %d, fouc is %s NULL != pstLayerCtxVo layer %d get vb block failed! Vo layer %d 's box has been filled! Vo chn %d 's box hasn't been filled! Vo layer %d has destoried VB pool! Someone(%d) occupies this module(vou)'s vb %d! Vo layer %d destory vb pool failed! Vo layer %d has create VB pool! Vo %d create VB pool failed! -----LAYER CSC PARAM----------------------------------------------------------------- %s%s%s%s%s%s LAYERID Matrix Luma Cont Hue Satu%6u%8u%8u%8u%8u%%: 8u [Func]:%s [Line]:%d [Info]:Null ptr! graphics layer %d is illegal! gfxLayer(%u) is invalid! graphics layer %d has not been binded! the vo device for graphics layer %d has been disable! vodev %d for graphics layer %d has not been enable! DEV ID %d invalid! vodev %d for graphics layer %d has been disable! get vodev:%d scan mode failed! Set gfxLayer:%d DcmpAddr failed! get vodev:%d VtThd mode failed! Set gfxLayer:%d DcmpBank failed! Set gfxLayer:%d Dcmpstride failed! Set gfxLayer:%d UpdMode failed! Set gfxLayer:%d DcmpInterModeEn failed! [Func]:%s [Line]:%d [Info]:Null ptr! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vou/vou_uflist.cHI_SUCCESS == s32RetNULL != pstNodevi release free node;0x%p! 0 == VOU_UF_QueryBusyNum(pstBuff)vo alloc node failed! [Func]:%s [Line]:%d [Info]:Vo(%d), display area Rect(%d,%d) is illegaled, should between (32, 32) and (%d, %d) Vo(%d), image size(%d, %d) is illegaled, should biger than (32,32)! Vo(%d), image size(%d, %d) should be smaller than disp rect(%d, %d), hd don't support cut! Vo(%d), image size(%d, %d) or disp rect (%d, %d) dosen't aligned by 2 pixels! Video layer 0 can't zoom when it's width is larger than 1280! imgsize (%d, %d), disp rect(%d, %d) Video layer %d can't zoom! imgsize (%d, %d), disp rect(%d, %d) HD 0's layer disp rect(%d, %d) can't be larger than 1080p! SD(%d)'s layer disp rect(%d, %d) can't be larger than 720x576! Vo(%d)'s display frame rate %d exceeds normal range(1~100)! Vo(%d)'s pixel format %d doesn't support! Unknow Video layer %d Unkown Dev(%d) type! line:%d! Unknow Dev %d!! This chip don't support cascade! Vo(%d), enPixelFormat(%d) is illegaled, only support 420&422! Vo(%d), image size(%d, %d) is illegaled, should between (32,32) and (720,576)! Vo(%d), image size(%d, %d) is illegaled, width align 2, height align 4! Vo(%d), image size(%d, %d) can't be larger than dev size(%d, %d)?:! Vo(%d), image size(%d, %d), dev size(%d, %d), wbc scale rate can't larger than 16X(include 16X) while pixformat is 422! Vo(%d), image size(%d, %d), dev size(%d, %d), wbc scale rate can't larger than 8X(include 8X) while pixformat is 422 and WbcMode is VO_WBC_MODE_PROG_TO_INTL! Vo(%d), image size(%d, %d), dev size(%d, %d), wbc scale rate can't larger than 8X(include 8X) while pixformat is 420! Vo(%d), image size(%d, %d), dev size(%d, %d), wbc scale rate can't larger than 4X(include 4X) while pixformat is 420 and WbcMode is VO_WBC_MODE_PROG_TO_INTL! Vo(%d), invalid wbc mode(%d)! Vo CSC matrix type(%d) should be identity/bt601_to_bt709/bt709_to_bt601 only! Vo device CSC contrast value %d out of range! Vo device CSC hue value %d out of range! Vo device CSC luma value %d out of range! Vo device CSC satuature value %d out of range! Vo CSC matrix type(%d) should be bt601_to_rgb/bt709_to_rgb only! Vo VGA CSC hue value %d out of range! Vo VGA CSC luma value %d out of range! Vo VGA CSC satuature value %d out of range! Vo VGA gain value %d out of range! VoDev:%d, vtth value(%d) should be in range: [%d,%d] Unknow INTTERUPT ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vou/vou_drv.c0VOU_DEV_DHD0 == VoDevVo(%d), the intf %d is conflicted between hd0 and Sd(%d) for type %d! Vo(%d) can't use LCD and BT1120/VGA at the same time ! Hd%d can't use CVBSBT656BT656_HBT656_L intftype, intf is %d! Hd%d unknow intf%d! Vo%d check hd's intf %d illegal! (VOU_DEV_DSD0 <= VoDev) && (VoDev <= VOU_DEV_DSD1)Vo(%d), the intf %d is conflicted with hd0 type %d! Vo(%d) can't use VO_INTF_BT656, when HD0 has used VO_INTF_LCD! Vo(%d) can't use VO_INTF_BT656, when SD%d has used VO_INTF_BT656! Vo(%d) can't use VO_INTF_BT656 and VO_INTF_BT656_H(VO_INTF_BT656_L) at the same time! Vo(%d) can't use VO_INTF_BT656_H and VO_INTF_BT656_L at the same time! Sd%d can't use intf(%d) except CVBS*: BT656BT656_HBT656_L! Vo%d check sd's intf %d illegal! Vo%d's intfsync %d illegal! Vo%d's bDoubleFrame %d illegal! (u32PhyAddr & 16) == 0HD0 INTTERUPT SD0 INTTERUPT SD1 INTTERUPT UNKNOW INTTERUPT %#x ! g_stCoefAddr.u32Hor != -1g_stCoefAddr.u32Ver420 != -1g_stCoefAddr.u32Ver422 != -1enHCoef >= 0 && enHCoef <= VOU_ZOOM_COEF_BUTTenVCoef >= 0 && enVCoef <= VOU_ZOOM_COEF_BUTTVoDev:%d, VO_OUTPUT_USER Wrong Vact: %d Error layer id found in %s: L%d Error priority id found in %s: L%d Error, Vou_SetCbmMixerPrio() Set a wrong CBMMIX Error mix id found in %s: L%d Error channel id found in %s: L%d Error, Wrong coef update layer select Error layer id %d not support colorkey mask in %s: L%d Error layer id %d not support colorkey in %s: L%d Error layer id %d not support colorkey mode in %s: L%d Error! HAL_SetZmeVerTap enMode is error! Error coef found in %s: L%d Error, Wrong layer ID! Error area num found in %s: L%d Error ACM block id found in %s: L%d SYS Map vo crg failed -----GRAPHICS LAYER------------------------------------------------------------ %6s%8s LayerBindDev%6s%8d HC0[Func]:%s [Line]:%d [Info]:Vo CSC matrix type(%d) should be rgb_to_bt709/rgb_to_bt601 only! Vo device CSC contrast value %d out of range! Vo device CSC hue value %d out of range! Vo device CSC luma value %d out of range! Vo device CSC satuature value %d out of range! enCscMatrix %d err, should only be RGB to YUV matrix graphics layer %d Enable failed! gfxLayer %d is illeagal graphics layer %d should be unbind first! graphics layer %d should be closed first! graphics layer %d SetCbmAttr error! H$T$VOU_GraphicsGetGfxStrideVOU_GraphicsSetGfxDcmpEnableVOU_GraphicsSetGfxExtVOU_GraphicsGetGfxAddrVOU_GraphicsGetLayerDataFmtVOU_GraphicsGetLayerGalphaVOU_GraphicsSetRegUpVOU_GraphicsSetGfxKeyEnVOU_GraphicsSetColorKeyMaskVOU_GraphicsSetColorKeyValueVOU_GraphicsSetLayerOutRectVOU_GraphicsSetLayerInRectV): OU_GraphicsSetLayerDataFmtVOU_GraphicsSetGfxPreMultVOU_GraphicsGetGfxPreMultVOU_GraphicsSetGfxStrideVOU_GraphicsSetGfxAddrVOU_GraphicsSetCscEnVOU_GraphicsSetLayerGalphaVOU_GraphicsSetGfxPalphaVOU_GraphicsSetGfxKeyModeVOU_GraphicsSetCscCoefVOU_GraphicsGetDevStatusVOU_GraphicsGetIntfSizeVOU_GraphicsSetVoCallbackVOU_GraphicsEnableLayerVOU_GraphicsCloseLayerVOU_GraphicsOpenLayerVOU_GraphicsDeInitVOU_GraphicsInitVOU_GraphicsUnBindDevVOU_GraphicsBindDevVOU_GraphicsIntProcessVOU_GraphicsSetDcmpInfoVOU_GraphicsGetDevMode   ~w|8)~,8),8)X,(n(h,X,8),8)X,@, @$ z>X (#()h0pVdFP HH1@@$h p0 # `B:M dB:M dB:M B:MB:MB:MB:MB:MB:MB:MB:MB:MB:MB:MB:MB:MB:MB:M<:B:MB:Mhi3521_vouA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo.rodata.str1.4.rel__param__ksymtab_strings.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4 P)0% &h8؉4 <'pC$Z$V (0: hԌ{d *X p| y2  en  4,0nU r d,Hx$ -yypy/y{}؂p H39i  "*$5? ,NXLht y ~ $ @ T p dp4c,p \` <   t      , 0 %D +  1 7 = C I O U [ a g m, s8   y p t   @ D :   P 0 D \ h t     4   ( @ L X d  ! ' - 3 9 ?  E, K8 QD WP ] c i o u {      0                 < $  "| (p .d 4@ : @X FL LH R< X\ _ f m t {        4 D \ t      8  T ` l x  # * 1 8 ? FH MP TX [` bh ip px w ~  \     d  < \ p |    :      80@0   %T ,| 3 : A H Ot V ] d k r y\  T d l t      0  T        `     '< . 4 :4 @ OOGp N U4 \T TSXSc؟m tx {   $ [[,\0\X   a@b,c4c\r       8 H  T`     # .  9  D O ^  m  |0  <  H  T    1 B8 z - FTh_l(j z,ؠxxxx`rtx ` y :   4 ( 0~4~L hl    <@ЂԂ, ćȇ| x|     4 t tx   R4 ДԔ%` Еԕ1 7 = C LPI, OX 5U [ |PX a dlg( px+L HPijHPĸ@H F s 4 m lp@ . |$((< "p .  4\  y: : :| $((  LH 4 \ x     x| |0   4 ! H       8  \ 0  `   LP l ! E" '! 94" 3" ?" -x! ! K" ,0Q$# WP# |# 4 <   /  # ]# i# o$ {t$ c@$ u\$ dh% $ $ &  & % l% % % T& <% & @& &   ##8* m8) ' h* * ( \' _x) D': {) ( X( t) ' ' f( 8( ,,,+ * , + * + + h+ - , - `, @, + t::- H=L=. - AA*/ #/ h. @. . EE1/ 8/ F<0 ?0 Mt0 M MT0 [0 NNp41 w\1 b0 i1 ~1  \= m> 04\> > > PX@? : ? A ? ? \? X`H 4@ O @ |V @ ] |@ <@ d A k ,A r @ y `A  A A B A TX,0 ,B X\04 HB lB B  C B B 4C LC C   D 4D C C C   XD |D  `' D . D 5 D: < E C @E J xE DHQ $F X E _ E f E $(m DF   t lF   { F    0G F TG F G  G G  G G ` H !` ` t       "  1  @  O  ^ ( m D | \ p  |           ( ! 8 0 P ? h N   ]  l  {        0 L  d    /  >  M  \  k  z  0 D T h x       . = L0 [@ j\ yp  |           $  -0 <H Kd: Zx i x        ( < L \  ,l ;| J Y  h w       ,  @  P  `  t      +  :  I  X  g  v  $  4  D  T  h  x            *  9  H  W  f  u8  D  x !t0`0L  * K>l6 ,PStM ( (-1xPxvPPcHH JX,XQv&&In /LprptP  yP 04܅P @Q tQ :HLQ  Q Q |Q     $  4  #D 2T Ah P 5P,`N| dH П,tQ S T @T `S yR S lR T R T T U $U 8U V %X U |V U \U 8V RW DH1X 7X = Y CPY I|Y OY ptUY [Z aDZ glZ +Z x|mZ 8<sZ 4 [ Fd[ @[ طܷLT^ ^ ([ :\ ^ ^ y\ .[ 4\ :0] p] " \ D\ ]  ^ .\ vX(^ 4_ _ $_ D_ txx_ \_: _ _ _ `d` | |        $ 8  P * d 9 x H  W  f  u              !  !0  !<  '!H  3!T  ?!0<M!l]! Q 8tD` 5` lyh` ` ` `d` 8<a  @x|$(|@Ddhdh |TXTX<@ :$  h l   tx8<|PTl04 |@DHL,a TXda 8<a 8 <   !!""T#X###H$L$$$@%D%%%,&0&&&l(p(H)L)$*(***++l,p,--4.8. ////x1|1P2T2$3(384<4 556 699a 0;4;<<??BBFFa : 0G4GDHHHHHJJLLPL(M,MNNlOpOb ZZZZ[[\\]]^^h_l___4b ``aabbcchdlddd j$jjjPkTknnnoXb oo(p,pPqTq4s8sttttvvb ` j!` y!x ! ! ! ! ! ! ! !4 "L d "x " -" <" K" Z" i"  x"  "< "X "p " " " " " " # #( ,#@ ;#X J#p Y# h# w# # # # #  #8 #H #` #x # $ $" +$ :$ I$ X$4 g$P v$l $:  $ $ $ $ $ $4 $P $l % % *% 9% H% W% f% u%0 %H %` %x % % % % % %  &  & !& 0&4 ?&L N&d ]&| l& {& & & & & &, &D &\ &t ' ' ' /' >' M' \'0 k'L z'h ' ' ' ' ' ' '0 'L (h ( ( .( =( L( [(  j($ y(< (X (p ( ( D` `wH}}}}~tb yb b b c c c  ,c pc c c c (d TX`d āȁd d d d X\TX ( ( ( ( )$ b D   )# ") 3)! :  C)p(Y)(lg)Ԇ~)\)h:T)Z)4)&  )^) *d$*w06*PLP*Y*m*P~*]*$**'`* 6*x +,#+,p(>+ I+PZ+;Tk+ }+@b+܌+TD+ ++d1+8,td &,|T<,XN,QP_,,w,X,,\`,`,l$,< |,X --/-K-`r(\-s-h---\---%x. .ȅ,.,,>.@,Q.X@ e.(*}.$f ....H.el./tzt4/T)F/H Y/o/$  ///$//xh/p~t/$0{`0.0jpI0Lc0s0|04<0D0$j00 0\L0(0X1<@ +1t@1` ]1Lt1l11, 1001Q11M 1@12` 2&2Xh@2dPV2`2H}$x2Tl  2m2024G: 2\2X2/3|3|#3|(334C39$U34@ e3*  u38s3dj3Т33Ě3,33D%t4d84-4pC4W4om4444 4440p40\55H(5x>5XU5Ld5k5z5h5̂$5\5555646nh&6E6XS8N6[g60z66\6\6,646HH7<7$57[D7f7 7\7`7x$7ԕ,777C 88@28T D8[8 j8@884~888p8 8 8] 9#9JH:9w``9< Tl9h  9999j  9D  9|94k  ::{(:8C:ܷ[:Xq:4:I:\:@s:u:::$;(;;;9R;?l;X{;;;D;Л;ij;ԃ;<Hx<2<B<PtQ<`_8g<v<<$9@ <tm :  <P<p<<#<sp=l4%=Qd7=xC=`=w< v=W$== ==8,==4=Ԕ >X>,>5>-@ G>T>i>z>> > >0a`>8P>̠ >>E >P ?`?5?A tWA8mAA$B Al_A,A$`AHA_BB D*BtCBl[B0ulBl}pBB@tBBBB Cb !CXR \RuR(RRRRRXRSpS x,2S |GS\TS6@ dSkS^T}SSSЇSXSLS T@&TT9T+  ITBWT$kTg|TTT,98TTTTq  THTT8U:)UdXYX4oXFXX98XX(hX $X-X$ Yn$Y;Y`MY|fYYOYYY"xYTYX$<ZZ)Z@ @ZOZ4;fZuZZZlZpOZhP<Zp  Z[\: [H&[p8[0M[e[lu[l[H([p[ȁ[r [b$[d98\$\$\7\4L\^\,s\`8\\\\!  \\L],]v0"]t7]@O] g]]Ԃ]]]$]8]4v ]L=L^x^@h-^k8B^\^i^@^^^X^^_L_(-_ C_d  V_ ,> +? +@ ,? ,@ ,= +A ,A +B ,B +C ,C +D ,D +E ,E +F ,F +G ,G +H ,H +I ,I ` 0 +4 ,P 4 ` t Y          +L ,L w$+M(,M,` 4+N8,N<` D+OH+?L,OP,?T+PX,P\` +Q,Q+R+S,R,S` +Q,Q+R+S,R ,S` 0D+QH,QL+RP+ST,R`,Sh` +Q,Q+R+S,R,S` +Q,Q+R+S,R ,S` 0+M4,M8+<` @,H+TL,TP+UT` \+V`+?d,Vh,?l+Wp,Wt,Ux+X,X+Y,Y+Z,Z+[,[+\,\+],]` +,+R,R+Q,Q+^D,^h` p+x,+Q,Q+R,R+^,^$` ,+4,Hl+Qt,Qx+R|,R+^,^` +,(+Q0,Q4+R8,Rd+^l,^` +,+Q,Q+R,R +^(,^X` `+h,|+Q,Q+R,R+^,^` +M ,M$+_(` 0+`4,`8` @+VD+?H,VL,?P+WT,W\,_`+ah,at+bx+c|,b,c+d,d+e,e` +,+,+R,R+Q,Q+f0,fT` \+d,x+R,R3:+Q,Q+f,f` +,(T+R\,Rh+Ql,Q+f,f` +,+R ,R+Q,Q4+f<,fd` l+t,+R,R+Q,Q+f,f` +$,8d+Rh+Ql,Rp,Q+f,f` +M,M+g` +h,h` +i+?,i,?+j,j,g+k,k+l,l +m(,m,+n4,n8+o@,oD+pL,pP+qX,q`` h+l,+,+,+,+,+,+,+M,M(` 0+r4,r8+s<` D+VH+tL,VP,tT+uX,u\,s`+vh,vl+wt,wx+x,x+y,y+z,z+{,{` +|,|` +}+?,},?+~,~++,,+,+ ,+,+$,(+0,4+<,@+H,L+T,X+`,d+l,p+x,|+,` +R+Q,R,Q+,+,D+RH,RL+QP+RT,Qd,R+,+,L` X+`,hwt+|,w+,w+,w+,w+,w+,w+$,,w8+R@,RL+QP,QT+X,`+h,+,` +,+,` +,+ , `  + , + ,( ` 0 +4 ,8 +@ ,H ` P +T ,X +` ,h ` p +t ,x +| , ` + , + , `  +Q ,Q +R ,R +S ,S ` !+R!,R!+Q!+R!,Q !,R|!0:+!,!+!, "` P"+MT",M`"` h"+l",p"+t"` |"+"+?",",?"+~",~","+","+","+","+","+","+","+","+","` #+#+Q #,#,Q#+R#,R#+#,$` $+M$,M$` $+$,$` $+$,$+$,$+?$+~$,?$,~$+$+%,%, %+%,%+ %,(%` ,%+0%,D&+L&,x&` &+&,&` &+M',M'+'` '+','` ',('+0',4'+<',D'+?H'+~L',?P',~T'+X',d'+h'+l',p',|'+'+',','+'+',','+','+','` '+','4 (+(,0)` <)+D),)` *+M*,M*` *+ *,$*+(*` 0*+>4*+?8*,><*,?@*+~D*,~H*,L*+T*,X*+`*,d*+l*,p*+x*,|*+*,*+*,*+*,*+*,*+*,*` *+*+*+*+*,*,*,*,*4 +++,+++,$,+(,,@,+D,,`,+h,,,` -+M-,M-+-` $-+(-,,-` 8-+@-,D-+?H-+~L-,?P-,~X-,`-+h-,l-+t-,x-+-,-+-,-+-,-+-,-+-,-+-,-+-,-+-,-+Q-` -,Q-+R-,R..C(.7<.+@.,8/+@/,/` /+/,00` 80<00+0,D1` p1+Mt1,M|1` 1+1,1` 1+1,1+1,1+R1,R1+1+?1,1,?1+~1+1,~1,1+1,1+1,1+1,1+2,2%: +2+2,2,(2+,2+02,42,@2+D2,L2` P2+T2+QX2,\2,Q@3+D3,3` 3+M3,M3+3` 3+3,3` 3+i3+?3,i3,?3+3,3,3+3,3+3,4+4, 4+4,4+ 4,$4+,4,04+84,@4` D4 T4+MX4,M\4` h4{ p4+Mt4,Mx4` 4+4,4` 4+4,4+?4,?4+b4,b4+4,4` 44 4+4,54 $5+(5,D54 T5+X5,x54 5+5,54 5+5,54 5+5, 64 46+86,\6+M`6,Md6+h6` p6+t6,x6` 6+6+?6,6,?6+6,6,6+6,6+6,6+6,6+6,6` 6+6,6+6,7+ 7,$7+(7,87+<7,T7+X7,p7+t7,7+M7,M7` 7+7,8` <8L P8L 9+Q 9,Q\9+Qd9,Q9+9,9` 9+9,:` :+:,:` :+:,;` ;+;,;+<,0<` x<+<,<` =+=,@=` \=+d=,l=3=+=,=` =+R=,R=+Q=,Q\>+`>,p>+t>,>+>,>+>,>` >+R>,R>+Q?,Qd?+h?,?+?,?` ?+R?,R?+Q?,Q(@+,@,D@+H@,`@` t@+R|@,R@+Q@,Q@+A,A+ A,8A` PA+XA,`A3pA+xA,A` A+A,A3A+A,B` B+(B,0B3@B+HB,pB` B+B,B3B+B,B` B+RB,RB+QB,Q`C+dC,pC+xC,C` C+RC,RC+QC,QD+D,(D+0D,PD` \D+RdD,RhD+QlD,QD+D,D+D,E%: ` ,E+4E,,> ++,,+, 7 $+ ,, d+Oh,Ot +A,A  @DHLPTX\`dhlptx|+O,O +T ,T $X+O\,Oh p+D,D   k   , +O0 ,O<  L +\P ,\X  p +Ot ,O  +E ,E  +O ,O  +V : ,V  !7 $!+(!,,!a +O>,O> >+p>,p> ?" \?) ???+O?,O@ @+q@,q$@ @+O@,O@+OA,O,A+O4A,O@A PA+qTA,q\A hA+lA+pA,tA,A+A,A AAA+ A, B* @B4\BElB+ tB, B" B+OB,OC C+tC,tC \CwC+C+C,C,C+C,C DE$D+(D+,D,0D,d,>h |+O,O +?,? +,`+O,O +@,@ ++,, +A,A 87 HL X+s `,s + ,   C0+ 8, \rH+O,O +D,D $+ ,, LrtH+O,O +E,E D^  (+O,,O8 <+TH,TP h Ch (e  + , +O,O +F(,F, 8T<+ @, P `&:  t C +O,O +G,G  + , + , r,H@+OD,OP `+Hd,Hl | +O,O +, HH0 H+OL,OX d+h,l  +,a +s ,s  +,`+O ,O $+K(,K, 0+4,8`L+OP,O\ h+Ll,Lp t+x,`+,a 7+,`7 + , 8L L+s P,s x +,( 8 lC|4 C  +O,O +T$,T( <`  ^(+ ,T0+ 4, 8, <+O@,Ot\ +O,O +P,P +O,O +Q,Q +O ,O (+R,,R4 L+OP,O\ h+Sl,St +O,O +, +O,O +,$ ,X+O\,Oh t+x,  +O,O +,  +,a +s ,s < H T \+`,d`x+O|,O +L,L +,`+O,O +V,V +,`+, a 87D L+P,T`tT7+ , + , +s ,s +O,O$< P+X,`+ h, 4 0^ \K\ +O,O  +Y,Y  <BDd7 |L +s ,s + , ? (4 84 H\ d 4 +O3:,O +\,\  (+O,,O8 D+TL,TP \yr o 7+O,O +,  $+O(,O4 D+]H,]P h+Ol,Ox +^,^ +O,O +V,V +O,O +_,_ $< P X+\,`a t+s x,s  s+,`+O,O +V,V  +O ,O  , +b0 ,b4  8 +< ,D `\ +O` ,Ol  x +| ,   + , a 7 s + , ` 7 $ L 4 CD Xh 7p J t + x ,  J +O ,O  +T ,T  +O ,O  + ,  $ +O( ,O4  @ +eD ,eL  d +Oh ,Ot  +V ,V    7 L C + , a  +  , 8 +< ,@ `\ +O` ,Ol  | + ,  +O ,O  +T ,T  +O ,O  +h ,h   +O ,O,  8 +< ,D  \ +O` ,Ol  x +V| ,V    7 L C  +O ,O, 8+T@,TD X+O\,Oh t+hx,h +O,O +, +O,O +, +,a 8+ <, ` hu l+p,t`+O,O +V,V 7 L C7 /H+OL,OX d+Tl,Tp +O,O +, +O,O +, +,a +s ,s `d+ h, |+,`+O,O +V,V  (): 7 8L P+OT,O` l+p,t +,a C+ ,  c ,4D[ Ly X+@ \,@   +,`+O,O +T,T +O,O, <+o@,oD H+L,P`\v h+l,p` u +O,O +p,p +,` +O ,O ,+q0,q@ \+O`,Ol |+r,r +,`+O,O +s,s +,`  0 H+OL,OX h+l,t 7+,a + ,  +s ,s 8 L lO    (e\ `+d,h`|+O,O +v,v +,`_+O,O +, +, `$+O(,O4 @+D,L d+Oh,Ot +w,w +,`7 L +O,O +, +$,(a @7H+s L,s d+ l, O y C  0 8 @ D+H,L``+Od,Op |+T,T y +O,O +z,z +,`Jb ( <+O@,OL X+G\,G` d+h,p`+O,O +{,{ +,`  $(,048<@DHLPTX\l+ p,  X7 pL |+,a + , C<: (+O,,O8 D+H,L p+Ot,O +T,T +O,O +, +,`0 T <  x +| , `    ! !+O$!,O0! .~ .1..Q.1. ..3 / /+(/,H/j T/Q`/> l/~ t//+ /, / /+s /,s / / 0 L0h0 0D0^ 0+0,0 1+ 1,1 81+<1+@1,D1,P1+T1,\1 `1|1?:C1+ 1, 12+ 2T2+ 2,2, 24 272 224 2 2y 2 3+ 3, \3 l3x33+ 3, 3+s 3,s 3733 4 (4X4d44+ 4, 474x 4 5 05+ 85, \575 5 6L 46X6%p6+t6,66 6 6+6,7 7+"7,"7 (7#T7+X7,d7 p7+"t7,"x7 7#7D 77777+s 7,s 08 L8+P8,\8 h8+"l8,"p8 8#8D 8B8+8,8 8+8,8 89c 9 (9:+-:+.:+/:,-:,.:,/:+0:,0: :+-:+.:,-:,.:+0;,0; ;8;+-<;+.@;,-D;,.P;+0T;,0\; `;t;+ |;, ;+5;,5; ;+6;,6; <+- <+.<,-<,. <+7$<,7,< 0<L<+ T<, <+s <+ <,s <, =+5=,5= =+:=,:= >+5>,5$> (>+;0>,;D> p>+5t>,5> >+;>,;> >+5>,5> >+;>,;> ?+5?,5? ,?+<0?,<8? P?+5T?,5`? l?+;t?,;? ?+5?,5? ?+:?,:? L@+5P@,5\@ `@+:h@,:|@ @+5@,5@ @+:@,:@+-@+.@,-@,.@+7@,7@ @A+5A,5$A 0A+?4A,?8A DA|A+5A,5A A+BA,BA A B+5$B,50B  $ <+j@,jh+kl,k   % 46 L d9 9   +k,k +k ,k0\gtg%: +u,u +,  $ 8 L l  +k,k(4@LXdp|]]]],      5h3   (h43 D P \hh3 x  +j,j+k,ki 8wp  c  , X5 dK p1    U  (U 0pP l$ Q  +,,+0,c+, $w <w P+T, m  0 +, +,L+P,x+|,+,+,@+D,+,+ ,P+T,X+\,+,+,+, +$,T+X,+,+,+,8+<,h+l,+, +,+ + , ,  +  + , ,  (+ ,+ 0, 4, < L+P,lptx|+,++  ,$, , t+x+ |,,  +,++  ,$, , H+L,P l+t,+,+,+, + ,D+ L, T `p+t,+, +, + $, , 8H+L,+, $(,048<@+D,x0:+ ,  +,+,+,0+4,d+h,+,+, +$,@+D,d+h,l x+,+, +,+, $<+@,h+l,p |+,+, + ,,+0,4 @\+`,+, +,H+P,X dx+|,+, 4+<,D T+X,+,+, +,H+P,X d+h,+,+,+,+,$ 0+4,d+, +,+ ,  +,D+H,t+x,+, (+,,8< `+h,p |+,< +,+, D+H,T< +,+, +,< $+(,8+@,H T+,< < +,< 8+@,H T+,< +,+, 0+4,D< t+x,+, +,< +, +(,0 <\+`,l< +, +,< (+,,<< p+x, +,< +,+ , L+P,`< +,+, +,< h< +,< D< +, +,< 0 +4 ,D < x + ,   + , <  3:+ , < L +T ,\  h  + , < + , + ,  $ +( ,4 < < < ` < < H < < < 0+4,@< < ,< |< < d< < < X+`,h t+,< +,< +$,, 8d+h,x< +,< +, (+,,<< h+l,|< +, +,< (+,,8< `+h,p |+,< +,< 4+<,D Plptx|+, +,C x+|,C +,+,C + , $ 0P+T,`C + ,  D+H,XC C + ,  +,C 0C `+ h, p |+,C + ,  $+(,4C l+ t, | +,C C 4C hC + ,  +,C $+ ,, 4 @d+h,|C + ,  +,C ,+ 4, < Hl+p,|C + ,  +,C <+D,H T+,C C +(,, 8\+`,pC +, +,C +( ,,  8 \ +` ,p C +  ,    + , C (!C P!C x!+ !, ! !!+!,!C "C 8"C p"C "C "+ ", " "#+#,#C 8#+ @#, H# T#x#+|#&: ,#C #+ #, # ##+#,$C ,$+ 4$, <$ H$l$+p$,$C $+ $, $ $$+$,$C $%+ ,%, 4% @%d%+h%,x%C %+ %, % %%+%,%C &+ &,  & ,&d&+h&,x&C &+&,&+&,&+&,&+ &, & &,'+0',<'C X'C 'C 'C 'C ( (C 8( P(+ X(, `( l((+(,(C (+(,)C ,)+ 4), <) H))+),)C )+),)C *+ *, * $*\*+`*,l*C *+ *, * *+++,+C @++D+,T+C x++ +, + ++++,+C ,+,,,,C P,+ X,, `, l,,+,,,C -C 8-+<-,L-C -+ -, - --+-,-C .+  ., (. 4.|.+.,.C .+.,.C .+ ., / /T/+X/,h/C /+/,/C /+ /, / /x0U0 0 0 08 00 0U1 1 1 018 @1P1 `1+ h1, l1 x11+1,1C 1+2,2C 42+ <2, D2 P2|2+2,2C 2+2,2C 3+ 3, 3 $3d3+h3,3C 3+3,3C 4+ $4, ,4 84d4+h4,x4C 4+4,4C 4+ 4, 5 5H5+L5,d5C 5+5,5C 6+ 6, 6 6@7+D7,X7+\7,t7C 7+7,7C 7+7,7C 8+$8,48C X8+\8,p8C 8+8,8C 8+8,8C 8+ 9,  9 99+9,9C $:+(:,@:C t:+x:,:%: C :+:,:C ;+  ;, ; ;+$;,(; 0;h;+l;,|;C ;+;,;C ;+ <, < <8=+<=,P=+T=,l=C =+=,=C =+=,=C >+>,,>C P>+T>,h>C >+>,>C >+>,>C >+ ?, ? ?8@+<@,P@+T@,l@C @+@,@C @+@,@C A+A,,AC PA+TA,hAC A+A,AC A+A,AC A+ B, B B8C+Ο 茮Οt`@@@ @ @@( @@ @ @   @ @ 0@ 0 @ @ @0SSPP@0|TXH `V`  X0H R X0HP X0HP X0HPy X0HPT X0HP/ X0HX  @@ @ @: @ @ @ @ @!@P@Z Hp@p@, Kx# $ L`0D<~@8P` p@@8 @ `4 @0 @ @ @ @ @@ `V`)p)``p)p`)pW`-X.>@0 @(p0 @`ph@@P @L @H @D @@ @< @0-=@0@( !h@@` @\ @X @T @  @P0@@p @l @h @d @=-@A@ @| @x @t @對=-@@ @ @ @ @ @ @@48T!@1 0@ P`ph\GBTE8DTT @ATU=0 h\HBT8DTT @TUp`-W! h\8BT8DTT @TU T81p1@0@` P-W(KB8T!@1 0@ P0 h\ TB8B8T@,0@:, K0呎#q က0 p` @,0@ 0#, K `0  @,0@ 0#, K `0  @,0@ 0#, K `0  @i,0@ 0#, K `0  @D,0@ 0#, K `0  @, 00@ , K1# `0  @0,0@0#,K 0@   P -L8M@PT $pd@b<`@HpPDhP`d0\ `@a&'lp` @TX㈀qpT~ @p􀟅P PT0T> ! -b A0 > @}"2cST@K`P@$K$.lR:@@ 2@h 0-LM0P: @T&0DSPP 0 @Π 0 @K00 @ @PPJx0 @ZP0 @PPJ40 @ @PPJ  0-LM0P; @T'0DSPP 1 @ 0 @K00 @z0 @PPJx0 @sZP0 @PPJ40 @n @PPJ4 p-L M`P P@@@ @: @@0 @Π  @0P@0 @e0  @PKpH p-L M@P ` hPP P0 @`0  @PKp@@ ?@X -L MpQ`& @  !p- P0 @B@0 @P@00@  - K0 @, @@@J@@0 @@M 60 @@d 0-L@p0P 000 -Lm` @!Pf p~0ؐSZ c3/ 6 @` @5 @0 @ pp``  pp$``(, ㏠0p$p4`(`8,<5 @`l0  @dpph``p txpp|``儀 p$p`(`,` p pX X0 @p0 @p p   Pi!80S 403/@  040P0000 @!0 @ 0P0t!P PUPP@M` @!P n0ؐSZ s3/2 @p @2 @`0 ` @ pp `` $pp(,` `o0$:4p(p8,2 @``l0  @dhppp t``x|pp` `刀$p(p,` p pX X0 @p0 @p p   Pi!80S 403/@ A@@ 3pp@p!000 PJ -@@P F5@@@@@@, 5@x -LT 0S@( S*@ PP@pP X$,^t (0x0 tpx40#q| \P: 0P . Pp0 P 6 @x&t< @p00CPt0xp&!0S SXP  @!P9 .P^0ؐSZ ⊃3/6 @ @5 @spP0 P @ p pPP $(pp,P P_0$4(8p,p05 @P`l0  @dhpp ptPPx|ppP P$匀(p,pP p pX X0 @p0 @p  00 Pi p!80S 403/W $@dP! bA0 >@}"2n^ $lP*l@KȂ P@@ l|0p S0 pp0 SF,P( !2 @ @?0@  !<K8<@20 0@4 bl! (K!l1 @  @@@D!3@@@!9``@`@@ 9@@@ 2@@@@@@ 9``@`@@` 9PP@P@@8 9@@@@@@ 9@h p-L MPP@(0U*00@ R(4 @A|0 @@T Q$P,U\@\1`(mb`m 0`: `@" @V0&1]P]?20@V;\SZ?h P`bV``haS a"R# bhQaQ2hacPP0hQb`cV2h``0cc2S30PS\0`8 ` hR 0042 @0 @@PT PT !1 @  @Kp!|1 @ @/ @ @!@, 1 @y @J0 @w0 @J0 @0 @J@@8 8PP@P@@ }8@@@@ p-L M@P ` hPP P0 @`0  @PKp@@ 2@  -L4M@PpP- T@(0T*Uo W] 00@ RaVk 0S0,S#$S  AR0S? R<09(0S,0S d0CSQX0S4\ R10.0S75hQ @!P  ] -ppX|8 @p 0 @, W p X  X0 @0 @ !0TpL X @\:[~'XL嚘,TpXP @P7 @P0 @   $(, 0$4(8, @6: @P`l0 @dhp tx| $(, @0 @0S S2 (KS& S$ 5 @d0 @J0S l T5 @lh0 @J\l  @d h4 @ 0 @,p4 @0 @JH4 @X0\4 @0 @J3 @0 @Jn @($ ,0148 <$@(Q3 @ @JA2 @(02 @0 @J&p2 @,0D2 @ 0 @J 2 @$0 @J1 @0 @Jh1 @ @J(1 @0 @J0 @020 @! @J0 @ @J 80 @@@ ;@@@@ -L4M@PpP5 T@(0T*Un GQ900@ R0aVr P0,S;$S 0 CR0SO RLI(0S,0S d0CSQX0S\ R 0 0S:hQ @!P  pqXppp8 @p 0 @, W p X  X0 @0 @ !0TpL X @\Z~'XL嚘,TpXP @x7 @P0 @   $(, 0$4(8, @6 @P`l0 @dhp tx| $(, @0 @0S S2 (KS) S' 5 @d0 @J0STRl! |5 @lh0 @J\l  @d h4 @X0\ @J4 @ 0 @,pp4 @0@4 @0 @J3 @0 @Jn @($ ,0148 <$@(Q@3 @ @JA3 @(02 @0 @J&2 @,0l2 @ 0 @J (2 @$0 @J1 @0 @J1 @0Sh1 @ @J(1 @ : 0 @J0 @0 @J0 @ @J`0 @ @J@@ +=@@@@( -L4M@P`]@(0TX*Q 00@ RQU" 0S0,S$S  AR0S  R 0(0Srp,0S d0CSQX0S\ R00ShQp @!P  `` `pp X X0 @`0 @p!L0 L P @ @VX @6 @P0 @   $(, 0$4(8, @6 @P`l0 @dhp tx| $(, @0 @0S S2 KSI SG  5 @2d0 @J0SlA 4 @2lh0 @J\l  @d h84 @.0 @J3 @2X0\3 @20 @Jt3 @0 @J} @($ ,0148 <$@(`2 @ @JP2 @.(0T2 @$0 :  @J52 @. 0 @J$1 @.,01 @'$0 @JX1 @.0 @J 1 @'0 @J0 @20B0 @C @J`0 @ @J@@ >@@@@< -L1 @,0 @JT1 @0 @J1 @00 @0\0 @ @Ji t0 @\0 @ @JR@@ 5PP@Pt -LlMP0P@00 @(X*Uh Rv , R7 ^0S P Q: @L0 @ PS0000@ RaVq  R0,S$S 0AS0S R(Q,Q*(dAQ\Q Q*XQ\Pp^hp\S#Q7:R"P :, R  00Kp(K00@`4` P `P Xl lX X@Xl0S 4K2/d0\Sx  S4x p৐  pp h  0p h000Kp t d K4倐x倠4圩,l4p圩,x4 T 0p X P L H ` \ 8  : pPmlX XX lp hp 00KpPz  h6 @  @s6 @LVPpP 0 @ppPpJ\\42lC D6 @f~plh0 @ppJA5 @\0 @ppJ. h5 @  @`5 @fΠX0\` 5 @\,0 @ppJ4 @fd0 @ppJ4 @d0\ @ppJH4 @c0X40x 4 @I0 @ppJ3 @Nvp @ppJ3 @\vp(0T3 @U0 @ppJ3 @\ 0 @ppJv2 @Xvp$0 @ppJc2 @\vp0 @ppJP82 @f0E 2 @Lvp,0 @ppJ51 @X0 @ppJ$1 @fΠ0`1 @J @ppJ 1 @K p0 @ 0 @pJ0 @vp @ ppJ@@h Q6@@@@@@@ 6@@@ 6@ -LMpP@P` QL,R[Sj@0S3 @ !P~ $P):Z(`@0X@ 08 00P !<1 @<0 @@$K1 @~ @Jl1 @z0 @J(1 @{0 @J0 @|0 @J0 @y @J`0 @ @J@@ 5@@@@ 0-LM@P0P0 ) Q K0PPPP K0PPPP x0 @m0 @PPJ40 @l @PPJ p-LM@P0`P 0 = Q+ R 0 KPPPP Kp PP PP 0 @<0 @PPJT0 @; @PPJ  0 @: -LMPP@Y  > @  @(K``@4K 0=@  P PU 0  0 P{  pPw P` P?!,@P @ Tp I= @ 0 @PP&d<$lW? PW W0 @p F?MQτ0` (< @v0 @@@+w4@0` ]τp` 0 P$(h+P!p  @!P P^0ؐSZ s3/; @p<:  @: @0 @ PPpp  PP$pp(, ㏠0P$P4p(p8,8: @`l0  @dPPhppp txPP|pp儀 P$Pp(p,p P pX X0 @P0 @p    Pi P!80S 403/U $0d@@r<p@H0P@Dh` d\ @b@hG#l0 T@\@TN@@\Xȟp ˆ T0T>! -b A} @· cS $~lW :@ PP0 P0 lK⠇p @0$(<'7 @}p0  @@ } .& $(P!p  @!Pu >0؀SZ S3/L6 @P @6 @sp0 @ PPp p $PP(pp, 0$4P(P8p,p5 @Ϡ` l0 @dhPPpp ptx|PPpp 刀$P(Pp,pp P pX X0 @P0 @p  P Ph P!80S @04@3/U $0d!  bA0 >@Ç}Ϡ"2n^ $lP*K p@?: p2 @A0  @@  $ 0(`"!@< pP@ $2p } @J0 @$@ 0$00(!!D1 @@0  @!<K040@"M @8?] @d0@ p-L M0@\ `-LPP@AP @`@@0L0C0Kp @@ @2PP@P 0-LM0 R P4 @!2 @ 0@@P B K0@@ 1@ p-L M 0R` S P0 @"@ @`@P 0A 0Kp@@ 1@0 p-L M01 S `- P@2@ 0@P`00L1  R LKp*:00 @ @H -LM!1S R( `-|P@2@ 0@P`01C 0 Rp00C0KX0 @ @@@ u?@@@@l 0-LM@P'  0R P@" @PL0S 00C 0K0\0 @M0 @@@ J1@ 0-LM 0R S @@" @P@ 0A 0K0X0 @' @P@@ K?@@@@ 0-LM@PPB QJ 0S <1 @0 @Q 0 @0 @ 0S 0 @0 @K0@@@ 1@@@ 1@@@@ -L$MP@@`40 0-ˀ (0 $ ,0 (00 00pQ00p PqP W p pP Y VpF 0-0 f @P 8pP p!p<8P pp   ,8$4p0pP P p0 8 V !0P<pP0 P 8 ,$4p0 PP@P4bo pPJ XE0p b?   4Y(K q<0  pp800 0,0000p0$4 p @P 1 @N0 @ J0: @1 @40 @`Q 0 @0 @p0S J 0 @0 @ Jp<0 @^0 @ Jz -L -L -L -L 0-LM PK@ 0 O@ 0 K0 0-LM PK@ 0 O@ 0 K0 -L00JP -L 0 -L 0 PP -LM K00  K -LFMP P PI  @@ @n?@\ `Pp@(pt'Xp Pp`,t!@H@ RL D T P  R R @   @@ @1@ @ @$ N(@  ,@ \ V@4(@\@  `^  ` p | x S IoK4 @0 <@ 8@  \K,K0Kp P@ ``@ ` `@ ` `@ ` <`KA pKP `$Q P @P0K`` @@  pp    @@ @v?PP@P,`pg$`H` p@ p0gKlp h0K 0 @0@ 0 @J @@ @r?PP@P -L,M \p`(@,P \_ @@"1@D \(@ U \l pq,0 `R04@ 8` <0 ,P  RI R0(0  @@x!f?PP@P0(0 ~ ^^]`I0RA  %1#AaQbBNĠ2PSB,~P!DK(D\<,\ @ 8$%:@@PP KD \(@ pv&0` ( `0 @0 @J@@ >@@@@, -LCMCK @`@ \pKP Z00\0 00 Z\0 01  0S SF @@<$0@@@@0|0 0, R(@x h l@ d t p <0 80 4 0 L0 H0 D @ 00  0SS @P @  P Р  0CS񟗫ȬԬԬ| CPS000 ( ,0  吐 0 @S|KCP < K0KLKP P-1@SEQ2 @`P P t0 @pP`  0SS < K0KLPK P P1 @Π0 @J(KP 0\0 1 0X0 CP Qii"Ƞ @(PD1 @@ @Đ /P @ 尠 @ P 㼐 @PȠL@K0@0 @Ps  @@ 1``@`@@` [1@@@8 ?1pp@p@@ 0@D -L -LM 0 K -LMQ0 K  0  K -L -L -L@ -L @@@PDSU_AddJobProcAreaDSU_QueryStateDSU_ExitDSU_InitJobProcInfoDSU_Init ,8DP\htxHT`l$0< DSU_FinishJobProcInfoDSU_GetFilterParamDSU_SetFilterParamDSU_&:FreeMem_CBDSU_VbSubDSU_MallocMem_CBDSU_NotifyDSU_CancleAllCreatedJobDSU_ProcTaskInJobDSU_TaskNotifyCallerDSU_CancleAllWaitJobDSU_CancleJobDSU_JobFinishCBDSU_EndJobDSU_VbAddDSU_AddLDCTaskDSU_AddRotateTaskDSU_AddBypassTaskDSU_AddFillTaskDSU_AddDualScTaskDSU_AddOddScTaskInterDSU_AddOddScTaskDSU_BeginJobDSU_CreateBypassTaskDSU_CreateTaskDSU_SubmitJobToHWmax_dsu_taskDSU_GetJobFromBusyListDSU_GetJobFromCreatedListDSU_GetJobFromFreeListDSU_GetPointedJobFromWaitBusyListDSU_GetJobFromWaitBusyListDSU_GetTaskFromJobDSU_GetTaskFromFreeListDSU_DeInitBufDSU_DeInitJobBufDSU_DeInitTaskBufDSU_InitJobBufDSU_InitTaskBufDSU_HAL_SubmitOsdOverImgTaskDSU_HAL_SubmitFillTaskDSU_HAL_SubmitScaleTaskversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=max_dsu_task:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 dsu ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/dsu/dsu.cNULL != pstProcInfo[%s]: %d,dsu was query state:job num:%d, free job num:%d Dsu hal close failed=%x, Dsu go on exit dsu exit successfully... open hal err = %X register mem func to hal err = %X [DSU] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:46] -----MODULE PARAM-------------------------------------------------------------- %12s max_job_num%12u -----RECENT JOB INFO----------------------------------------------------------- %s %8d%8s%8d%8d%8s%8d%8d%8d -----MAX WASTE TIME JOB INFO--------------------------------------------------- -----DSU JOB STATUS------------------------------------------------------------ %10d%10d%10d%10d%10d%10d%10d%10d -----DSU TASK STATUS----------------------------------------------------------- %10d%10d%10d -----DSU INT STATUS------------------------------------------------------------ %10d%10d%10d%113: d -----DSU MEM REQ STATUS ------------------------------------------------------- %10d%10d%10d%10d -----DSU TASKLET STATUS ------------------------------------------------------- -----DSU JOB STATISTIC FOR EACH MOD-------------------------------------------- %10d%10s%10d%10d%10d%10d NULL != pJobinput NULL Ptr illegal dsu filt type:%d unsupport filt type:%d ,just support ser param to filter type of USER1/2 Get param(filter type:%d) failed:%x unsupport filt type:%d ,just support set param to filter type of USER1/2 set param(filter type:%d) failed:%x free VB fail,for DSU hal temp buff(phyadd:%d poolId) free VB for DSU hal temp buff(phyadd:%x poolId) NULL != pTaskNodeinimg VB--: pool:%d PhyAddr:0x%x Outimg VB--: pool:%d PhyAddr:0x%x get VB fail,for DSU hal temp buff(size:%d) get VB for DSU hal temp buff(size:%d poolid:%d phyaddr:%X) dsu was notified to exit ... NULL != pCurJob && DSU_JOB_STATE_CREATED == pCurJob->enJobStateNULL != pCurTask notify user task has finished ..... fmt = %d width = %d height = %d field = %d YphyAddr = %X CbphyAddr = %X CrphyAddr = %X YVirAddr = %p CbVirAddr = %p CrVirAddr = %p YStride = %d CbStride = %d CrStride = %d NULL != pCurJob && DSU_JOB_STATE_SUBMITED == pCurJob->enJobStateinput illegal param: job handle %d dsu mod not ready job not in created state,now state is %d cancle job:%d (addr:%p) and free job num:%d, task num:%d NULL != phHandle0 <= hHandle && max_dsu_task > hHandle(NULL != pJob) && (DSU_JOB_STATE_PROCING == pJob->enJobState)0 <= enModId && MAX_BUSY_LIST_NUM > enModId busy job num:%d, first Job:%d(addr:%p) 0dont't schedule tasklet... schedule one tasklet... hal=%d job=%p 0 <= pJob->enCallModId && HI_ID_BUTT > pJob->enCallModIdput job:%p from created to wait busy list dont't schedule tasklet... inimg VB++: pool:%d PhyAddr:0x%x Outimg VB++: pool:%d PhyAddr:0x%x dsu don't support this operation input illegal param: job callmodid %d input illegal pa3: ram: task callmodid %d (not equal job modid:%d) input illegal param: in img fmt %d input illegal param: img size(%d,%d) input illegal param: stride %d input illegal param: err inimg addr(Y:%X,C:%X) input illegal param(odd): out img fmt %d input illegal param: err outimg addr(Y:%X,C:%X) dsu free task not enough for fill task need temp buff:%dbyte update job temp buff to %d ~~~~~~~info of %dnd task:%p of job:%p (Field=%d)~~~~~~~~~~ ......inimg info..... ......outimg info..... ......TmpBuff info....... tmpHandle = %d ......opt:%d bitmap info...... phy=%X s=%d w=%d h=%d bAlpha=%d Alpha0=%d Alpha1=%drect.x=%d rect.y=%d rect.w=%d rect.h=%d ......opt:%d fill info...... color=%X fill.x=%d fill.y=%d fill.w=%d fill.h=%d input illegal param: err rotate angle:%d input illegal param: dst rect(%d,%d,%d,%d) pic(w:%d h:%d) input illegal param: osd fmt %d input illegal param: err osd size(w:%d,h:%d) input illegal param: err osd stride(Ys:%d,Cs:%d) dsu free task not enough illegal scale strategy:%d input illegal param: type %d,HFilt %d, VLFilt %d VCFilt %d dsu (pstOpt)->bForceHFilt %d (pstOpt)->bForceVFilt %d input illegal param: scale %d-->%d add pTask:%p to Job:%p kmalloc for pstTmpTask failed when 2scale! g_astModules[HI_ID_SYS].pstExportFuncs != NULLGet temp buff(size:%dbyte) from vb failed when 2scale! 1st task failed when 2scale! 2nd task failed when 2scale! input illegal param: job pri %d input illegal param: job callchnid %d no free job for user to beginjob DSU_JOB_STATE_FREE == pJob->enJobStateDSU_BeginJob ok: put job(hdl=%d addr=%p) to created list not submit job to hw because of DSU Mod exit HI_SUCCESS == s32RetDSU_HAL_BeginJob err:%x submit task:%p(type:%d) of job:%p to HW DSU_HAL_SubmitXXJob err(invalid task type:%d) DSU_HAL_SubmitXXJob (task type:%d)err:%x put job:%p(state:%d) to busylist[%d] DSU_HAL_EndJob err:%x ModId ModName JobNum MaxJob psNum MaxPNum TslNum MaxTslNum &: TslTm MaxTslTm ReqOk FreeOk ReqFail FreeFail IntNum FifoDepth IntTm HalProcTm Success Fail Cancel AllTaskNd FreeNd BusyNd AllJobNd BeginNd EndJobNd ProcNd SeqNo ModName JobHdl TaskNum State InSize OutSize CostTime Free Begin EndJob Procing ProcOk ProcNok ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/dsu/dsu_buf.c!list_empty(&pBuf->stBusyJobList[ModId][ChnId])!list_empty(&pBuf->stCreatedJobList)plist != HI_NULL[%s]: %d,DSU_GetPointedJobFromWaitBusyList :job wait for busy list empty job wait for busy list empty pJob != HI_NULLtask list of job %p empty job free list emptyNULL != pJobBufNULL != pTaskBufto free job index buff:%p to free job node buff:%p to free task node buff:%p malloc job index buf(%d*%dbyte) for DSU err malloc JobList buf(%d*%dbyte) for DSU err malloc TaskList buf(%d*%dbyte) for DSU err ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/dsu/dsu_hal.c0[%s]: %d,submit hal a osd task failed=%X submit hal a fill task failed=%X .........TdeOsiMbBlit............. stOutSfc.u32PhyAddr:%X, stOutSfc.u32Width:%d, stOutSfc.u32Height:%d stOutSfc.u32Stride:%d, stOutSfc.enColorFmt:%d stOutRect.s32Xpos:%d, stOutRect.s32Ypos:%d, stOutRect.u32Width:%d stOutRect.u32Height:%d ~~~~~~~TdePass:%d picmode=%d~~~~~~~~ InimgWidth = %d, InImgHeight = %d, field=%d outimgWidth = %d, outImgHeight = %d, field=%d submit hal a scale task failed=%X $(,hi3521_dsu%:GNU| 0GDGڅr-k4A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rel.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4  |(V)T$% X 8x<4 X@G\C YpOX2̳kg tZ whs Z D$} ,[h$p/,W ,N  $ %<1 ; @\ EO Tcm r0: w,0z   wwTX( < w`       t   |  D T l   $ 8    H "x w,\(d w. 4 : @t w@DF` L wR X whl^ d, j wp| vP wdh|d , T    w!"  H l w&&    d $   w.. D p  wd3t3   w4 4  # ) /, 5H ; A0 G M S Y _X eh k$ q w } d wp>x>$ wHHwRRP w*:D[L[    wHgPg   L 0 wss  X  ( wHLh    @ w$,w8<wx|  w!4 (d / 6 = D wwKZi$ x0D Ph     ,4;HJX Ydhx w   ( <P+`:tIX gv   1 B w ( ,< ( w w % w:JU(d sܒ  ;  1@T O wm w8<r  w z w@ 0 w\ w?:    p  w4@ "D  ww0H"l-;w   p ; 1 @  w O m r@ ww$<zX  d wtxw I W,eDwp w w` s`#  ! w  HPg  `/;K|`]"k$y,8x4 , \ H/ < V $e DLx  T p  x @  4X  0 pL % 2 @> 0(` (w <  L   H   x>x  p  + ܔX@ ܒU d t    < P |` <:   L+ 8 lB X4c v   0 X 0  |  4h  t3 , 3 K \a 4Dr \  hH     sT  RD  42=N_w<@<&\ p"1.<L[ $aDSU_GetVerMagicDSU_ModExit.LC0DSU_ModInit.LANCHOR0.LC1.LC2.LANCHOR1.LC3DSU_QueryState.LANCHOR2.LC4.LC5$d.LC7.LC6.LC8.LC9.LC10.LC11.LC12.LC13.LC14.LC15.LC16.LC17.LANCHOR3.LC20.LC21.LC19.LC22.LC23.LC24.LC25.LC26.LC27.LC28.LC29.LC30.LC31.LC32.LC33.LC18.LC34.LC38.LC37.LC36.LC35.LC40.LC39.LC41.LC42.LC44.LC45.LC43.LC47.LC46DSU_Notify.LC48.LC51.LC52.LC50.LC49.LC53.LC57.LC56.LC54.LC55.LC62.LC65.LC64.LC63.LC61.LC60.LC59.LC58.LC66.LC68.LC69.LC67.LC70.LC71.LC82.LC84.LC85.LC86.LC87.LC88.LC79.LC80.LC90.LC83.LC76.LC77.LC89.LC75.LC74.LC78.LC72.LC73.LC81.LC91.LC92.LC94.LC93.LC95.LC96.LC99.LC101.LC100.LC98.LC97.LC106.LC105.LC104.LC102.LC103.LC111.LC107.LC108.LC109.LC110.LC112.LC115.LC116.LC117.LC114.LC118.LC119.LC113__func__.13473__func__.16065__func__.16045__func__.13457__func__.16000C.332.15908C.333.15909C.334.15910C.335.15911C.336.15912C.337.15913C.338.15914C.339.15915C.340.15916C.341.15917__func__.13489__func__.15405__func__.15388__func__.15375__func__.13449__func__.15350__func__.16055__func__.13869__func__.13593__func__.13550__func__.13823__func__.15146__func__.15254__f):unc__.15057__func__.13439__func__.15637__func__.15427__func__.14864__func__.14668__func__.14417__func__.13954__func__.14204__func__.13903__func__.15221__func__.15195__func__.13624__param_str_max_dsu_task__mod_version3432__mod_license3431__mod_author3430__mod_max_dsu_tasktype3428s_stModules_stExportFuncsmax_dsu_task__param_max_dsu_taskg_enDsuModStateg_stDSUCtxs_stDsuDbgInfoDbgTslProcTimes_stDsuDbgExInfoDbgEndJobStaBeginTm__func__.10259__func__.10155__func__.10126__func__.10217__func__.10191__func__.10086__func__.10056__func__.10041__func__.9974__func__.10019__func__.9916__func__.9990__func__.6681__func__.6618__func__.6484__mod_srcversion23__module_depends__mod_vermagic5DSU_HAL_SubmitRotateTaskDSU_AddOddScTaskInterparam_ops_uintDSU_QueryCreatedJobNumTdeOsiMbBlitCMPI_RegisterModDSU_PutJobToFreeListTdeOsiMb2MbTdeOsiCancelJobDSU_SubmitJobToHWDSU_CancleJob__this_moduleDSU_CreateBypassTaskDSU_PutJobToCreatedListDSU_HAL_CancelJobTdeOsiOpenDSU_QueryBusyJobNumDSU_HAL_GetJobNumInHWVB_UserAddDSU_HAL_CloseDSU_FinishJobProcInfoDSU_GetFilterParamTdeOsiOsd2MbDSU_GetJobFromCreatedListcleanup_moduleDSU_SetFilterParammemcpyDSU_QueryBusyTotalJobNumDsuProcShowkfreeDSU_QueryFreeJobNumDSU_QueryWaitBusyJobNumdo_gettimeofdayDSU_AddLDCTaskDSU_ExitDSU_HAL_GetFilterParamCMPI_RemoveProcTdeOsiEndJobDSU_InitBufDSU_HAL_GetTempBuffSizeOfDualTaskDSU_HAL_RegisterMemFuninit_moduleVB_UserSubDSU_BeginJobCMPI_CreateProcTdeOsiCloseDSU_AddBypassTaskg_astModulesDSU_AddRotateTaskDSU_GetJobFromBusyListDSU_GetJobFromWaitBusyListkmem_cache_allocDSU_PutJobToBusyListDSU_QueryFreeTaskNumDSU_FreeMem_CBVB_GetBlkBySizetasklet_killTdeOsiMbFillg_aModNameDSU_GetPointedJobFromWaitBusyListDSU_MallocMem_CBDSU_PutJobToWaitBusyListDSU_HAL_SubmitScaleTaskDSU_GetJobFromFreeListDSU_HAL_SetFilterParamtasklet_initDSU_VbSubDSU_HAL_GetTempBuffSizeOfOddTask__tasklet_scheduleCMPI_UnRegisterModpanicDSU_HAL_EndJobDSU_InitDSU_PutTaskToFreeListTdeOsiGetFiltParamDSU_ *:HAL_SubmitOsdOverImgTaskmemsetDSU_HAL_SubmitFillTask__memzeroDSU_VbAddDSU_HAL_OpenHI_LOGDSU_GetTaskFromFreeListDSU_HAL_SubmitLDCTaskDSU_PutTaskToJobDSU_InitJobProcInfoTdeOsiBeginJobExDSU_RlsTmpBuffDSU_QueryTaskNumInJobvfreeDSU_HAL_IsSupportRotateVB_Handle2KernDSU_AddOddScTaskDSU_AddFillTaskTdeOsiSetFiltParamDSU_HAL_IsSupportLDCseq_printfTdeOsiMemRequestVB_Handle2PoolIdTdeOsiRegisterMemManageTdeOsiGetJobNumInFifoDSU_CreateTaskDSU_GetTaskFromJobDSU_HAL_BeginJobDSU_JobFinishCBDSU_DeInitBufDSU_QueryWaitBypassJobNumvmallocDSU_AddJobProcAreakmalloc_cachesVB_Handle2PhysDSU_EndJobDSU_AddDualScTask\+`+d+h,l,p,x+|,+,+ u, +,+,,@+D,\jp+,+,+,+,,+0+4,8,D+H,PTh+l,+ , +,++,,}+`,`w(D+H,\d+l,t|+,+,+,$+ (, +"," +#,#+$ ,$$,+%0+&4,%8,&<H+'L,'T\+(`,(dp+)t,)|+),)+),)+),)+),)+),) +),)(+),,)8<+@,P+*T,*++,++,,,+),)+),)+),)+),)+),)+),)$+)(,),8+)<,)@H+*L,*\+d,+-,-!?: ++,++.,.+),) +) ,)  +) ,) ( +), ,)0 < +)@ ,)D P +)T ,)X d +)h ,)l p +)x ,)  v g g g g$ +/, ,/4 < +D ,L uX Zd +0h ,0  ++ ,+  +1 ,1  +) ,)  +) ,)  +) ,)  +) ,)  +) ,)  +) ,) $ 0 +/8 ,/H T +2X ,2p x ++| ,+  +3 ,3  +) ,)  +) ,)  +) ,)  +) ,)  h +4 ,4  ++ ,+ $ +5( ,5, 8 +)< ,)@ L +)P ,)T ` +)d ,)h t +)x ,)|  +6 ,6  +7 ,7  +) ,)  +) ,)  +) ,)  +) ,)  +6 ,6( 0 +84 ,8< H +)L ,)P \ +)` ,)d p +)t ,)x  +) ,)  +) ,)  +) ,)  +# ,#  +9 ,9 +9,9H+9L,9h+:,:+,+-,-$+,,t+-|,-+,+-,-+ ,T+-\,-ht+|,+-,-+,4+-<,-HT+\,+-,-+,+-,-$,048<@DHLPTXw+*,*D+*H,*++,,+=,=,zD+H,TX+@`,@l+,+A,A+,"<: +B,B +,(+C,,C4@t+,+F,F+,+G,G+,$4+B8,B@X+\,ht+Cx,C+*,*+*,*+,+J,J(+,,@H+KP,K\h+N,N+O,O++,,+P,PDXht+x,+S,S+*,*+,+C,C+*,*(+,,@P+TT,TXd++,,+X,X (\nx+*|,*+,+Y,Y(+,,8L+ZT,Z+,+Z,ZHhx+N,N+O,O0]pv+*,* +$,,8+Y<,Y@P+T,`t+Z|,Z+, +Z ,Zp    +N ,N  +O ,O   !! !X!]`!+d!+h!,l!,x!+[|!,[!!+!+!,!,!+\!,\!!+!+!,!,!+]!,]!!!!""" ""0"+ 4", D"+H",x"+*|",*""n"#+#, #,#+Y0#,Y4#D#+H#,T#h#+Zp#,Z##+#,##+Z$,Zd$$$$+N$,N$$+O$,O$$$$ %%P%]d%+h%,t%|%#):u%%+`%,`%%+%,%%+a%,a% &+&,&,&+b0&,b4&P&+T&,`&l&+cp&,ct&&+&+&,&,&+[&,[&&+&+&,&,&+=&,=&&&&&&&+*&,*'w,'+ 0', H'+L',''+',((g(+f (,f4(X(((+(,((+Y(,Y()+),)()+Z0),Z))+),))+Z),Z$*D*T*d*+Nh*,Np**+O*,O******,+wd++*h+,*++*+,*`,],v,+,,,,+g,,g,--w\-+`-,l-t-+h|-,h--+-+-,-,-+[-,[--+-+-,-,-+i-,i--+-+-,-,-+i-,i-.+.+., .,.+=.,=$.(.+,.+0.,4.,@.+jD.,jL.P.+T.+X.,\.,h.+kl.,kt.x.+|.+.,.,.+l.,l..+.+.,.,.+m.,m........../+ /, /+/,>+C>,C>,>+<>,H>+L>+P>,T>,`>+=d>,=l>p>t>>>+ >, >+>,?@q8@D@+H@,X@d@+zl@,zp@@@i@i@+v@,v@@+w@,w@A+{A,{PA\A+|`A,|dAtA+xA,AA+ZA,ZAB+}B,} BB+ B,(B ,>T[+7,7+?,?ī,+70,7`p+@x,@Ԭ+1ج+2ܬ,1,2+4,4+1+2,1,2+4,4 +3: $+1(+2,,10,2<+4@,4HL+1P+2T,1X,2d+4h,4pt_|f + , {+ +s, ,s $+ (, ,\PTX\`dhlptx|Y b yW48c<@aDHLPTXp\l`dxo,<0:hi3521_vdec.ko9Y9Y9Y ELF(xP4( p-L00@ Ϡ  2$`BTXQ  @R 2$_BT4BTp p -L -L`PPP$P"P1PPP!PAP  P 1P P BP #P P -LP 0 0 ??,00 0 000$0(0P08400 @00 0@@@DH@@@(@`\$L,480 P0`P000 -L?PJ@/#"RJ -L?PJ@/#"RJ -L?PJ@/#"RJ -L?PJ00@Ϡ0#"RJDP t!\1 lR00 -L?PJ@/#"Rd J l00 -L?PJ00@/0#"RJQ3'J<0 0 -L?PJ@/#"RJ -L?PJ@/#"R3J0 -L?P0 @Ϡ##J 30 -LM@0S @P P@@  @ @ @0\0 @@  @ @00@@@@@pp@p@ @``@P`P@@P@@@\P<~@\ @@`@@@ `p @D H L P T X P=Qh 0SS Z@0 SS @0 `S03 S0 S0 $S0 "S0  S0  S0 S :0 S0 AS 0  S 0 !S 0 S 0{ BS 0x S0u S0p ” H\D P^L  TX0@ 0 P@UO`X @ @0 0@@@PP@@P@@p @p@p@``@@`{@@`_PQ `@VO 8_XP2S `\OX01 RNF  @ @00@``@@@p@p@0p p@P8 P@P@\Z@@`@@@@QQG0 Qh@ lph0p`xSc|1t1Qnln` \h l ld l0< h @p@d0@t 0-L?P@J 000@/0#"R@PJ 0  p-L?P@J p/00@ QJ3\\ P`J p-L?P@J p00@o0&2SPJ -LQ 0 00`S3 S1 : S. $S+ "S( S$ S S S AS  S  S  S  BS  S S (0 ,04<$8  -L M@ SP`0`PcpV Xi  0S (*PP: (KU 1 W2*Xb  0S *QD: Pe0 S*P*0c  @P R;  R  R0c  @Ppe X 0c  @P0c  @`0c  @PX 0c  @`(g 0  e -LDM?PPp@@J(K/00@`Q@@J0CSS  @Pφh PNOO8– \dK_ pp@2Ss  岀2? ∠ 0 ∀匠 ! " ? X0岐㈀1∀0 ∐!dK8 @2S  ? 2L1 2  ! !h4 \0 3/Pm 0  @f0 @@@J]  -LM?PP`J(Kɟ @ p࿯ Pf@@@2Sd  <2? 0 2 !   ? 2t20< 2: 2 <! ! JO 280 0"0@ DL` "R  ? @D@0 < @0"<! ! 0 K\043/ P"00@R  ? HK@0 @0"  ! " ? 0000K?00<  0 <!28 Ss^p 00 SSc0500b00 0SS QF SS^? 00@pppp Ѐ5#pp@^ TdYl X)h9,P(4 00$2S  ? 2L@1o0< 2 <! ! 00@ 5"0ypp npyp 0 @< 2P<SP@  ? 2P@10<  2 -LM?PP@@J(K00@o0&࿟ PCPpp@2SE  ? A2∀B 2匀! " ? B0A2@ 0@@"!QF@l0S (@T BTl 2@B@S@@ "  ? 2L1 0 0!! l 00K(@4/@P \04 3/ P\@ 44/P P2@@@S  ? 刀1∀2  ∀@!@   ? 2℀1Ԁ :0 "匀!"RN2pp@S  ? 0C" 1 2 !!OPpPPpP @嘀ppTpW`   @@p⤀pTpW<   @ ğ@p B B@BDBHBLBBB \0 43/@P 0 @@@JNOO0  @ P #>A℁NtΆxA |!pq1qqqp[φ@̀KⰀ @@ppp,qp@ ?2@@@S  ? 2 L1 0 0!! @@JF @0 @@J;2@@@S  ? 2HL1 2  !! @0 @@J2@@@S  ? 2L1 2  !! @  @@J@@!0pp@p2PP@S  `2? 儀Hq`∀0p pb匠 !! @@L 0@0 @P@@ 0P@P -L M@P 0 <0(, 0040K@@ T7@ -L MPP @000@&̠嬐0 Jt`pSp pi`i؆``  (0,0 \ T (K @@ @ -L?P@J00@:_4%࿏pPObV0 @r+ 00 @J -L?P`J@@@00@"6'R[  s? lP1P2 P!P " ? 21sΠ00  !"R( 2@@@S  ? |0C2102  !!JP "R00@А6&Ά ☩ 0 R,  n @`2 @S@@  ? `0C2D02  !! S0Q,:cP)*0+ 2@@@S#  ? 0C2L0 2 ! !!!! -L M?P0 JK@Ϡ#2SJRJ 0<K@a<@ 8 bK4 $0 -L,M8KP`0P 0 @(K?UJ@@@@<0 2<Sh  ? 删 2∠  2匠 ! " ? 2 10H 2H0 !"@D 吥"Qɒ ( "@@@R  ? L H0  2H0 !!J0 pr'P@p t @p QpQ P@ W Q"``@R  ? @) : H0  2 H0!!0X43/P2``@Sb  55? T02 `!`   ? 05020"0!2圥*S( 2@@@S  ? P0C27 02 "!!J@ j` ˜D\b 2@@@SI  ? 0C2; 0 2!!"@@@R  ? L !H0  2 H0!!0 @`!|"R 0 @㑥,P `Pi-@!2 @ 0@P@p `2C`<D# 0AL˜SSDLL Q8 #SS0S1 + 0L˜\-2@@@S  ? XLQ02 2 !!@2 @P@N@ˆ 0 @ L""@@@R  ? xL QΠH0  2 H0!! @ -L Q0J?SJ𫝈@O$QJx|p`W`fᔕpn p`f`lP``@c#΃䙓`䉃 Ÿ 0  0``@p c,0YkPY `k | -L,M?P`pJ(KQJ 00@ɏ6(࿯ PP1t1 \ᘅ  lY PP@2S  ?  : @1@2 @!@   ? 21Π02 "!!t 0nY!R0JPM:Qb a 0pQ`^P 0@Ѐ&@ɖ ) 0  P002S  ? 2tL1 0 0!! POMQM0aP*0 @`2`@S  ? 2L1  2  !! J PR !t\!lQ PQhQt@ TQ d j@ Q2S PM?@@PK 㮟 H H 0 @4 < 8 ^ 0 E  t0 Sc cP 0 @J J0 @`2`@S  ? 2`N1 l0 @ J O -L$M?PPpJ @o%&2S†(KOPWPet0 S  0cS[ t!`S0! Q\=* @0 J!0`aX!R0#0b\:0a!c pQb Z@ᜅ%.ș@ЀI@P@ @ O!R 0 @J!t0S!cQ^$ Xt1 ^ n\XJh PQBt Q :! a10cP01y ?@K/H  L L0 0 @4 <0 8 H  t!0SccP ^ 0PH O 0 @E -L M?P`pJc@@@2S`  3 ? P1P2 P!P   ? 223 2 0 0!@#Q- 2@@@S  ? 2L41 0"0!!J KP @#QPP“ ^+ 0 @2@@@S  ? 2 L=1 2 !!Jp"R   ^ :( ^*(\,*R2@@@S  ? 2LQ1 2  !!0 @J2@@@S  ? h0C2L 0 2!! PY, -L  ? 24L1  0 ! !HnOk2@S  ?  : 0C2 0 2! !"R ”  T @?P @K@L XP \` Hd2S ^ Qk HP2SLQ2SZ   ? t`1`2 `!` " ? 2102  !d"R 2S 2S  ? 0C2 0 2!!` PP  < 0P 4P 8 TP  X  d2S ^ Q T q XP @0H JHJ2„@ S@@  ?  0C2 0 2! !H JcXP\`„HJXT ORD2 @p`d2 @@@ <p@p@ -LDM?PP`J @O%$2S„(K迯 PPpp@2S  ? h刐 1∐ 2 匐 !   ? 210 2!dQt ”\q "RF` `0P  @L2%,`LbX `^`@P002 "S  ? L 02 2 ! ! qOn 2@S@@  ? 2<L 1 0 0! ! JC2@S   :? 0C202  匀! !2 ?@H0 T L @\` P XP `]  ? 刐 1∐ 2 匐 ! " ? 21 0  2 !d"R 2S Uw 2S  ? 2L1 2  ! !`eo PdP Q ”\ U0 P,Q3H ^/2S L@K0T 00 4 L< 8 @KP dQ ”\ ^ 0 bPPP@K JgXP @0 J[2@XP@@S  ? 0C2 0 2! ! 0 @J.XP\`„sD2 @P`rd2 @p@@ =P@P^_OP -L,M0@KPp  0 @U2 @`K0  @(P  P`0  P`, #  K0 @eϠ  @ 0  @0 @0(0 @gϠ  @h -LLM?PP@ Jd@@@ɯ 2@S `\  R? p1p2 p!p   ? 2$2R2 0 0!Q) 2@@@S  ? 0C2T02   !!J(Kp : QQ 0SS0 4 张 ̠RbbX#2@@@S  ? 2Ll1 0  0!!J SSj/0P Pu 0 @P2P@S  ? 2L1  2 !! J0SF4 ^ !^1R0Q_*0 @P2P@S  ? 2L1{2@@@S  ? LX02 2  !! J;SP 0 S#3YQ S8SRj 40 P1S  Rp*0 @P2P@S  ? 2`N1  2  !!\  SZ4 0 R !QA: Q*0 @P2P@SK  ? 2xN1o/P0`QI:ba 00Qj^[ 0 @P2P@S  ? 2N10 @0fl @쀖,``@ 0 @2S  ? 2L1 0 0!@ @`@"@%@@@9`i@` 0R9`  ? 2 L1 2  ! !!PS U\h: a R: cb0 00QjS2Ѐ: K@@܄K 2 ^  + 000 "@@`  !l!4 ,Q @쐖0P PP@ `4`0``2S  ? 0C21\* 0 \Q: ` Q:c0i –QnЀK@ ԅK@0 2 ^ + 0@` 0 @P2P@So  ? 2L1S P \*00 @P2P@S  ? 2L1t p-L$M@<KP 8P4"K$<`P`!Kp -LM 0K@K -L@ $P"d1   ^ 0222@2D2H2L2<22 0-L@Pp |Q4pPU,Q 82S dPU7PU  0PhP dP Pt |PhPh -LM?PP@@J(K@p/8 <0 P@Qw``@2SB  J? (A2∠ B  2匠 !   ? BJ0A2@ 2 @!"R@l0S@ (@T= 4B 0 @@4—\] 0 @Q `@T 2@S@@  ? 0L0l>02"<: ! !8 +0 0 0l 00K(@4/@P @ \043/4— 0 @@TW 4\@4/@PF40 @8Po2 S@}  >? 02 匠 !   ? 2102 !2`S4b``@  ? 2L1 0 0! !40 @< `P@ 84— 0 @NOO0  @  2@@@S  ? 2LL1 0 0! !8@@Jy8 @0 @@Jj2@@@S  ? 2 L1 2  ! !8@  @@J?0 @@2@@S  ? 2\N1\02  @! !8 @@J0 @@2@@S  ? 2L1e@@x i>PP@P@@P >pp@p0 @`@@ >`@` -LEM<`K?P0 @P p @J< (K@8࿟ K P@`TM XV ˜\$ Z 0#SS @AECP@@JNOOS" "S ;S @ ! $2S Al00SN @P9 0  @BS SS@): $2S 0 @@@J@P S$ $S `S @0 @@J PQ 0 @@@J0 @@@Jf#@@BPP00 0(1 (1  82R\  @\        "! 0 @ C 1 T$` RO @N PW!P@@H @D @@HK@@ X03/P!02= @|=5",! $\((%(h K@`P d@ h @\ @P" 0 @ @@JHI@@,W9PP@P @!@@JB(E/KE/K x | \0| K3/0P 0 @@@J @| 0Kll xxt  80 <@ 4P 00 l @P Qn 0PdP7 @Ø*: l0 @ @@J P@ 4 뜠 @41@Z@T   @0 @@@@@0 ᨠP@6 @eϠ  @\0 43/0  @ @@Jk@@t&S:pp@pd@l 0Ph/  ld0P6 @&J@ 3 @ @@J:5 @Cl0 @@ @@J'p5 @J@ l0 @ @@J, K@P"@D @ \@44/P @@$N:``@` \043/0  @@@J 0 @@l@To 0 Pd3L4 @eO@  @0 @ @@J 041 Pp@41,3 @e  @0 @ @@J P@h+dP3 @gϠ  @ P@t p2 @gϠ  @d@  P@  `0@@V@T   @o@p P @(T m@ P @(T,@2BS@@@   ? `2`  2`!` ! ? L2@@2A 2@2 @@ !!@2B@S@@  ? 2L1 0 0!!40 @\@ 4 4/@Pw `Rh4! 41?:[Ġ절0K/ⴠ  @@@,A@|0 @  @\4 @"R;P  0 &P00H  ` Pw 0 @2@@@S  ? 2`@`i 1b 2 ``@! !@㐐@@49/2S  kd? 1`∐ 2``匐 ! " ? 2``Bk 1b@ b0"@!0:@ ‡A.0 4`i@4IP`  @0 @H@P2P0`b P0@ @.@@@TɞTɎ2‡ S  ? 2<L1 0  0! ! 0043/P( `` ` Q  |Q0 @#P)PɃ0 @@2 @@S"  ? 2@21 2  ! !0 @@2@@S  ? 0C21S 0 @`b@DH 0D"H2`@@1?" @b `f!Q  H—.*NCH"4Ɏ2S{L02Xtʜ @@@@ #'m` Xh KX K K0l` $9/`2Sr  ? |刐 1∐ 2 匐 !   ? 222 0"! QGPDV7 Xʬ`PP P"P 2S  ? 0C20 2 ! !Q0 l0`$L–\Y8 P4 PP2S  ? 0C2Ϡ02" !!Q0#l0$ H Q6 O"D Q5 40DQ $Q6 K Q' D Q Y4 0DQhH Q (40HQ 4Q $QD Q 40DQvs)0D Q 4X0DQhe40HQ  H QrZW#D Q $40DQdLI4X0HQ !XH QV>; -L h p-L M*: ``@0S @P@@T@@@@PPP@ lFile name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vdec/vdec.cs32ChnID >= 0 && s32ChnID < MAX_VDEC_CHNVDEC poll vechn %d not created! 0buffer opt error,buffer len %d: data len %d: warp buffer opt error,buffer len %d: data len %d: chan %d jpeg or mjpeg is not support set param! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:4288 [Info]:vdec channel %d cfg error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3919 [Info]:get stat error for chn %d been reset or destroyed and create again %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:4054 [Info]:seting prctl param,can't reset chn %d sys has not been ready yet channel:%d has not stopped yet vdec channel %d cann't recuit the video buffer! cann't stop channel %d yet Error! Length of buffer mus"): t be multiples of word (32-bit)!cann't start channel %d again when reset this channel! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:538 [Info]:stream error and the format error !%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:565 [Info]:image stride/width/height error: %d %d %d trying to stop chn %d 0 chn %d stoped [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1858 [Info]:release packet error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1281 [Info]:chn: %d release mod %d error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1297 [Info]:busylist empty [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1314 [Info]:chn: %d release img %#x can't find release firmware image fail!: %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1357 [Info]:chn %d FramesInSending %d is error u32TotalFramesInVdec: %d %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3453 [Info]:chn:%d have no userdata! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3466 [Info]:chn:%d destroyed when getting data [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3476 [Info]:chn:%d read cb error when getting data [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3483 [Info]:chn:%d read cb error when getting data [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3538 [Info]:chn:%d destroyed [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3547 [Info]:chn:%d read cb error when getting data [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3554 [Info]:chn:%d read cb error when getting data [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3387 [Info]:chn:%d usr release poolid is modified %d %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3410 [Info]:chn:%d usr release can't find image in list [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3205 [Info]:chn:%d destroye#<:d total framenum:%d usr num:%d,busynum:%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3303 [Info]:chn:%d destroyed [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3318 [Info]:chn:%d getimage timeout to alloc %x [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1582 [Info]:trying to alloc %d Bytes in VDH %s[Func]:%s [Line]:%d [Info]:valg alloc mmz buffer failed! valg alloc mmp buffer failed! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1591 [Info]:cannot alloc %d Bytes in VDH [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1658 [Info]:chn: %d Read CB error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1665 [Info]:chn: %d Read CB1 error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1696 [Info]:chn: %d PTS index error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1706 [Info]:chn: %d PTS index data is not coherence with stream data virtaddr:%x,rh:%x,wt:%x,rh:%d,rt:%d,wh:%d,wt:%d,len:%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1727 [Info]:chn: %d read buffer error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1734 [Info]:chn: %d read buffer1 error virtaddr:%x,rh:%x,wt:%x,rh:%d,rt:%d,wh:%d,wt:%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1768 [Info]:chn: %d Read frame CB error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1775 [Info]:chn: %d Read frame CB error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1802 [Info]:chn: %d unknow opt type [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3653 [Info]:seting prctl param,can't destoy chn %d trying to destroy chan: %d %d 0 firmware chnl:%d has not stopped yet trying to destroy chan: %d %d 1 chnl:%d has not stopped yet HI_NULL != pVdecChn->stFirmWareFunc.pfnExit-----------------------before VDEC_CID_DESTROY_CHAN trying to destroy chan: %d %d 2 HI_SUCCESS == s32Rettrying to destro$&: y chan: %d %d 3 can't down sem in destroy chan: %d %d chan: %d %d is destroyed [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2303 [Info]:seting prctl param,can't create chn %d mod %d unexist [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2318 [Info]:chn:%d !sys module is not ready! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2326 [Info]:chn:%d unsupport stAttr! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2338 [Info]:chn:%d had been created! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2414 [Info]:firmware cant' open! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2443 [Info]:chn%d:not enough buffer when alloc streambuffer! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2456 [Info]:vdec channel %d get firmware memsize error can't get mmz name Vdec%d_%sCtx[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2491 [Info]:chn%d:not enough buffer when alloc ChanMemCtx buffer! Scd[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2505 [Info]:chn%d:not enough buffer when alloc ChanMemScd buffer! Vdh[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2521 [Info]:chn%d:not enough buffer when alloc ChanMemVdh buffer! Jpgd[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2557 [Info]:valg alloc mmz buffer size(%d+%d) failed! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2568 [Info]:valg alloc mmz buffer size(%d+%d) failed! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2587 [Info]:CMPI_Remap_Nocache mmz buffer size(%d) failed! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2598 [Info]:CMPI_Remap_Nocache mmz buffer size(%d) failed! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2612 [Info]:chn%d:can't create decoder channel! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2625 [Info]:vdec chn %d cfg vfmw error StreamBuf[File]:/home/pub/platform_h3/mpp/cod%3:e/mkp/vdec/vdec.c [Line]:2670 [Info]:chn%d:not enough buffer when alloc stream buffer! UsrBuf[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2685 [Info]:chn%d:not enough buffer when alloc stream buffer! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2699 [Info]:chn%d:not enough buffer when alloc stream node! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2709 [Info]:chn%d:not enough buffer when alloc pts node! !!s32ChnID:%d,%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2730 [Info]:chn%d:can't start channel! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:4391 [Info]: %d should be StopRecvStream before SetPrtclParam. [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:4455 [Info]: %d set prtcl param can't destroy channel [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:4463 [Info]: %d set prtcl param within other create channel [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:4482 [Info]: %d set prtcl param can't create channel [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:987 [Info]:read image error for chn %d been reset or destroyed and create again %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1001 [Info]:read no image. %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1009 [Info]:chn %d been reset or destroyed and create again %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1020 [Info]:stream error and the format error !%d busy addr size: <%x %x> <%x %x> chn: %d usr addr size: <%x %x> <%x %x> chn: %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1105 [Info]:chn %d been reset or destroyed and create again %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1128 [Info]:chn %d can't add block for %x [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1141 [Info]:chn %d FrameInfoBuf Error,copy instread VDEC_BUF_QueryFree failed. Free %d, Busy %d, User %d. [Fil&0:e]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1254 [Info]:chn %d FramesInSending %d is error event genearte: %d %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1382 [Info]: EVNT_DISP_EREA at Event %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1402 [Info]: EVNT_FRMRATE_CHANGE at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1407 [Info]: EVNT_SCAN_CHANGE at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1419 [Info]: EVNT_USRDAT at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1424 [Info]: EVNT_ASPR_CHANGE at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1427 [Info]:VDM ERROR at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1432 [Info]:Video format unsuport at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1439 [Info]:SE Error at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1447 [Info]:Stream error rate %d larger than set %d at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1452 [Info]:Stream out rate larger than thresh at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1455 [Info]: EVNT_FIND_IFRAME at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1460 [Info]:Stream error ,can't decorder at Event chn %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1469 [Info]:chn %d pic size (wxh): %dx%d larger than set %dx%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1482 [Info]:chn %d pic ref num:%d larger than set %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1491 [Info]:chn %d slice num %d is not enough,part of image will be discarded. [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1500 [Info]:chn %d PPS num %d is not enough, some images will be discarded [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.'%: c [Line]:1509 [Info]:chn %d SPS num %d is not enough, some sequences will be discarded [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1517 [Info]:chn %d find I frame error. [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:1531 [Info]:chn %d unknow vfmw info type: %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:913 [Info]:chn %d Image Can't Link to VB for %x, froce to release [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:919 [Info]:chn %d froce release fail [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:934 [Info]:chn %d FramesInSending %d is error [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2816 [Info]:chn %d can't not lock sem! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2823 [Info]:chn %d not start to receive stream! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2829 [Info]:chn %d stream len can't be zero! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2835 [Info]:chn %d stream len larger than Bufsize %d! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2843 [Info]:chn %d stream len %d larger than MaxFrameSize %d! sending %d %d... [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2853 [Info]:chn%d buff can't access! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2863 [Info]:chn:%d file mode is no block and buff full! pVdecChn->u32TotalFramesInVdec:%d %d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2886 [Info]:chnl %d is destroyed [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2892 [Info]:chnl %d is stop to recv stream[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2898 [Info]:chn:%d wake up error datalen: %d usrlen:%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2908 [Info]:chn%d:too much frames in vdec! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2920 [Info]:chn%d:copy_from_user err (pu8Addr : 0x%x,u32Len : %d)! HI_NULL!(%: =pFree[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2945 [Info]:chn%d:copy_from_user err (pu8Addr : 0x%x,u32Len : %d)! sending finished %d Bytes %d Bytes in Buffer [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2878 [Info]:chn%d is stop! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:2996 [Info]:chn %d can't not lock sem! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3003 [Info]:chn %d not start to receive stream! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3009 [Info]:chn %d stream len can't be zero! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3015 [Info]:chn %d stream len larger than Bufsize %d! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3023 [Info]:chn %d stream len larger than MaxFrameSize %d! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3032 [Info]:chn%d buff can't access! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3048 [Info]:chn%d is stop! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3055 [Info]:chn:%d timeout! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3063 [Info]:chnl %d is destroyed [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3069 [Info]:chnl %d is stop to recv stream[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3075 [Info]:chn:%d wake up error datalen: %d usrlen:%d [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3085 [Info]:chn%d:too much frames in vdec! [File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3097 [Info]:chn%d:copy_from_user err (pu8Addr : 0x%x,u32Len : %d)! HI_NULL != pFree[File]:/home/pub/platform_h3/mpp/code/mkp/vdec/vdec.c [Line]:3120 [Info]:chn%d:copy_from_user err (pu8Addr : 0x%x,u32Len : %d)! vdec<6>unload vdec.ko ....OK %svdec register failed error<6>load vdec.ko ....OK ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/co)0:de/mkp/vdec/vdec_ext.cg_astModules[HI_ID_H264D].pstExportFuncs != HI_NULLVDEC initialize again!VDEC is busy now!HI_ID_VDECgVdecLockVDEC get spin rec error! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vdec/vdec_buf.cpNode->u32Magic == MAGICpValuemalloc VEN_BUF node failed! chn %d pic size is out of range. chn %d video RefFrameNum %d is not support,need between [0,16] chn %d video RefFrameNum %d is not support,need between [1,16] chn %d vedio enType is not support! chn %d Priority %d is not support chn %d Buffer size %d is not engough chn %d Buffer Size %d is larger than max size chn %d video mode is not support chn %d video mode %d is not support chn %d video SupportBFrame %d is not support version=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=g_u32VdecMiniStreamBufMode:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 $hi3521_vdecGNU `^>$+֭TA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.rodata.str1.4.modinfo*3:.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 HH)<% 4H8T4 |C8K2tOZ@KgLc t sLo p }L$y M$M|MpM/'NwO8Tp) }C P"',@164;8@HFPLXR`Xh^xdjpv|$,8DL$,4<DL TTx"(.4:@F+&: LR8X`^ldxjpv|x  (4@LXdpD8P`X hpx$*06<DBtH|NTZ`gntw~dпD t  p    H   t   L       L " :AHOHVP]tdk t""rhy <t %$%t,&0&tL+P+(t ..tt4x4Xt$>,>t>>xtP=t|tW@^Ae???@\AB\B`Hh Wtfu ,@Ph  t  )  8 G V e t tt     ,,@ X  xtx <dKlKt8 KK"Kt| |D   'K1L6LL@LFL;LLL,Ltt  / V  g  x 1 B) t h l(  tdKt  t@ @.*:  D, t& t2 tL8M0lMt@DtMtt"Mt0> 0L DZ Xh lv tL`,DOTNMMN;O6N"|N'N1NtMt tl l#  ! t   t $%  .h (@ l  P( |P2 B T{4O ldd w  0  t  0 & h@  XT 6 $D U 0h #r {    $ ('d    ? T6LDED_<n~N$t {!t 1t>NMHg|D@tl\H L*'X:,"pL/?:Uf8yX<n `Xd-,H=PLg<t8l{THd0&h  'x?h}LeXlw P+,>x  1>K(l^f |h|00p>2=Px4 ^jH} @D,]@dT Hp&0 ? Kxf4s LL0 !p2,$a.LANCHOR0.LC0.LC1.LC2.LC3.LC4.LC5.LC9.LC6.LC7.LC8.LC10.LC11.LC12.LC13.LC14.LC15.LC16.LC20.LC19.LC22.LC21.LANCHOR2.LC17.LC18.LC23.LC24.LC25.LC26.LC27.LC28.LC29.LC30.LC31.LC32.LC55.LC56.LC57.LC58.LC59.LC60.LC61.LC62.LC63.LC64.LC33.LC34.LC35.LC36.LC37.LC38.LC39.LC40.LC42.LC41.LC43.LC44.LC45.LC46.LC47.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC65.LC68.LC66.LC67.LC69.LC70.LC71.LC72.LC73.LC74.LC75.LC76.LC77.LC78.LC81.LC79.LC80.LC82.LC84.LC83.LC85.LC86.LC87.LC88.LC89.LC90.LC91.LC93.LC94.LC95.LC96.LC97.LC90: 8.LC99.LC100.LC101.LC92$d.LC102.LC103.LANCHOR1.LC104.LC105.LC106.LC107.LC108.LC109.LC110.LC111.LC112.LC113.LC114.LC118.LC119.LC115.LC117.LC116.LC120.LC121.LC122.LC124.LC123user_linear_space_valid.LC126.LC125.LC128.LC127.LC132.LC130.LC131.LC129.LC136.LC133.LC134.LC135.LC137.LC138.LC139.LANCHOR3.LC141.LC140.LC142.LC148.LC149.LC146.LC143.LC145.LC144.LC147.LC151.LC150.LC152.LC153.LC154.LC155.LC157.LC158.LC160.LC159.LC156.LC163.LC161.LC164.LC162.LC166.LC167.LC165.LC168.LC169.LC170.LC171.LC172.LC173.LC174.LC175.LC177.LC178.LC179.LC181.LC176.LC180.LC192.LC182.LC187.LC191.LC183.LC185.LC189.LC190.LC186.LC188.LC184.LC194.LC196.LC199.LC200.LC202.LC204.LC203.LC193.LC195.LC197.LC198.LC201.LC208.LC206.LC205.LC209.LC207.LC211.LC210.LC212.LC213.LC214.LC215.LC216.LC217.LC226.LC228.LC229.LC221.LC223.LC230.LC231.LC225.LC222.LC224.LC227.LC219.LC220.LC218.LC234.LC232.LC233.LC235.LC237.LC238.LC239.LC236.LC244.LC245.LC247.LC248.LC243.LC242.LC246.LC241.LC250.LC240.LC249.LC251.LC270.LC259.LC254.LC256.LC265.LC268.LC257.LC269.LC264.LC261.LC260.LC255.LC258.LC252.LC253.LC262.LC266.LC267.LC263.LC271.LC273.LC272.LC279.LC282.LC286.LC287.LC290.LC291.LC278.LC283.LC274.LC275.LC276.LC277.LC280.LC281.LC285.LC284.LC289.LC288.LC303.LC304.LC299.LC300.LC296.LC292.LC293.LC294.LC295.LC297.LC302.LC298.LC301.LC306.LC305fmt.35678__func__.35562__func__.32057__func__.35234__func__.34645__func__.34943__func__.32040__func__.31937__func__.31187__func__.33994__func__.33851__func__.33395__func__.33614__func__.27566__func__.31610__func__.34353__func__.32334__func__.27604__func__.30542__func__.30249__func__.32725__func__.33057cur.30534prevsec.30535vdec_openvdec_closeVDEC_QueryStateVDEC_NotifyVDEC_GetVerMagicVDEC_ModExitVDEC_ModInitvdec_mmapvdec_ioctlVdecIoctlvdec_poll__func__.29992__param_str_g_u32VdecMiniStreamBufMode__1:mod_version577__mod_license576__mod_author575__mod_g_u32VdecMiniStreamBufModetype523vdec_fopss_stVdecModules_stExportFuncs__param_g_u32VdecMiniStreamBufModes_stVdecUserRefg_stVdecumapd__key.29950__key.29951__key.29952__func__.9416__func__.9380__func__.9344__func__.9521__func__.9542__mod_srcversion23__module_depends__mod_vermagic5VDEC_ReleaseUserDataVDEC_GenDefaultPrtclParamVdecGetStatgStdType2PAYLOADVDEC_SendStreamTimeOutVDECSDK_InitVDEC_FreeVDEC_SetTimeOutVDEC_MemFreeVDEC_GetImageTimeOutVDEC_SetUSRTimeOutgstYNNameVDEC_BUF_QueryUserparam_ops_uintVdecQueryDatagstOutputModeNameVDEC_BUF_ISUserEmptyVDEC_GetChnParamVDEC_ReleaseStreamCMPI_RegisterModVDEC_ReleaseImageVDEC_DRV_CHIPID_Update__this_moduleVDEC_BUF_PutUserVDEC_BUF_QueryBusyVDEC_PollsnprintfgNalTypeEOPICVDEC_BUF_AllocFreeNode__arm_ioremapVdecSndChnFrmVDEC_GetAttrVDEC_SetSkipRefParamfinish_wait__iounmapVdecStopRecvStreamupVDEC_GetImageBufferVDEC_SetDisplayFrameNumVDEC_BUF_ResetVDEC_ReleaseFirmWareImagecleanup_moduleprepare_to_waitmemcpyCMPI_MmzMallocCMPI_UserCopyremap_pfn_rangeVDEC_GetUserDatakfreeVDEC_BUF_PutBusyVB_PutBlkdo_gettimeofdayVDEC_DRV_CHIPID_CheckVDEC_MemInit__wake_upVDEC_SendStreamVdecProcShowCMPI_RemoveProcVDEC_GetFirmWareUserDataVDEC_TranFMIDToChnIDVDEC_BUF_PutFreeg_stVdecLockobey_minCRinit_moduleVDEC_MemAllocVDEC_SetStreamTimeOutVB_UserSubVDEC_SetChnPrevModeCMPI_CreateProcgstAttrEnTypeNameVDEC_GetChnPrevModeVDEC_GenChanCfgVdecInfoChnDecErrscheduleschedule_timeoutVDEC_CheckChnParamg_astModulesVDEC_GetDisplayFrameNummsecs_to_jiffiesbFirmWareOpenVDEC_BUF_FreeCountVDEC_ReadStreamVDEC_TranslateTypeVdecGetChnFrmBufVDEC_DRV_IsFieldSupportVDEC_BUF_GetBusyVDEC_SetRxBlockVDEC_BUF_BusyCountVDEC_DRV_CheckVdecCapsbTimerRuningg_VdecLockRecVDEC_CreategstDecModeNameVdecGetChnStrmPackVDEC_SetTxBlockVDEC_BUF_GetFreehi_user_notify_vdec_eventVDEC_GetPrtclParamVDEC_TimerISRadd_timerVDEC_GetPerfInfoVALG_CB_Write_Pack_UserVDEC_DestroyVDEC_CheckJp2 :egPrtclParamVdecGetChnJpgdBufstrncpyVDEC_GenVfmwCfgParamCMPI_UnRegisterModpanicVDEC_SetChnParamVDEC_BUF_Releasememcmpprintkmemset__memzeroVDEC_GenDefaultParamHI_LOG__init_waitqueue_headVB_CreatePoolExtCMPI_MmzFreeVDECSDK_ExitVALG_CB_Write_PackjiffiesVDECFirmWare_CheckCapVDEC_CheckH264PrtclParamVDEC_ModuleExitProc__get_user_1VDEC_BUF_ISFreeEmptyVDEC_BUF_QueryFreeinit_timer_keyVDEC_GetFirmWareImagehil_mmb_flush_dcache_byaddrVDEC_PackFrameInfoseq_printfdown_interruptibleVDEC_ResetChng_stVdecChnVDEC_SetPicRxBlockgstVdecChnTimerVdecPutChnStrmPackVDEC_GetImageg_stVdecFuncInfoVDEC_BUF_GetUserVDEC_GetUserDataTimeOutautoremove_wake_functionVDEC_BUF_UserCountVDEC_EventProcessdel_timers_s32VdecStateg_stVdecSemg_u32VdecMiniStreamBufModeg_stVdecProcCMPI_UnRegisterDeviceVdecStartRecvStream__copy_from_userVDEC_SetPrtclParamVDEC_BUF_InitVDEC_BUF_ISBusyEmpty__kmallocVB_DestroyPoolVB_AddBlkToPoolCMPI_RegisterDeviceg_u32VdecVersionVDEC_BUF_CleanUp +,+,+,H+L,+, +$,t+x,+,(+,,l+p,+,+,x+1,1+,x+ + , , x+ , +x+ , + $x,+0+4,8,<+@,D, H+P,T+\,`+h,l+t,x+,+,+,x+,,+,++,,+,yD+H,`+d,+,x+ +, ,+! ,! +" +# ," ,# +$$ ,$( +%0 ,%4 +&< ,&@ +'H ,'L +(T ,(X +d xh , y  y , +)0 +4 ,)8 ,< +*@ ,*D ++H +,L ,+P ,,X +-\ +.` ,-d ,.p +/x ,/| +0 ,0 3: +1 ,1 + x , C  +2 ,2 x  y4 +3< ,3p x +3 ,3 x + , x +4 + ,4 , +5 ,5 +6 +7 ,6 ,7 +8 +9 ,8 ,9, +:0 +4 ,:8 ,D xL +;P ,;d l y  y +< ,< x +<(,<\xh+=l,=tx|+>+,>,+?,?+@+A,@,A+B,B+C,C+D,D+E,E+F,F+G,G+,xyDhy+H,Hx+H,H8xD+IH,IL+JPxX+K\+`,Kd,h+Ll,Lp,Jt+M|,M+N,N+O,O+P,P+Q,Q+R,R+S,S+T,T+,x y<+UD,Ux+V,V+Wx+X+,X,+Y,Y,W+Z,Z+[,[+\,\+],]+^,^+_ ,_+`,`+a$,a(+b0,b4+c<,cDxP+T,ly+d,dx+e+,e,+f,f+g,g+h,h+i,i+j,j+k,k,x<y+l,lx0C<JHx+m,mxD+pH,pPgd+h,|y+q,qg+,H+rL,r+s,sg+t,tg8+<,+w,wg+,+x,xgy$+y(,y0gL+zP,zXgx+|,(+{,,{4gP+|T,|\gx+}|,}g+~,~g+,g`+d4:,pg+,g+,g+,g+,g@+D,\+`,hgpy+,g+,@+D,Lg+,+,g+,X+\,dg+,yL+rP,r+,g+,gL qd +h ,l g + , g + ,!+!,!g!+!,!g!+!,!g!+!,!g!+!,"g"+", "gX"+\","""""+r",r"S"+r",r #S#+r#,rP#S\#+r`#,r#S#+#,$+$,$g$+$+%,%,%+%,%_ %h%+l%,&+&+ &,&,&+ &,(&_,&X&+\&,&+&,P'+T',4)|))+),)g<*+D*,L*gd***+*,*g*+*,*g*+*,*g*++ +,+g0+D+L++++,+>+y,+ ,,h,\,\-+-,-:t-\--+-,-g-+-,-g .D.+L.,\.yh.+l.,.\0/\h/+l/,/\/$0+,0,0\00y1+1,L1\1\2+r2,r2+2,X3\33+r3,r3+3,3g3+4,T4\t44+4,4y4+4,$5\5\5+?5,?6+6,h6\66y7+7,L7\7\7+7,P8\8/8%8H8/8%8889+9,9gD9+L9,P9gp9e99+9,9g9+9,9g:y,:<:e:e:5: +:,D;\t;;;+;,;g;+;,<\8<H<+L<,P<g`<+d<,<\<<+<,=g=+ =+=,=, =+$=,,=_4=+8=,=\=+==+=+=,=,=,=_=+=,=+=g>+>+>, >,>, >_$>(>L>ex>+|>+>,>,>+>,>_>>el?+p?,|?g?+?,?g?+?,?y@+ @,@g@0@)@@+D@,H@gX@@+@,@+@,@\`A\A+A,A\4B+r8B,rB+B,BgB+B,C\xC)C+C,C\,>gȹu+?,?g+@,@ g(+A,,A4gTSp+Bt,B|g+C,CȺ+̺,к+Ժ,ܺ+?,?<\\8\|+,ļ\<\`+md,mh+l,Vؽ\0+r4,rd\|\$\\5\X\\\()H+DL,DTg|\4+E<,ELgX+F`,Fhg|+,g+ ,,g@\+,gee+,g+,g+,(g<Xle,+4,Hy+K,Kg,+L0,L8gy,CH+ML,MTg\+,< XCt+r,rX+N,N,g4h+l,\0\`+l,\R@XX+\,x \8:: \d+p,\@+OD,OLgP+mT,mCC+P,Pg+?,?Td+Qh,Qg+R,Rg+S,Sg+T,T$+U(,U,g4D+VT,Vdt+Wx,W|g+X,Xg+Y,Yg+Z,Z +[8,[@+D+H,L,X+\\,\d_h+,y+K,K g|+L,LgAC,yC+_,_g4*+, =<D+rH,rX+`,`g+a,agCD+H,\ \<+H,\RX4+8,T \\@+L,\+O ,O(g,+m0,m`+?d,?C+b,bg0+c4,cHgPx+d|,dg+e,e+f,fg+g,g+h,hg@+iH,iPgXt+jx,j|g+k,k+l,l++,,+m,m_8+<,d+h,+{,{x!+, +, +,98P|*N[68Yh`t|QI~"4;@HFTtz|$TP\ +,YY+B,B+} ,}$0+?4,?\+?`,?+++,,,+,_+?,?+,+,+{ +B,{,B(e0+4;:,8+M<+L,MT,`+h,+{,{hh h,+}4,}D+H,\t`+md,mp+Ux,UV+,g+,g+,g+++,,,+,_++ ,$,0+4,<_@++,,+,_8//++,,+,_++,,+,_d###H+L+P,T,`+d,l_p+t+x,|,+,_++,,+,_L+P,Tg,+0,+,g+, g\+`,hg+,g+,g,+0,8gT+X,\gx+|,g+,g+,g +,,$^(+,,0c8+,+e ,(+{0,{4e@+D+H,L,T dx+|,g+++,,+7+,,+,c   $,08l txk|W2< :extdrvA9Y8Y8Ytw2868.ko9Y'X8Y:ELF(#4( -L -L -L -L -L``@pp$0S(P@W0@  0  P$P0 0-L@P9$,8PpPp0Ps pPp P T9 P P P@ P P P PP@ 0@0PpP{p Pr {pPspP s Po Pk Pg@ Pc P_ P[ PW@ PS00@@V!0 -L@| Q@PU U 8 4 0  ,  (  $ @          @        @      @ . ' ( ) * +  @. ' ( ) * + @ > 7 8 9 : ; | @x> t7 p8 l9 h: d; `@ \A@ X@| Q@@ PEpEEx wpEz=`E y7 3v` . * & @"     P  uP  @ NUA @ -LDMq@@ Q | 0x  ?  03^(K @P([PL@ K ?   03QdpK P00@d $ R*``Q(P2` =?c\`   03^ P ?  03\gXK @Pp @X[$0QjP0(P W[Q"V [sP0 W[Q"U [gP0 W[Q"T [~[P0 W[QS [OW[S [ 0sHz 0 ?   03^XPK P @X[$ QP0(` ?0 03P P} H ? 0  003S4K P0AP@@@1@@&4$0Q*&1@@4 0[@( ?  03Q4PK P4 @0(PPP000  PP PP000 0 =?  03^ P ? 0  003S<K `P8@P<P@T(P T T*@ ` @ @  0 ?   03Qg,K P\, ? 03\PDK @PJ00@D $RD*@\A(PN@0[  M ?  03Q&LK @P%00@L $R*HQ(P)H 0ƒ| 'YXK T4KOLKJDKE,K@<K;dK 6(K1 @`O"L @`C@@ ` @ J  @@ W[S [ <0LW[S [ ;0Ls@ @ W[U [ >0L@ P0@@ W[T [ ?0Ls@ P0;@ W[V [ :0L @P0@ @{`U w@ sE o@@W [XSK5W[ 2 rPP0TK*W[ GP0UKW0[">P0VK -L@ -LM@@@,0@S @ 8 $A\@8 P8 0  @0`w@P@uQ @? ` a  @  @ @P,4 p`w vpzd    q  |` @ d       @ 0sPAU4C @ R   @  @ s Q     @    @ C K @ g h2 eT fv @  4P`P `P P   Ur` ß P0Us`0` P0P   @    @   2 T v       @    @    p  s { | ~  @0$@QhPTaPU P,a ?0   PUP`"2 T v      PU @8(K(08GNUݭTӖHtw2865_set_audio_sampleratetw2865_ioctlchipsnormlicense=GPLparmtype=chips:uintparmtype=norm:uintdepends=vermagic=3.0.8 mod_unload ARMv7 tw2865_set_audio_formattw2865_set_audio_sampleratenot support this samplerate:%d func(%s) line(%d):tw2865 not support this samplerate:%d tw2865 0x%x set to PAL mode ok! tw2865 0x%x set to NTSC mode ok! tw2865 not support this video norm : %d module param norm must be PAL(%d) or NTSC(%d) module param chip invalid value:%d ERROR: could not register tw2865 devices warning: tw2865 0x%x i2c_read err, val:0x%x!!! tw2865 driver init successful! tw2865 0x%x set to 2d1 mode ok now not support this work mode:%d invalid video mode %d %s %s %d /home/pub/platform_h3/mpp/extdrv/hi3521/tw2868/tw2868.cinvalid chip id %d invalid audio_format:%d invalid tw2865 ioctl cmd tw2868dev,$$4$,PR xPpp Ppp 332222 k@&e5rA:tw2868GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1A.aeabi$7-A A ,.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4< 'X)p% ,+8`4 D+C$Z$V D/ d <l\`u42  d/0 /0 $ /!!r"pr"/"/R 6!4VHk`+d,$( ,04+,d++,, d4j+,dj+,dD+ H, Ld|n]++ ,+ dH nT +X , m n + ,T n` +d , m n4 +8 ,@ +,D +-H ,,L ,-T dp +,t +-x ,,| ,- d n + ,h m n + ,`npcn+,<nH+L,eeeeee$e8e+.,.d+/,/d(+0,,00d+1,1d+2,2d8 +,S+,,+#4,#8dX+$\,$hdtf+%,%d+&,&d$4DH+L,| 0@P`| ,<L\l| ,<p(8HXhx(8HXhx+,,@L`l$<+'@,'DdT X \ ]c T  T   W^RU[Z         *(;<M$ 8P U _$ d<z  ` `  ( T  MTM| |    H `   M8M    , 4 &  8  K  M]  M$h$,M MM*M4 74  H=! MM M Xdt$|(`tT T `&0:8O]yP@tw2868.c$atw2865_module_exit.LANCHOR0tw2865_byte_readtw2865_byte_write$d.LC0.LANCHOR1.LC1tw2865_set_video_norm.LC3.LC4.LC2tw2865_module_init.LC5.LC6.LC7.LC8.LC9.LC17.LC13.LC14.LC12.LC15.LC16.LC10.LC11__func__.19199__func__.19260__param_str_chips__param_str_norm__mod_license1052__mod_chipstype991__mod_normtype990__ksymtab_tw2865_set_audio_format__kstrtab_tw2865_set_audio_format__kstrtab_tw2865_set_audio_sampleratetw2865_devtw2865_fopschipsnorm__param_chips__param_norm__ksymtab_tw2865_set_audio_sampleratetw2868.mod.c__module_depends__mod_vermagic5tw2865_openmisc_deregisterparam_ops_uinttw2865_closegpio_i2c_read__this_moduleAudioSetup16Ktw2865_i2c_addrcleanup_moduleinit_moduleAudioSetup8Ktw2865_set_audio_formattw2865_ioctlInitAudioSetuptbl_pal_tw2865_8KHztbl_ntsc_tw2865_8KHzAudioSetup48Ktw2865_set_audio_samplerateprintk__memzeromisc_registerAudioSetup44_1Ktbl_ntsc_tw2865_commontbl_pal_tw2865_common__const_udelaygpio_i2c_writeAudioSetup32K__copy_to_user__copy_from_user0 hi_ir.ko9Y'X8Yv9 ELF(T4( -L 0-L0>OPOP@@  Q# 0>ORL@āȁȁ ȁȁȁ( 4 0@ 0-LM@@@P0S$ R K0Q  0 3/@  -L@0S@@@$ .O@/2@ -L00@ $$ -L@@@0S(@@0_PE/2U"pp@$`d`d `P P$PO  TM@/2@ -LB1P88           L|,        4                @@@Cc^ 04$ R00@ @@4Q @ @4\ @@S40^0@ @S@s01P @ @s01^ @CQ@s01P @P PP@qr P } @yPP00@qr ^!g @cPP@qr P Q @MPP00@qr ^!; @7 ? 0 3R@@@ @0S% @! @@@@@ P  Pz00@qr ^  @@ @  -L$M 0m@@@?`@LPKpQX$0 R$;O  0D < H @   , $0\  0 O(K Z P}8K?p P` @$0 PQ R( ` 03\$ P @@ $ 4 -L@@@0S0>O,  @@@RO0R, @@@R>0>O0, 7, 8 Q@ .O000@P TUY P^O Q @0A40C (0SJQPP@0A0>O$ ,Q=Q $ @ ^0>O40 P @ĄS 0S C$ B @0^G S  C$P B( (0 0P 0)pp@$Pdd=b0A@$` #3,0 0>OT ( $ , 00` 0   O M @R0B40C0>O (0S O0P ( $0,0  !0P 0(  "R0B4@0C0>O$,0SR0B@40C10Q  @ @@P P^O@@@@ @@@@@@ @$@(@,@0@4@@@ (, @  @ $ @$ -L0@@ -L M@0>O @ P @ @@@@00@@@P 0@@ @@ @K<-C <-C <-C*"3e0-C <-C <-C*De0Fi,#4i0Fi:Fj= 0H0H`  0H0H`  0H0H` 0H0H`hiir_ioctlhiir_readversion=HI_VERSION=HISI_IRDA-MF @Hi3520v100R001_C_0_2_0 2011-04-29 14:05:20description=Hisilicon Infrared remoter(HIIR11) Device Driverlicense=GPLsrcversion=19305107EDE7DC1AD28B572depends=vermagic=3.0.8 mod_unload ARMv7 <7>hiir: IR_BUSY. Wait... <7>hiir: Enter hiir_select. <7>hiir: Enter hiir_release. <7>hiir: Enter hiir_open. <7>hiir: Error: device already open. <7>hiir: IR_IOC_SET_BUF -> buf_len=%d <7>hiir: IR_IOC_SET_ENABLE_KEYUP -> enable_keyup=%d <7>hiir: IR_IOC_SET_ENABLE_REPKEY -> enable_repkey=%d <7>hiir: IR_IOC_SET_REPKEY_TIMEOUTVAL -> repkey_delaytime=%d <7>hiir: Error: IR_IOC_SET_FORMAT -> invalid args=%lu <7>hiir: IR_IOC_SET_FORMAT -> codetype=%d <7>hiir: IR_IOC_SET_CODELEN -> code_len=%d <7>hiir: Error: IR_IOC_SET_FREQ -> invalid args=%lu <7>hiir: IR_IOC_SET_FREQ -> frequence=%d <7>hiir: IR_IOC_SET_LEADS -> leads_min=%d, leads_max=%d <7>hiir: IR_IOC_SET_LEADE -> leade_min=%d, leade_max=%d <7>hiir: IR_IOC_SET_SLEADE -> sleade_min=%d, sleade_max=%d <7>hiir: IR_IOC_SET_CNT0_B -> cnt0_b_min=%d, cnt0_b_max=%d <7>hiir: IR_IOC_SET_CNT1_B -> cnt1_b_min=%d, cnt1_b_max=%d %s: copy_to_user fail! <7>hiir: IR_IOC_GET_CONFIG <7>hiir: IR_IOC_ENDBG <7>hiir: Error: Inappropriate ioctl for device. cmd=%d <7>hiir: Enter hiir_  read : head=%d, tail=%d, buf_len=%d <7>hiir: Enter hiir_interrupt. <7>HIIR11 REG:################################################### <7>%.8x %.8x <7>hiir: frame error. <7>hiir: hardware overflow. <7>hiir: release key interrupt. <7>hiir: receive data interrupt. 0x%.8x-0x%.8x <7>hiir: repeart key [0x%.8x]-[0x%.8x] detective <7>hiir: logic Error: int_mask=0x%.8x, int_state=0x%.8x. <7>hiir: Exit hiir_interrupt. <6>HISI_IRDA-MF @Hi3520v100R001_C_0_2_0 2011-04-29 14:05:20 <7>hiir: Error: can't register Hi_IR<7>hiir: Error: request IRQ(%d) failed hiir: init ok. ver=%s, %s. Aug 31 201213:02:08PDatsthi_irGNUXG>YX(l""a!A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 ! )8,% +08d4 +C0KT2g c ,X q0$m $- T$xxpx/4-`q 5,+4,+,}+,l+p,x} +,+,+,}+ ,,+0,@+D,h+"l,"x+#,#}+$ ,$} <@DHLPTX\`dhlptx|+,$+*(,*,}8+<,d+h,t++x,+|}+,+,,,}+,+-,-}+,+,+.,. }+ ,<+/@,/D}L+P,l+0p,0t}+,+1,1}+,+2 ,2$}0DP+T,t+3x,3|}+,+4,4}+,$+5(,5,}T+X,`+6h,6l}|+7,7}+,+8,8}+,+,+9,9 }+:,: }0+;4,;8}D`+d+h,p,yv t\ +6d ,6h   }   + , +? ,? }   , +0 ,X +\ , + , + , +$ ,P +T , +B ,B }  + , + ,h x +| ,  + , | , wD +H ,  w + ,(+0,X+C\,C`}l+Dp,Dt}|+E,E}+F,F}+G,G}+H,H}+H,H}+H,H}+H,H}+H,H} +H,H}+I,I }(+G,,G0}8+H<,H@}H+HL,HP}X+H\,H`}h+Hl,Hp}x+H|,H}+H,H}+I,I}+J,J}+K,K}+L,L}+M,M} +,q+ ,$r+Q,Q}(+,,4~@+RD,RH}T+X,l+Sp,Sx{+T,T}+,r+U+V+W,U,V,W}0z4DsL>P`d'p!xxu    , / 9EO T` ehlu< z,e  \ x e  (e<    8   @    \    l  x eDH!H+ e  1` 7 = CX Ix O U [ a g m  s0 ey 0 P X    e  LL= e $ Dh *$ ?@ e eP[dpee# !e $ ,'0@U_fthiir.c$ahiir_writehiir_exithiir_interrupt.LANCHOR0hiir_config.LANCHOR1.LC0hiir_select.LC1$dhiir_release.LC2repkey_timeout_handlerhiir_open.LANCHOR2.LC3.LC4hiir_ioctl.LC22.LC5.LC6.LC7.LC8.LC10.LC11.LC13.LC15.LC16.LC17.LC18.LC19.LC20.LC21.LC14.LC12.LC9hiir_read.LC23.LC33.LC29.LC35.LC24.LC25.LC26.LC27.LC28.LC30.LC34.LC31.LC32hiir_init.LC36.LC37.LC38.LC39.LC40.LC41.LC42static_dev_param__func__.19273__func__.19397__mod_version557__mod_description556__mod_license555hiir_miscdevhiir_fopsrepkey_timeout_timerhiir_s_availableg_dbg_flaghiir_dev__key.19 452hiir_codedef.chi_ir.mod.c__mod_srcversion23__module_depends__mod_vermagic5free_irqmisc_deregister__this_modulefinish_waitcleanup_moduleprepare_to_wait__wake_upinit_modulescheduleboot_tvec_basesrequest_threaded_irqadd_timerprintkmisc_register__init_waitqueue_headjiffies__get_user_4__aeabi_uidivmodautoremove_wake_functiondel_timer__copy_to_user v< wdt.ko9Y'X8YW*!ELF(4( p-L0R> `CP`P@@P%r@VT@@ S! V PrVP@ S VR@Pr VR@ S Pr @ p@  QA  !p -LAQ" 00@QA   ,! Q%*A,  !00@ 0-LP/ UP9 00@@ RQ%*A6 -0@ 00@,  ! Q%*A,  !P 0@00@@ p 3P @@@00@  0-L@@@0SPP@ @ 00 !^ 0@P  !P 0Q A   !PP@@ -L@@@  0!0   !00@   Q5:A<0 ̎!P0 0 -L70HQ( (HQA L Q 70HQ3 OHQ:H Q"70HQ00@P7 PS   00@QA@  !@ @  0?(03P( P!P1  Q%*A,  !00@  P  00@QA@  !   QA !  QA !00@ -LM  ?@$ Kc" !  0  @@@ 0S PQP@̪Apo`0  Q Q 0   ! ? $K -LHD@ @Q5:A < 0 !@ 00@QA   !@ @Q5:A < 0̃!00@ @ Q @T @@@@@@0T x-LB PP@P!@@@iB P .@@@W@@@`00P HiDog: set heartbeat to 0, heartbeat will not be changed. <3>HiDog: set heartbeat range error, t = %d <3>HiDog: force heartbeat to %d <2>HiDog: Unexpected close, not stopping watchdog! <6>HiDog: Watchdog is disabled! <3>HiDog: function %s line %u failed <4>H!iDog: default_margin value must be 0HiDog: cannot register reboot notifier (err=%d) <3>HiDog: cannot register miscdev on minor=%d (err=%d) hidogwatchdog(`<Hisilicon Watchdogd<<6>Hisilicon Watchdog Timer: 0.01 initialized. default_margin=%d sec (nowayout= %d, nodeamon= %d) wdtGNUeW^ȊowA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.init.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 X)d% T84 4 C8 8Kp xT2g0c H so H yd$$ H$l ! lpl/1,`Z %+ ,,o`ooo8+<,+,+, +$,c+,k+,+,k+,k+,+,,+0,D+\H,\Lg|+,k+,+,k+,D+\H,\m,+0,Lph+l,+,f+,fs$p+,+,x+|,a+,+,$d,`[h$+(,h+l,+,+,+, c(j,Z0+4,@+D,L^T^\`] +$,4+%8+&@,&D,%Lkd]x+%|+&,%,&k^+,+','k+,e+(,(kl$+)(,),k4h<+@,H+*P,*Xk+,+,+++,,+,,nct  t $t,48Td\hqpb_     #6 @HT Y@ ^p c q v {! d\   \     $(?TPT_l px-q*@YZ    &( ,0$ :dh ET  T` c t}    c((#L U!.$<JTdc -4BSjwhi_wdt.c$ahidog_write.LANCHOR0hidog_notifier_sys.LANCHOR1hidog_set_heartbeat.LC0.LC1.LC2hidog_release.LC3.LC4hidog_openhidog_ioctl$dwatchdog_exitwatchdog_init.LC5.LANCHOR2.LC6.LC7.LC8.LANCHOR3hidog_deamon.LC9__func__.18201__param_str_nodeamon__param_str_nowayout__param_str_default_margin__mod_version558__mod_alias557__mod_license556__mod_description555__mod_author554__mod_nodeamon85__mod_nodeamontype84__mod_nowayout81__mod_nowayouttype80__mod_default_margin77__mod_default_margintype76optionscur_marginidenthidog_miscdevhidog_fopshidog_notifierdefault_margin__param_nodeamon! nodeamon__param_nowayoutnowayout__param_default_marginhidog_stateorphan_timerdriver_openbannerwdt.mod.c__mod_srcversion23__module_depends__mod_vermagic5yieldmisc_deregister__this_module__arm_ioremap__iounmapcleanup_moduleschedule_timeout_interruptiblesched_setschedulerinit_modulewake_up_processmsecs_to_jiffiesregister_reboot_notifier__put_user_4module_putunregister_reboot_notifiertask_hidog_deamonkthread_stopprintkmisc_registernonseekable_openkthread_create_on_node__get_user_1__get_user_4no_llseekreg_ctl_base_va__copy_to_userparam_ops_intreg_wdt_base_va!W gpio.ko9Y +X8YS"ELF( 4( -L -L p-LM7 0LQ@  LQ4 @Kp ?   03Q.(`K PT($ Z 0 s]䃒䃂 排?P12 0 000P3U  ? 0  003S (K  (K P!( $0 (<s$$ &^s44 6s 44 6 -L@ x-L@@P@@?>OO /O///Od@OPT/NO/Pk.mv ///{/d r04PQ0O>OO@DSP?O>O O@`k`^nOC^?^O;N/7N.O@c___[_W_S_O_Ė~ĆOOOOOOāNNN@0= $p48 p6 8%PU B$ȄH|4F8 H|6 8AQ@@@xlicense=A-MTK Licenseauthor=A-MTKdepends=vermagic=3.0.8 mod_unload ARMv7 MultiFuncPort ioctl function error <3>tlclk: misc_register returns %d. init all multi-function port and set direction ###init all multi-function port and set direction ..done ### ###Init all LED ..done ### gpio$gpio"GNU:A7I0Z1A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 8)D% 0 8`4 H xCPL2h_P[ 0 i$e  $$$p$/S( C\+`,d,0$/\-t0 +,( +,. +(,,,4+8,<,d+h,,+,,$)DPX+*   )2 <(FKT$YL^chx  $ " $h $$ -! $  #2MultiFuncPort.c$amfp_openmfp_releasemfp_exit.LANCHOR0mfp_ioctl.LC0mfp_init.LC1.LC2.LC3.LC4__mod_license41__mod_author40$dmfp_miscdevmfp_fopsgpio.mod.c__module_depends__mod_vermagic5misc_deregister__this_modulecleanup_moduleinit_moduleprintk__memzeromisc_register__copy_to_user__copy_from_user"S tlv_320aic31.ko9Y +X8YL)#ELF(4( -L00@P  -L00@ A -L x-L@Px``@P$ @Txu$P @@ -L -L@@@A $| Q@$f2 $ $ $ $ $  $ P $ $ $0 $0 $ $ $ $ $ $ $ $ $% $( $) $* $+ $, $/ $3 $@ $A $&>  p-L MR@:$`[`5TM T $  L $    t <  x P ( D(xPx ?0003S$K P Kp$Kf@A $$  [@A $!0[  #$r @A$$[ 2[#$ r @A$$[ @@@A)$" [)"3$| @A$$ [R3$| %$$ [%R3$| @A$$ [R3$| %$$ [%R3$| r@A,$$[, @@@A+$$[+ aPP@@$"0["$| $  "[PuPU] $ $ $6 $$,$| $  $e #$f @A $@@@A$$\7  $r @A$$\7 "$r @A]$$0[] [!S3$" r @A\$$[\ @A[$$[[ @AV$$0[V @@@AR$$[R @AQ$$[Q @AH$2[H $[$!3"r @AG$$[G 00@AF$$[F @@@AA$A2[ $[$!@A@$$[@ @A?$$[? @A:$:2[ $[$!00@A6$$[6 @@@A5$$[5 v@A3$32[ $[$!@A/$$[/ ^ @A.$$[. T@@@A$[$0[  S3!$!r @A$[$0[ @A$[3  $r @@@A$2[ $D$ $ $  $$ $$  $e $f " $fP$"[p $  $ $ $ $ $e $  -L@ -LM@Ppp@ P @$`2 @ @^2@, $x P E2@@@@@@ ? @ P@(0S $Ktlv320aic31_inittlv320aic31_device_initchip_countauthor=Hisiliconlicense=GPLparm=chip_count:the num we device uses the tlv320aic31,#default 1parmtype=chip_count:intdepends=vermagic=3.0.8 mod_unload ARMv7 reg%d =%x, <6>%s [%s ,%d]: could not register tlv320aic31 device tlv320aic31<6>%s [%s ,%d]: init aic31(%d) error <6>%s [%s ,%d]: tlv320aic31 device init fail,deregister it! ,(H,0tlv_320aic31GNU Z|]kO$ۄ TA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4  X )0% x 8L(4 Ct8KT2Pg c ! so !0 }$y !$p/'#  !; & +,8+<,`>|+,J+,CJ+,C+,CH +,$A0F@APA`ApAAAAAAAAAAA A0A@APA`ApAAAAAAAAAAAHLPTX\`dhlptx| PKpD|G+,JA+,JA=+,JDAP+T,dJx+|,JA+,JAJA(+,,<J\AhJA+,J+,J+,J$ATAdAtAAJAAAA+,J+,J8AD+H,XJxA+,JA+,J + , J( +, ,< JP +T ,d Jx +| , J + , J A + , J + ,( J< +@ ,P Jt +x , J + , J + , J + , J$ +( ,8 JL +P ,` J + , J + , J + , J A$ +( ,8 JT +X ,h J A + , J A A A# A J A( A8 AH Ad Ap J A A A A A A A +,;+,E$+(,<+@+D+ H,L, T,\ChJ|AJ+!+,!,C+,;+"+,",+ , CA=$I ,?LX`B@   ,#-,(?P Z _ d vH y( H T | v$v,  A^v *$ :,h K( v v V vivrvxx !v$ $(!+9Hh]lzTtlv320aic31.c$atlv320aic31_open.LANCHOR0tlv320aic31_closetlv320aic31_exit.LANCHOR1.LC0.LC1tlv320aic31_ioctl$dtlv320aic31_init.LC2.LC3.LANCHOR2.LC4.LC5__func__.19442__func__.19410__param_str_chip_count__mod_author634__mod_license633__mod_chip_count597__mod_chip_counttype596tlv320aic31_devtlv320aic31_fopschip_# count__param_chip_countopen_cnttlv_320aic31.mod.c__module_depends__mod_vermagic5misc_deregisterIIC_device_addrsoft_resetgpio_i2c_read__this_modulecleanup_moduletlv320aic31_writeinit_moduleprintk__memzeromisc_register__const_udelaytlv320aic31_reg_dumpgpio_i2c_writeparam_ops_inttlv320aic31_read__copy_from_user#L%hi_rtc.ko9Y'X8Y$ELF(4( -L0>O -L0@ s0>O  -L 00@P  -L00@ Mp-L,M@PT 0Kp`KvL4  B$& N(@ , 0 80 O 0-L0>O@P@0 0-L0M00DQPW H QH 00HQ DQ& K0Q>  QO0@K@  ? 0  003S  P @  ?0 03\.0@K P K 0@K .O  ?0  03^ 0@K P K 0K -L0MP8K@p`$80, @v΃0 (0P 40dV```PK -L'@@ 0-LM@@P @ P5 @@@P4@@0 0@80'0@PP '@@$@@ .O0>OQA@  K0version=HI_VERSION=HISI_RTC-MDC030001 @Hi3531v100alias=char-major-10-135description=Real Time Clock interface for HI3511license=GPLauthor=Digital Media Team ,Hisilicon crop srcversion=C82FEEFB7BDE882D09824A4depends=vermagic=3.0.8 mod_unload ARMv7 driver/rtcrtc device register failed! RTC Alarm hi3511 rtc: failed to register IRQ_RTC(%d) rtc_init <6>HISI_RTC-MDC030001 @Hi3531v100set time error!RTC set time year %d month %d date %d hour %d minute %d second %d weekday %d rtc_set : rtcdate2second fail rtc_time = %d RTC read time HI_RTC_RD_TIME HI_RTC_SET_TIME rtc_time : %02d:%02d:%02d rtc_date : %04d-%02d-%02d rtc$hi_rtcGNUR:y*-#PjGCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1A.aeabi$7-A A ,.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.comment.note.GNU-stack.ARM.attributes4 )8% 88P4 ClL2p _ $[ 0 i $e   $   p / B h+l,+,4FHK+ , N+!,!N+"," N(+#,,#0N8+$<,$@NH+%L,%PNX+&\,&`Nh+'l,'pNx+(|,(N+),)N+*,*N,U8++P,+xN+","N+#,#N+$,$N+%,%N+&,&N+','N+(,(NI8ID+)H,)LN+-,-NW8TL+.P,.TNVGYV0Q@OpW+/,/RB+ ,$S(+,,0C+,P$+(,,N@+D,HJL+P,T+X,h+p,M+,N+,S+,C+,N+, N$DD,PXHE     X@+5  D8MR \e j,oL}8ht$ 0@XP`t22J13{ D+T W$ b$h TTnyT# !T T$ 8D 2AJ_fp~P|< 8$hi_rtc.c$artc_alm_interrupthi_rtc_open.LANCHOR0hi_rtc_releasertc_exit.LC0.LANCHOR1rtc_init.LC1.LC2rtc_read_proc.LC3.LC4.LC5rtcdate2second.LC6.LC7.LC8.LC9.LC10.LC11.LC12.LC13.LC14.LC16.LC15.LC17hi_rtc_ioctl.LC18.LC19.LC20__mod_version449__mod_alias448__mod_description447__mod_license446__mod_author445$dhi_rtc_devhi_rtc_fopsrtc_statushi_rtc.mod.c__mod_srcversion23__module_depends__mod_vermagic5free_irqmisc_deregister__this_modulecleanup_modulertc_valid_tmrtc_setinit_modulertcSecond2Datecreate_proc_entryrtc_tm_to_timertc_lockrequest_threaded_irqprintk__memzeromisc_registerrtc_alarm_complex_setsprintfremove_proc_entry__copy_to_userrtc_time_to_tm__copy_from_userrtc_getrtc_alarm_simple_setrtc_getalm$ tw2865.ko9Y'X8Y2%ELF(4( -L -L -LPPTP RPVP -LPPTP RPVP -LPP@$0Sa(p`@@  $P -L``@pp$0S(P@W0@  0  P$P0 0-L@P%t|PpPp0Ps pPp P T% P PP 0@0PpPgp Pr npP_pP f Pb P^ PZ00@@?!0 0-L@| Q@PUt Ul ? ; 7  3  /  + ' #    . '  ( ) * + > 7 8 9 : ; A@ @| Q@0@0 P 0E sE qE |0E sEP quPNUA @ p-LDMq@@ Q 4 d  l 0  ?0  003S$K @P$P@Kp ]?P  03Q\`K P{00@\$Q* X(2L 03\T g Pa 0?  03^EPK PP00@P[$ QJH (@odt O0[K [ %!O[K [2| ?  03PPPK P @P[$ QH0(`}rh ? 03P P o  ? 0  003S$K P$] =?  03^<K @P00@< $R*8Q(P80[ 8 ?  03PDK @P00@D $R*@P(P@0 "r  ?  03Q K @P [P ?   03Q{,PK P{, 00@(QPPP0(0  PP PP0(0 ( 0?  03^[ PU ? 0  003SH4K `PD0@P4P@T(Px TQ T @  ? 0  003S,K P(AP00@, $ Rc*0q(PK }$Kx,Ks4Kn<Ki\K d K_DKZ J PO[M [ H O0[N [ H O[L [0sH U E j @#@@O [2 |KKO[ rtH0LKO0[ kH0MKxO["0bH0NKm@@@@ -L@ -L M@,0@S @0 d$ AR@0 Z P0 8`0p @N@@%@xPU @? ` a  ,P d | q0 s | q0sPAUC @ R   s Q      C K   XP P PUp P Ur p    2          p  s { | ~  $@WPTaPU P,a  ? 0 PUP`"2 T v      PU @0(K(GNUfb/O3*Zn_tw2865_set_audio_sampleratechipsnormlicense=GPLparmtype=chips:uintparmtype=norm:uintdepends=vermagic=3.0.8 mod_unload ARMv7 tw2865_set_audio_formattw2865_set_audio_sampleratenot support this samplerate:%d func(%s) line(%d):tw2865 not support this samplerate:%d tw2865 0x%x set to PAL mode ok! tw2865 0x%x set to NTSC mode ok! tw2865 not support this video norm : %d module param norm must be PAL(%d) or NTSC(%d) module param chip invalid value:%d ERROR: could not register tw2865 devices warning: tw2865 0x%x i2c_read err, val:0x%x!!! tw2865 driver init successful! tw2865 0x%x set to 2d1 mode ok now not supp% ort this work mode:%d invalid video mode %d invalid chip id %d invalid audio_format:%d invalid audio_bitwidth:%d for 2865 invalid tw2865 ioctl cmd tw2865dev$$$$,xPTRV xPpp Ppp 332222 k@&e5rA:tw2865GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1A.aeabi$7-A A ,.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4 X)4% L$8P4 d$C<$Z$`V ' dp,l`u420  <'0 l'0$ '%p/'O |.%LS|i+,+,`+d,hb++,, b4h+,bh+,b+ , b Hl`Yl++p,+tbl+, kdlp+t,(l4+8,kla4 l@ +D , l + ,` lx [ l + ,P k l + ,( lD +H ,x c c c c c c c c +, ,, b +- ,- b+. ,.b+/,/b+0,0b+-,-b+1,1b +,P+,,+#4,#8bX+$\,$hbtd+%,%b+&,&b0DXl 0@P`p(8HXhx(8HXhx8HXhx+','b [a Q  Q   T\ORXW%          *(0;X0M P U _$ dz  `   ( T  MM \    8   M   $   "  5  MGi  M$h$,M MMM4 !4  2=! MM M BN^mz$|(lt@ `*0>8Sap}P@tw2865.c$atw2865_module_exit.LANCHOR0tw2865_byte_readtw2865_byte_write$d.LC0.LANCHOR1.LC1tw2865_set_video_norm.LC3.LC4.LC2tw2865_module_init.LC5.LC6.LC7.LC8.LC9.LC16.LC10.LC13.LC11.LC15.LC12.LC14__func__.19222__param_str_chips__param_str_norm__mod_license953__mod_chipstype892__mod_normtype891__ksymtab_tw2865_set_audio_format__kstrtab_tw2865_set_audio_% format__kstrtab_tw2865_set_audio_sampleratetw2865_devtw2865_fopschipsnorm__param_chips__param_norm__ksymtab_tw2865_set_audio_sampleratetw2865.mod.c__module_depends__mod_vermagic5tw2865_openmisc_deregisterparam_ops_uinttw2865_closegpio_i2c_read__this_moduleAudioSetup16Ktw2865_i2c_addrcleanup_moduleinit_moduletw2865_set_audio_bitwidthAudioSetup8Ktw2865_set_audio_formattw2865_ioctlInitAudioSetuptbl_pal_tw2865_8KHztbl_ntsc_tw2865_8KHzAudioSetup48Ktw2865_set_audio_samplerateprintk__memzeromisc_registerAudioSetup44_1Ktbl_ntsc_tw2865_commontbl_pal_tw2865_common__const_udelaygpio_i2c_writeAudioSetup32K__copy_to_user__copy_from_user% pt7c4307.ko9Y +X8Y&ELF(4( -Lg6f6FϠ A1l!@ -L@ 1 -LP0@S0(SR 0QpVSR0QpV SR0QpVSR 0QpVS R0QpV S@R0QpVS R -L0P0(00 00 0@00 -L0 00 0@00 -L00 00 0@00 -L0 @ -L00 00 0@00 -L0(00 00 0@00 -L00@ !   -L00@ -L0Q  0@3/@PA -L -L0 p-L M$KP@ 0 e``$ $[#["[!0[  @   P[ @   [[Kp?@ 0-LMP@KKK KK0K K0KdK0 0-L0M 0$0DQB  HQ9 0$0HQ $HQ Q  D QE 0$0DQ@K0 H Q  Q 8@K@ g 0-?@ $ 03\$ '@ @ P  ?$03^8@K$ PPwR$ P8K$ -LDM@HKPp`!H4@ @v< D0 }Π 81 @0 @ @0 @dPeV```0 K -LM @]8@KR 0?P p ` 8 0P K&@40 @0  @ R     R  P ? 0@00,BPPP^_O -L 0-L@P0P @T0uP @@ -L -L@ 0-L8MH+L,PSxLLO4al`T+&,&X+',' F$+((+)0,(4,)8X+,+V,VG+,$Kd+l,p]L?J+*,*S J +* ,* S( ++, ,+4 SH ^+,Y =(U$+(,0I8+"<,"L+#P,#TSp>x+$,$S+$,$ S ,@04ZHLX`lHE    l@" .D7 A L,UZ(](Z& @ DhDr({   @ZxZ  $ ,h ZZ&6Z,E, V5!Z Zfv$ lD< 0<T, &4=J S0 [c|p~Pp< L D+:0BQb,pt7c4307.c$artc_open.LANCHOR0rtc_releasertc_poll.LANCHOR1rtc_llseekrtc_exit.LC0$drtc_fasyncread_timeset_timertc_ioctl.LC1rtc_initrtc_read_proc.LC2.LC3.LC4.LC5.LC6.LC7.LC8.LC9__mod_license85__mod_author84rtc_waitftrtc010rtc_miscdevrtc_fopsrtc_statusrtc_irq_datartc_async_queuept7c4307.mod.c__module_depends__mod_vermagic5misc_deregistergpio_i2c_write_arraygpio_i2c_read__this_moduletransIntToDayi2c_write_datatransIntToMonthtransIntToYearcleanup_modulememcpyadd_wait_queueinit_modulecreate_proc_entryi2c_read_dataschedule__put_user_4rtc_lockBCD2BINcapablertc_reg_dempfasync_helpertransIntToDateprintk__memzeromisc_registerdefault_wake_functiongpio_i2c_read_arraysprintfremove_proc_entryrtc_readtransIntToSecMintransIntToHourremove_wait_queuegpio_i2c_writeBIN2BCD__copy_to_user__copy_from_usertransIntToWeek&  tw2960.ko9Y'X8Yz/' ELF(4( -L -L -L -L -L``@pp$0S(P@W0@  0  P$P0 -LP#<DL4@pPpP| pPp0P  P PP @pPp Pr pPp P P P P@@@ 0-L@| Q@PUp Uh i e a  ]  Y  U Q M I E A =. 9' 5( 1) -* )+ %> !7 8 9 : ; @| Q@0@0 P 0E sE qE |0E sEP quPNU@ p-LDMq@@ QL L,   0 ?  03Q K @P [P@Kp ]?P  03Qz\`K P{00@\$Q* X(2 03\T g Pa 0?  03^0PK PP00@P[$ QJH (@cXM O0[K [ TO[K [2|M ?  03PPPK P @P[$ QH0(`xmc ? 03P P 'o ? 0  003S,K P(AP:00@, $ R.*0q(Q ?   03Q,PK P, 00@(PPP0(0  PP PP0(0 ( 0?  03^ P ? 0  003S4K `P0@P4P@T(P T T @   ? 0  003Sg$K Ps$ =?  03^P<K @Pa00@< $R[*8QX(Pj80[ i ?  03P&DK @P<00@D $R6*@P3(PE@0 "r CPK ,KDK<K$K~4Ky\K t Ko J eO[L [0sH O[M [ H O0[N [ H U E j @8@2@-@'@!@O [2 KKO[ rH0LKO0[ H0MK}O["0H0NKr -L@ -L M@,0@S @0 T$ AR@0 J P0 8`0p @>@@xPU @? ` a  ,P d | q0 s | q0sPAU@ r   s '@     9  XP P PUp P Ur p    2     3 3 # H  p  s { | ~ D $@WPTaPU P,a  ? 0 PUP`"2 T v      PU @0(K(GNU /M"bHi*$$$,chipsnormlicense=GPLparmtype=chips:uintparmtype=norm:uintdepends=vermagic=3.0.8 mod_unload ARMv7 tw2960_set_audio_formattw2960_set_audio_sampleratenot support this samplerate:%d tw2960 0x%x set to PAL mode ok! tw2960 0x%x set to NTSC mode ok! tw2960 not support this video norm : %d module param norm must be PAL(%d) or NTSC(%d) module param chip invalid value:%d ERROR: could not register tw2960 devices warning: tw2960 0x%x i2c_read err, val:0x%x!!! tw2960 driver init successful! tw2960 0x%x set to 2d1 mode ok now not support this work mode:%d invalid video mode %d invalid chip id %d invalid audio_format:%d invalid tw2960 ioctl cmd tw2960devPTRVǵ ϵ xPpp Ppp 332222 k@&e5rA:tw2960' GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1A.aeabi$7-A A ,.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel__param.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4  ) % !8 4 !C$Z$V $ h d $0 px `l42$ $0$ %p/%K +4MHd`+d, $(,0+,Zp_+ ,Z_,+0,4Z+,Z  $(,`gx'Q+),)Zg+,8f|g+,@gL+P,fg +$,g+, f\ gl +t , g S8 gD +H , g + ,< [P [d [x [ [ [ [ [ +* ,* Z ++ ,+ Z +, ,, Z +- ,- Z +, ,, Z +. ,. Z +,K+,,+!4,!8ZX+"\,"hZt\+#,#Z+$,$Z0DXl 0@P`p(8HXhx(8\(8HXhx+%,%Z S  Q L  L   NW^aRP       *(;<M  4PUTkHplu$ zHMM 0h' M   $  ,M   #  6  MHnM$hMMM4 4  =! MM M-<J$X|fuTLt`@8(6FRa0u(Ptw2960.c$atw2960_module_exit.LANCHOR0tw2960_byte_readtw2960_byte_write$d.LC0tw2960_set_video_norm.LC2.LC3.LC1tw2960_module_init.LC4.LC5.LC6.LC7.LC8.LC14.LC9.LC10.LC12.LC13.LC11__param_chips__param_str_chipschips__param_norm__param_str_normnorm__mod_license891__mod_chipstype830__mod_normtype829__ksymtab_tw2960_set_audio_samplerate__kstrtab_tw2960_set_audio_samplerate__kstrtab_tw2960_set_audio_formattw2960_devtw2960_fops__ksymtab_tw2960_set_audio_formattw2960.mod.c__module_depends__mod_vermagic5misc_deregisterparam_ops_uintgpio_i2c_read__this_moduleAudioSetup16Kcleanup_moduletw2960_set_audio_formatinit_moduletw2960_set_audio_samplerateAudioSetup8KInitAudioSetuptbl_pal_tw2960_commontw2960_ioctlAudioSetup48Ktbl_ntsc_tw2960_8KHzprintk__memzeromisc_registerAudioSetup44_1Ktw2960_open__const_udelaytbl_pal_tw2960_8KHztw2960_closetw2960_i2c_addrtbl_ntsc_tw2960_commongpio_i2c_writeAudioSetup32K__copy_to_user__copy_from_user'z?ssp.ko9Y'X8Y( ELF( 4( -L@0  -L@ r9  0  -L@0  -L@P0 @ @  -L@0 -L@ 0 -L@ 0$ -L@ 0$ -L@0 P -L@P0  P -L@0 -L@0 -L@0 -L00@ P -L00@B  0P@  -L00@B   0    @00r -L00@B   0   0@00 -L -L -LQ@ Q @0 p0 Rr0 -L00@@ 0@ 0-L@PPO@@@0QR?O@@@Cq R / @0C 0@0@0@0@0 -L@@@@0 0@ r9  0   -L@ 0@ -L00@ @ -L B 00@P@ @P @@P @@GNU;4(,|EmKVUOkE.Z ' spiset_burstspi_wait_setfinishspisetspigethi_ssp_set_serialclockhi_ssp_set_frameformhi_ssp_writedatahi_ssp_readdatalicense=GPLdepends=vermagic=3.0.8 mod_unload A(RMv7 Kernel: No such ssp command %#x! set cpsdvsr parameter err. set frame parameter err. set spo parameter err. set sph parameter err. set datawidth parameter err. Kernel: ioremap ssp base failed! Kernel: register ssp_0 device failed! Debug: ssp initial failed! Kernel: ssp initial ok! ssp0$sspA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab__ksymtab_strings.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4 X)<% `08L4 C$Z$@V (dT{v824<  0  $   p /  (F ~ +,4+8,t+x,+,+,+,+ ,@+D,d+h,+,+,+,+,+,H+L,+,+,+,WcS+,8+<,@WX+\,+,W+,W+, W+, W8+<,\RhM+,^ +,(L,+0,4GI +$,4+8,<WH+L,PZ\+`,dWp_|+,W+ , W8]<iR M e$0h4U(`, $HDTPQXgPN       <# - 2$ 7@ < A\ Ft KW \ a f k    ' . E Z k 6898P  6a6{66  6 $ $h 6 600666((6 6 &( 6 0  A! 6Q(@_o$}h(T<$\Lh*t40E$\c$v8(X$<L, l!|06 0I4$]pg n hi_ssp.c$a.LANCHOR0hi_ssp_exit.LANCHOR1.LC0.LC1.LC2.LC5.LC3.LC4hi_ssp_init.LC6.LC7.LC8.LC9__kstrtab_spiset_burst__kstrtab_spi_wait_setfinish__kstrtab_spiset__kstrtab_spiget__kstrtab_hi_ssp_set_serialclock__kstrtab_hi_ssp_set_frameform__kstrtab_hi_ssp_writedata__kstrtab_hi_ssp_readdata$d__ksymtab_spiset_burst__mod_license846__ksymtab_hi_ssp_readdata__ksymtab_hi_ssp_set_frameform__ksymtab_hi_ssp_set_serialclock__ksymtab_spi_wait_setfinishssp_devssp_fops__ksymtab_spiset__ksymtab_hi_ssp_writedata__ksymtab_spigetssp.mod.c__module_depends__mod_vermagic5hi_ssp_enablemisc_deregister__this_module__arm_ioremaphi_ssp_disablereg_ssp_base_va__iounmaphi_ssp_set_serialclockcleanup_modulehi_ssp_set_inturruptinit_modulessp_openhi_ssp_set_frameformhi_ssp_write_altssp_ioctlhi_ssp_writedatahi_ssp_interrupt_clearprintkhi_ssp_dmac_enablehi_ssp_alt_mode_setmisc_registerhi_ssp_writeOnlyhi_ssp_busystate_checkspiset_burst__const_udelayhi_ssp_init_cfgspigetssp_dmac_tx_chssp_dmac_rx_chhi_ssp_read_althi_ssp_is_fifo_emptyspi_wait_setfinishhi_ssp_dmac_disablessp_closespisethi_ssp_readdata(adv_7179.ko9Y'X8YS)ELF(\ 4( -L -L -LV x-L0`@PV@ V 4T0x -L V 0-L0P6  p 3Q00:P@@QPUB U00@3  3 4PT0U9 0% U5 U00@g  g P @0@P0P0RT000@3 3 0@gg$X4 -LqQ RtT8@Xg g\o m00@$33@Xg gH[ Y00@$3 3 $9LJ@4 -L@ 0-L@@P @@+PpP @@u00@Q P  P @@@0@ *   | ! norm_modeauthor=hisiliconlicense=GPLparmtype=norm_mode:intdepends=vermagic=3.0.8 mod_unload ARMv7 err_out could not register adv7179 devices. read adv7179 register is %x check adv7179 error. adv7179 driver init fail for device init error! adv7179 driver init successful! adv7179h$  *     | ! adv_7179)GNUzV/bF) .A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 ()% D84 \CtKD`T2gpc D so \0 }t$y $p/ < <<=pHHH+,x+|,+,D+,+ ,L+P,dhl+,+,+,8+<,t+x, +,< +,E +$,(D8ADLA`+d,hDl+p,tD+,GG)+,<+,D+ , DI  >BCF@?      %DT+$1 6@d CP U4 ZT _il n p@ @@s444h  @ $ h $4 X4 @ @  "@@,@4;4 L=!@\lz$(p adv7179.c$aadv7179_exit.LANCHOR0T.230T.231.LC0.LANCHOR1$dadv7179_init.LC1.LC2.LC3.LANCHOR2.LC4.LC5init_656_PALinit_656_NTSC__param_str_norm_mode__mod_author571__mod_license570__mod_norm_modetype566adv7179_devadv7179_fopsinit_601_PALinit_601_NTSC__param_norm_modenorm_modeadv_7179.mod.c__module_depends__mod_vermagic5misc_deregistergpio_i2c_read__this_modulecleanup_moduleinit_moduleread_single_regadv7179_ioctladv7179_openprintkmisc_registeradv7179_closeinit_vdagpio_i2c_writeparam_ops_int)S gpioi2c.ko9Y +X8Y%*ELF(t4( -LM00  R*+0 \   R  \: K -L -L -L -LP P P0">Oē| $00">Oē| $0">Oē| $ @ -LP P P0">O ē| 0 0">O ē| 0">O ē| @ -LM 0S+! P0 \ P   R+! 0S P 0S  R+! ^ 0S00 ^ K -LMp `P+A P 0S$P $P$ $ $Q 0 0 ^l$P $Q P R 0 \$ $ $PWƠI . P ^$P $0S$ $ $P 0 \$P $P P Q  R$$ $0S`F&v  R+!$ $\$0$0 $^ 0 \K -L M 0S+! P @T@ 0S"O4Ď  R+! P @T@ 0S  R+! \00 ^ @T  R+! 0S@@ P00 ^"O@D  R+! 0S@@ P00 ^"O @  R+! ^ 0S00 ^m  R+! \00 ^0* \$K -LM 0S+! P0 \ P  R+! 0S P 0S  R+! ^ 0S00 ^  R+! \00 ^0 \  R+! P0 \ P  R+! 0S P 0S K -LP@p*T`D$`TPV PT `PTD x-LP@`3x -LM `"nOpP+A,P ,0S(P (P( ( (Q,0,0 ,^d(P (Q,P , R,0, ,\( ( (P)04,P ,\(P (^( ( (Q,, ,0SĖ $(P (Q,P ,0S,, ,P(0( ( R ,P ,P(P (Q(0( ( R,, ,PpGw( ( R+!, ,\,, ,0S(0(0 (\x$K 0-L@P VSOR@0 -L M00  @R+0 P  \ P 0S+! P0 \ PTI y  R+! 0S P 0Sa  R+! ^ 0S00 ^n  R+! \00 ^0* \KT -LP@pt@TP `TP fb`TPYPQ x-LQ@2 70LQ5 LQ 0xQPU% %(0XpPPxP0 `  ? 0  003S, 0x\, | 0x` ? 0  003SP V0 0x P  @@ 0 -L@ -L@@P GNU~M-&&Zv8?Yi8)Fgpioi2c_ioctllicense=GPLdepends=vermagic=3.0.8 mod_unload ARMv7 gpio_i2c_write_arraygpio_i2c_read_arraygpio_i2c_writegpio_i2c_readsiiReadSegmentBlockEDIDError input. %s:copy from user fault! gpioi2c,$gpioi2cA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.modinfo__ksymtab_strings.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4d \)* % 844 , C$Z$ (V LPd4lD8u|^24 0$ p/@? "e0+4,8I+,IB0SHMxGPSAGR0Q<J@+ D+!H, L,!PIXG +,? +,K(B F$PM A  $CDOPDXLHE      '/ 44B@J0X fvP$ p   8   %F G f ) $$h *    +! ;KtY@ n T|$t4, D;J[gpio_i2c.c$agpio_i2c_exit.LANCHOR0i2c_set.LC0gpio_i2c_initi2c_clri2c_start_biti2c_send_bytei2c_receive_acki2c_stop_biti2c_receive_bytei2c_send_ack.LC1.LANCHOR1$d__func__.15481__ksymtab_gpio_i2c_read__kstrtab_gpio_i2c_read__mod_license641__ksymtab_siiReadSegmentBlockEDID__kstrtab_siiReadSegmentBlockEDID__kstrtab_gpio_i2c_write_array__kstrtab_gpio_i2c_read_array__kstrtab_gpio_i2c_writegpioi2c_devgpioi2c_fops__ksymtab_gpio_i2c_write__ksymtab_gpio_i2c_read_array__ksymtab_gpio_i2c_write_arraygpioi2c.mod.c__module_depends__mod_vermagic5misc_deregistertime_delay_usgpio_i2c_write_arraygpio_i2c_read__this_modulegpioi2c_opencleanup_modulesiiReadSegmentBlockEDIDkfreeinit_moduleprintk__memzeromisc_registergpioi2c_closegpio_i2c_read_arraygpioi2c_lockgpioi2c_ioctlgpio_i2c_write__copy_to_user__copy_from_user__kmalloc*%sil9024.ko9Y'X8Yf+ELF(pB4( -L -L00@     -L0SQ R\ 0S Q Rp3 -L0  | r |0Rs0s3 -L000S R \0S R\0S R\ 0 0r 0 s0|S|\~\ -LM0S (KQ0 @à;YQ3<0=0S>P@ QʥRj 0jJ<` `0 8 PEU\\y00s0 \0|0B s0 C0s070 S*@P0pt@ `V`R 0PYu0 ?P`|0@P s0PUA@D@D0s0T\ pP`0wp\\vPs0:0l0 <嘄@4@ 8`Pz@4xp`PY@PIPzv`@@@=U P puyPp`@p4zv`@X'@0  @Px0u@`z0v`P@uPpt@`z0v`40\00@0 4P0E8P|@t@st@8@ y0Y אY``@@PpDPƵDpȥq0 \s0ZPYu0p?pU R -L0S s00S -L00@H R R R R I 00@I@|Q*pI/P@pI ARPP<PQ?P0S @XP0S+@0TP0S@LP0S @0@P0S@<P\0P0S/ -L -L00@ R o SVTU -L00@X AX -L00@XP X  '=@@\ -L@@@0@ LHN K S   D p L x @"0OI0JM@@0I0JMO@0@0 O0IM J0@0OI0MJ@ OIJ M@0OIJ0M@ OIJ M@0O0IJM0@0 OI0J M@OIJM@0! O0IJ M0 -Lr% r6 r| r r r r5 rp r r rp r rZ r r r rc rp r  r  r` r r r5 r r  r  r r` rbX rc@ rdL re rf, rg rh ri r -L r -L 1D -L%| -L 0-L@P0 -LRpP P@ T`J`uPV  @  ` @qP TpP -Lq0r+ -Lr -LM@@@Pb0S K`l0„|t@pP`U$@0rb ( K`@p&`KTd'pK#`K^d(PK!`K\d$@K`KSd"K`K` K%`K0K' [@ x 0-L1@PT s@0D00 0-L@P1@T0D s@ 00 x-L@P``Pux -L@ -LP x-L@`P`@tx -L 00@ -L 00@ -L & -L 00@  -L00@@@  -L00@   -L@@@ |00 -L 00@ 0-LP@q0 -L< 0-LP@q0 -L`c0`c@ -LMp`@.@K<@KP;@K:@K9@K8@K7@K6@K5@K4@K3@K2@K1@K0@K/@K@" 16[r4`[qL3P[2[qp1 [/[w8K0[ yp:K@ {w`.[70Kpv`Q1K 0;K0@RH M0S0:0K S: [@090[? :0Kp0: K90KJI Y @8KB : [00@;p[P9[o`G8["6p[v5`[0, Kp2[4P[ z3[1[x@ 70Kxp@0D wp:K0[wP/[u+ ~D0|~zlbN0S& (KM0?:KS 9P[p9KJI Y @8K0`0@:[R ゠Z@ ]zXWzI8KS9[pp`9`K -L@  @@@? R N0SN0S 0-LM@@@R0S!& % SP! &RPP@Q! 'S@@ 0K0&@ %SP &RPP@QS RS\S0S!"#T$T U%q$U V -LM  0`Pc0P@`00@$ KbBpP@`Ttxp^4`K\d!0K`KPK$@K#pK"K KK -LMs@@@PIAp0QSQ 0  @l!d"K Ġ!`K#K$K‚! KKK 0R @b`,#K$Kg$K,Ġ#KP&Ġ"`K!KZ ` K KP$`K0p P7P@30KKw$K|N0 # KS$ K= S@ K0S S CpQ0$0KI0C| SR S S S S S00? @^ =Q0#0K>P0#0K0#0K$ [~0} `KQ N0S` -L< -L00@     P 0-L@@@LPU% O?P KQ xc @ X|  0KQ` O0L0LP -L -L00@+   -L00@   x-L@ @@ @\`P$ RP0ST0 o0UV0@ @l 0d0@ rccr@x -LQ @@@@@$ P@@ B=\ -L@R`# P`UpDpv`W  P0Us`  pr` PUq` -Lq0r -L M00@ PPPp@`? @t@  T 0`00STQXP0S Ks00ST: 0 p-L M@@@PU KpK0P A0? =0>0@0 0K`P VAP?P0=P?0>P@P[P [P 0A`?0=`>`@` 0-L@@@PP? R 0 0-L@@@0S0=P 00@Q \ =0=0R <==P0P!R S   0P0 -L@\ -LM@  0S @@P =P @@@ = K  !!""#$%%&&''(())**123456789:;<=>sil902x_open p  #`!0  pZ z$>< pr(np28,XL pw>r  pw|r&  pw+ |r& ph @ L ph @ L ph @ Lp $|x 9pe)8,$X `q,@@'D (P e8,( q@? 8 ~ 9 ~ : ~ q@ @0 8@ 0 9@ 0 :@ 0q,@':P e)8,$ ` e)8,$~! P e)8,$" e)8,$#$0*jh $@ @ %&0* q'@ @(0'  `>8W (:'P e8,():'(*+'`,@@'D ,-'`q@?E .9.e8,XL/9.r(nL01.Z z$>< 23.Z w>9450* N`q,@@'D 670* N`q@?E 890*]Z z*>< :;0*]Z w>9(0u0RpX H((tRpX H( (]|RpX H((]dRpX H( pZ z$>< :pr(n+ :p2,XL:p2,XLtpe)8,$Xtpe)8,$Xtpe)8,$X:pe)8,$X:(:(t(:P 2,:P 2,tP e)8,$tP e)8,$tZ e)8,$ :` e)8,$~@N %s [%s ,%d]: you should close the device first! sil9024HDMI_480I60_4X3 HDMI_576I50_4X3 HDMI_480P60_4X3 HDMI_576P50_4X3 HDMI_720P60 HDMI_720P50 HDMI_1080I60 HDMI_1080I50 HDMI_1080P60 HDMI_1080P50 HDMI_1080P25 HDMI_1080P30 Havn't the mode:%02X 0x63 = 0x%x <6>%s [%s ,%d]: sil902x device init fail,deregister it! Havn't the CMD:%X <6>%s [%s ,%d]: could not register sil902x device $$4( sil9024+GNUI-̒qN.uLPtAGCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1A.aeabi$7-A A ,.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.comment.note.GNU-stack.ARM.attributes4d% 0Fx )%(% S(8%4 SC`&K`<T20=g>c `T s>o xT0 }?$y T@$@@fApfA/AT \ _+ ,+,+,++,,x+|,+,  $(,048<@DHLPTX\`dhlptx|+,+,+,+  + ,(+,,+,+,+, + + , , $ 4 +8 ,d h l p t x |       +" ,"  +$ ,$  +% ,%  +& ,&  +' ,' D +(H ,(L p +)t ,)x  +* ,*  ++ ,+  +, ,,  +-$ ,-( L +.P ,.T x +/| ,/        , < L \ l |           , < L \ l |          ,HhTh`hlhxhhhhhhh0xzer+ ,4gs+,(h0gdg|hhghhhhg h@hLhTgph|kkggh+,$(+,,Ttx+|,+,d+,+,h<@D+H,lg|hghhllhh,s0+4,Ph+l,+,r$+,,<+D,s$r0+8,H+P,l+0p,0+,sh D+H,P`lxhl+,h`h +$,8hPhhhhhhhhhh +(,,h8l<r@+D,sr+  +,l+,t+x,+,s$h+,c8<TX|tl+,m+,qi{ h,h<HhXd`|lq+,~+,  ~ + +$ ,( ,8 l p +t ,| + ,    e +2 ,2  +4 ,4  +!, !$!a(!+5,!+0!,54!,@!L! P!t!e!e!e!e,"D"+H","p" #(# <#+@#,`#]####,$+0$,<$uT$h$+l$,$g$+$,$h$h$y$l$h%g,%v@%T%\%+,a$ +, 4+:8+<,:@,LX1h+l,pat+5x+|,5,b (fH3T\to       %( 3(@ $JPW \4 $  ( d a g  m< rP wd |x  $ p+   4 L! T!  (# ,#<@ LT$X/\ >M \m~ s $ (h $    X\ !#4\4PB,[l0g< t\0$  00(4,*\H3 p@(Ogql(,# $<<0$X\ 488LJ( |\(pv<HX,;\$@t< 8$4"7 IT!VdLt$444Hx<T2<xCQT\ "(iXA|(` dsil9024.c$a.LANCHOR0$d.LANCHOR1sil902x_closesil902x_exit.LANCHOR2sil902x_open.LC0.LC1.LC13.+  LC14.LC2.LC3.LC4.LC5.LC6.LC7.LC8.LC9.LC10.LC11.LC12.LANCHOR3sil902x_device_init.LC15sil902x_ioctl.LC17.LC16sil902x_init.LC18CSWTCH.320CSWTCH.323CSWTCH.326CSWTCH.329CSWTCH.332__func__.20288__func__.20310__func__.20339__param_str_norm__mod_author3560__mod_license3559__mod_norm3553__mod_normtype3552sil902x_devsil902x_fopsnorm__param_normopen_cntsil902x_timersil9024.mod.c__module_depends__mod_vermagic5SetGBD_InfoFrameGetDDC_AccessInitializeStateVariablesVModesTableSetAudioMutemisc_deregisterparam_ops_uintSetFormatDisableTMDSgpio_i2c_read__this_moduleReadByteTPIWriteByteTPIsiHdmiTx_PowerStateD0siHdmiTx_VideoSetReadIndexedRegisterReadSetWriteTPIStartTPIsil902x_testcleanup_modulesiiReadSegmentBlockEDIDInitVideoConvertVIC_To_VM_IndexWriteBlockTPIinit_moduleDoEdidReadOnHdmiCableConnectedVIC2IndexsiHdmiTx_PowerStateD2OnDownstreamRxPoweredUpI2CWriteBlockSetAVI_InfoFramesSetDEParse861LongDescriptorssiHdmiTx_TPI_InitsiHdmiTx_VideoSelTXHAL_InitPostResetg_sysEnableTMDSSetAudioInfoFramesReadClearWriteTPIadd_timerAspectRatioTableTxHW_ResetsiHdmiTx_TPI_Pollg_hdcpEnableEmbeddedSyncsiHdmiTx_AudioSelprintkReadModifyWriteTPIParse861ExtensionsDisableInterruptsI2CReadBlockmisc_registerDoEDID_ChecksumsiHdmiTx_PowerStateD0fromD2OnDownstreamRxPoweredDownjiffiessiHdmiTx_AudioSetSetEmbeddedSyncinit_timer_keysiHdmiTxTPI_REG0x63_SAVEDWriteIndexedRegisterReadModifyWriteIndexedRegisterCheckEDID_HeadersiHdmiTx_InitReleaseDDCReadBlockTPIParse861ShortDescriptorsHotPlugServiceg_CommDatagpio_i2c_writeg_edidtpivmodeOnHdmiCableDisconnecteddel_timerEnableInterruptsDelayMSmsleepParseEDIDprintVideoMode+ i2c.ko9Y'X8Y,ELF(4( -L@ 0 000S  -L @ 0 000S -L@@!@@p p p pP}PzQPS( RC`Q9E@  @ p  Q`PES p`pS PEp0S+ C@p`P9 p 0 000  S@PZL P@ ZLPp00@  00 S  pp p -L M@0 P`AP`@ P P @p@@@pTpS' CpaP5F@ @     Rp`FSpS`F0PP0 P0 @i@   c@`R@@T7 DpDa@P T   0   p0@ p @Rp0@ p( p0@   @Rp0@`F0@S00@ 00S(K0@@0`FS0    0T -LM0   0 K -LM0  0 K -LM0 0  K -LM0 0 K -L -L -,L MQ@ Q @=?OK 0 00 0 -L` `@@@ pP p 0  000S@ 0T 0@ -L -L00@ @ -L B@@@@P @0  0GNUaUjۺ ` H A$E $<DPDXMB@     8 '1 6 ;D4 I  _  v  "  ,     $ $h , ? Vq4 {4  =!  d8,  $@8$@ hD-6 GtlX_8hvt\i2c.c$a.LANCHOR0i2c_exit.LANCHOR1I2C_Ioctl.LC0.LC1i2c_init.LC2__kstrtab_i2c_read_ex__kstrtab_i2c_write_ex__kstrtab_i2c_read__kstrtab_i2c_write__kstrtab_i2c_write_config__mod_license536__mod_author535__mod_description534$d__ksymtab_i2c_read_exi2c_devi2c_fops__ksymtab_i2c_write__ksymtab_i2c_read__ksymtab_i2c_write_ex__ksymtab_i2c_write_configi2c.mod.c__module_depends__mod_vermagic5reg_i2c_base_vai2c_read_exmisc_deregister__this_module__arm_ioremapi2c_write__iounmapcleanup_modulei2c_write_exinit_moduleI2C_DRV_ReadI2C_Openi2c_write_configI2C_DRV_WaitReadprintki2c_readmisc_registerI2C_DRV_WaitWriteEndgpioi2c_lockI2C_DRV_WriteI2C_CloseI2C_DRV_WriteConfig,pinmux_16D1_LCD_hi3521.sh9Y'X8Y-#pin select muxctrl_reg0 himm 0x200f0000 0x00000000 #VIU0_CLK / GPIO12_0 / / muxctrl_reg0 himm 0x200f0004 0x00000002 #VIU0_VS / GPIO12_2 / VIU0_CLKA / muxctrl_reg1 himm 0x200f0008 0x00000000 #VIU0_HS / GPIO12_3 / UART2_RXD / muxctrl_reg2 himm 0x200f000c 0x00000000 #VIU0_DAT15/ GPIO0_0 / / muxctrl_reg3 himm 0x200f0010 0x00000000 #VIU0_DAT14/ GPIO0_1 / / muxctrl_reg4 himm 0x200f0014 0x00000000 #VIU0_DAT13/ GPIO0_2 / / muxctrl_reg5 himm 0x200f0018 0x00000000 #VIU0_DAT12/ GPIO0_3 / / muxctrl_reg6 himm 0x200f001c 0x00000000 #VIU0_DAT11/ GPIO0_4 / / muxctrl_reg7 himm 0x200f0020 0x00000000 #VIU0_DAT10/ GPIO0_5 / / muxctrl_reg8 himm 0x200f0024 0x00000000 #VIU0_DAT9 / GPIO0_6 / / muxctrl_reg9 himm 0x200f0028 0x00000000 #VIU0_DAT8 / GPIO0_7 / / muxctrl_reg10 himm 0x200f002c 0x00000000 #VIU0_DAT7 / GPIO1_0 / / muxctrl_reg11 himm 0x200f0030 0x00000000 #VIU0_DAT6 / GPIO1_1 / / muxctrl_reg12 himm 0x200f0034 0x00000000 #VIU0_DAT5 / GPIO1_2 / / muxctrl_reg13 himm 0x200f0038 0x00000000 #VIU0_DAT4 / GPIO1_3 / / muxctrl_reg14 himm 0x200f003c 0x00000000 #VIU0_DAT3 / GPIO1_4 / / muxctrl_reg15 himm 0x200f0040 0x00000000 #VIU0_DAT2 / GPIO1_5 / / muxctrl_reg16 himm 0x200f0044 0x00000000 #VIU0_DAT1 / GPIO1_6 / / muxctrl_reg17 himm 0x200f0048 0x00000000 #VIU0_DAT0 / GPIO1_7 / / muxctrl_reg18 #VIU1 muxctrl_reg19 himm 0x200f004c 0x00000000 #VIU1_CLK / GPIO12_1 / / muxctrl_reg19 himm 0x200f0050 0x00000002 #VIU1_VS / GPIO12_4 / VIU1_CLKA / muxctrl_reg20 himm 0x200f0054 0x00000000 #VIU1_HS / GPIO12_5 / UART2_TXD / muxctrl_reg21 himm 0x200f0058 0x00000000 #VIU1_DAT15/ GPIO2_0 / / muxctrl_reg22 himm 0x200f005c 0x00000000 #VIU1_DAT14/ GPIO2_1 / / muxctrl_reg23 himm 0x200f0060 0x00000000 #VIU1_DAT13/ GPIO2_2 / / muxctrl_reg24 himm 0x200f0064 0x00000000 #VIU1_DAT12/ GPIO2_3 / -: / muxctrl_reg25 himm 0x200f0068 0x00000000 #VIU1_DAT11/ GPIO2_4 / / muxctrl_reg26 himm 0x200f006c 0x00000000 #VIU1_DAT10/ GPIO2_5 / / muxctrl_reg27 himm 0x200f0070 0x00000000 #VIU1_DAT9 / GPIO2_6 / / muxctrl_reg28 himm 0x200f0074 0x00000000 #VIU1_DAT8 / GPIO2_7 / / muxctrl_reg29 himm 0x200f0078 0x00000000 #VIU1_DAT7 / GPIO3_0 / / muxctrl_reg30 himm 0x200f007c 0x00000000 #VIU1_DAT6 / GPIO3_1 / / muxctrl_reg31 himm 0x200f0080 0x00000000 #VIU1_DAT5 / GPIO3_2 / / muxctrl_reg32 himm 0x200f0084 0x00000000 #VIU1_DAT4 / GPIO3_3 / / muxctrl_reg33 himm 0x200f0088 0x00000000 #VIU1_DAT3 / GPIO3_4 / / muxctrl_reg34 himm 0x200f008c 0x00000000 #VIU1_DAT2 / GPIO3_5 / / muxctrl_reg35 himm 0x200f0090 0x00000000 #VIU1_DAT1 / GPIO3_6 / / muxctrl_reg36 himm 0x200f0094 0x00000000 #VIU1_DAT0 / GPIO3_7 / / muxctrl_reg37 #VOU1120_CLK internal sync himm 0x200f0098 0x00000002 #GPIO12_6 / VOU1120_CLK / LCD_CLK / muxctrl_reg38 himm 0x200f009c 0x00000002 #GPIO4_0 / VOU1120_DAT15/ UART3_TXD / muxctrl_reg39 himm 0x200f00a0 0x00000002 #GPIO4_1 / VOU1120_DAT14/ LCD_DATA_G1 / muxctrl_reg40 himm 0x200f00a4 0x00000002 #GPIO4_2 / VOU1120_DAT13/ LCD_DATA_G2 / muxctrl_reg41 himm 0x200f00a8 0x00000002 #GPIO4_3 / VOU1120_DAT12/ LCD_DATA_G3 / muxctrl_reg42 himm 0x200f00ac 0x00000002 #GPIO4_4 / VOU1120_DAT11/ LCD_DATA_G4 / muxctrl_reg43 himm 0x200f00b0 0x00000002 #GPIO4_5 / VOU1120_DAT10/ LCD_DATA_G5 / muxctrl_reg44 himm 0x200f00b4 0x00000002 #GPIO4_6 / VOU1120_DAT9 / LCD_DATA_G6 / muxctrl_reg45 himm 0x200f00b8 0x00000002 #GPIO4_7 / VOU1120_DAT8 / LCD_DATA_G7 / muxctrl_reg46 himm 0x200f00bc 0x00000002 #GPIO5_0 / VOU1120_DAT7 / LCD_DATA_B0 / muxctrl_reg47 himm 0x200f00c0 0x00000002 #GPIO5_1 / VOU1120_DAT6 / LCD_DATA_B1 / muxctrl_reg48 himm 0x200f00c4 0x00000002 #GPIO5_2 / VOU1120_DAT5 / LCD_DATA_B2 / muxctrl_reg49 himm 0x200f00c8 0x00000002 #GPIO5_3 / VOU1120_DAT4 / LCD_DATA_B3 / m- :uxctrl_reg50 himm 0x200f00cc 0x00000002 #GPIO5_4 / VOU1120_DAT3 / LCD_DATA_B4 / muxctrl_reg51 himm 0x200f00d0 0x00000002 #GPIO5_5 / VOU1120_DAT2 / LCD_DATA_B5 / muxctrl_reg52 himm 0x200f00d4 0x00000002 #GPIO5_6 / VOU1120_DAT1 / LCD_DATA_B6 / muxctrl_reg53 himm 0x200f00d8 0x00000002 #GPIO5_7 / VOU1120_DAT0 / LCD_DATA_B7 / muxctrl_reg54 #VGA himm 0x200f00dc 0x00000002 #GPIO13_0 / VOU1120_HS / VGA_HS / muxctrl_reg55 himm 0x200f00e0 0x00000002 #GPIO13_1 / VOU1120_VS / VGA_VS / muxctrl_reg56 #BT656 himm 0x200f00e4 0x00000002 #GPIO12_7 / VOU656_CLK / reserved / SDIO_CCLK_OUT / muxctrl_reg57 himm 0x200f00e8 0x00000002 #GPIO6_0 / VOU656_DAT7 / LCD_DATA_R0 / SDIO_CARD_POWER_EN / muxctrl_reg58 himm 0x200f00ec 0x00000002 #GPIO6_1 / VOU656_DAT6 / LCD_DATA_R1 / SDIO_CARD_DETECT / muxctrl_reg59 himm 0x200f00f0 0x00000002 #GPIO6_2 / VOU656_DAT5 / LCD_DATA_R2 / SDIO_CWPR / muxctrl_reg60 himm 0x200f00f4 0x00000002 #GPIO6_3 / VOU656_DAT4 / LCD_DATA_R3 / SDIO_CCMD / muxctrl_reg61 himm 0x200f00f8 0x00000002 #GPIO6_4 / VOU656_DAT3 / LCD_DATA_R4 / SDIO_CDATA3 / muxctrl_reg62 himm 0x200f00fc 0x00000002 #GPIO6_5 / VOU656_DAT2 / LCD_DATA_R5 / SDIO_CDATA2 / muxctrl_reg63 himm 0x200f0100 0x00000002 #GPIO6_6 / VOU656_DAT1 / LCD_DATA_R6 / SDIO_CDATA1 / muxctrl_reg64 himm 0x200f0104 0x00000002 #GPIO6_7 / VOU656_DAT0 / LCD_DATA_R7 / SDIO_CDATA0 / muxctrl_reg65 #SIO0 himm 0x200f0108 0x00000001 #GPIO7_0 / SIO0_RCLK / muxctrl_reg66 himm 0x200f010c 0x00000001 #GPIO7_1 / SIO0_RFS / muxctrl_reg67 himm 0x200f0110 0x00000001 #GPIO7_2 / SIO0_DIN / muxctrl_reg68 #SIO1 himm 0x200f0114 0x00000001 #GPIO7_3 / SIO1_RCLK / muxctrl_reg69 himm 0x200f0118 0x00000001 #GPIO7_4 / SIO1_RFS / muxctrl_reg70 himm 0x200f011C 0x00000001 #GPIO7_5 / SIO1_DIN / muxctrl_reg71 #SIO2 himm 0x200f0120 0x00000001 #GPIO7_6 / SIO2_XCLK / muxctrl_reg72 himm 0x200f0124 0x00000001 #GPIO7_7 / SIO2_XFS / muxctrl_reg73 himm 0x200f0128 0x00000001 #GPIO8_0 / SIO2_R-: CLK / muxctrl_reg74 himm 0x200f012c 0x00000001 #GPIO8_1 / SIO2_RFS / muxctrl_reg75 himm 0x200f0130 0x00000001 #GPIO8_2 / SIO2_DIN / muxctrl_reg76 #SPI himm 0x200f0134 0x00000001 #GPIO8_3 / SPI_SCLK / muxctrl_reg77 himm 0x200f0138 0x00000001 #GPIO8_4 / SPI_SDO / muxctrl_reg78 himm 0x200f013c 0x00000001 #GPIO8_5 / SPI_SDI / muxctrl_reg79 himm 0x200f0140 0x00000001 #GPIO8_6 / SPI_CSN0 / muxctrl_reg80 #himm 0x200f0144 0x00000000 #SPI_CSN3 / NF_BOOT_PIN4 / CLK_TEST_OUT0/1/2/3 #I2C #himm 0x200f0148 0x00000001 #GPIO13_2 / I2C_SDA / muxctrl_reg82 #himm 0x200f014c 0x00000001 #GPIO13_3 / I2C_SCL / muxctrl_reg83 #HDMI pinmux -uboot #himm 0x200f01cc 0x00000001 #GPIO11_4 / HDMI_HOTPLUG/ muxctrl_reg115 #himm 0x200f01d0 0x00000001 #GPIO11_5 / HDMI_CEC / muxctrl_reg116 #himm 0x200f01d4 0x00000001 #GPIO11_6 / HDMI_SDA / muxctrl_reg117 #himm 0x200f01d8 0x00000001 #GPIO11_7 / HDMI_SCL / muxctrl_reg118 -:hi3521_aenc.ko9Y9Y9Y̠.ELF(Z4( -L -L -L 3@ -LMPQ" 0_Ϡ 0#(P   0 K 0 @0@ 0 @0JJ 0 @0@ 0 @0JJ, 0-LMP0Q _ϠP@## :( S: 0PK \0*Q0a\:0H1H!  @ 1! J!0 @0 @J!0 @)0 @@J!D0 @1 0 @@J~, -L MPP\1 @ 0 @0JJ K1_O0$`PO P! IPpP0DQQ W_PP P M0X1x1  ! !, -LMp `X(H PN`PD PX@=Z ( P?`Q '@ P(P3` R P@X"( P&`0SX @P @@ 1@@@@X @PP@X$KX @P @@ b?@ -LMR@pS Qd_o& 1S{0Q $P@@ (P0 PK00 S.Y) I 4   X*4Z    X:00S(`XXP 0!R F 0!(K44 !Ph a  h F 0.: H1 @O0 @J1 @I 0 @0JJ0 @Z0 @ΠJ@@d F2@@@@@@< E2@@@ '>PP@P, -LMP`PQ _Y"000 4 @PO)(IPH`0Sj @Yp X. (P:` Rb @pY"4@0 xA0(K@XP9@(pP`P) @Y(P `^ @(pP P1 @@0 @0JX@P 0 @@X@P X@P 0 @ 0 @0JJD0 @ 0 @0JJ,/ -L4MPH H R 3_O44 `P$ P}?pPF@K @P L !RJP PB 0^? X1S<  \ P O(KP$ P0L< 8 40 00 P 0^ X1S e  !R 0!R X^ Z* pP_ h HH3Hx!1 @ 0 @0JJP1 @ 0 @J 1 @ 0 @0JJz 0 @ 0 @Od!`0 @ @J.:Q@@ 2@@@@, -LMP`2 @ 0 @0JJ(K2_O0$PpPO P}  q!F 00DQQ8 Pq WoP) Hp 0p p X0^p pp  XPI ! @P' `J`pZY` ``ppZP !rn@@8 #>@@@ !2PP@P, -LMP@3 @ 0 @0JJ(K_XP`P Opp@l03/0 !Rc Q` ??@0   Rb( b\A! R8 l!!`1 @0 @Jo(p\%: g\b@hpWpnpX. W" Tp D D!!I(p\*@@@` 0``@`@@8 0PP@P@@ 0@@@@, -LMP0 @ 0 @0JJK_OhPp`PO0  R !!, x-L``@.: 0SxPP@@l 1/P@ T x/ -L$MP@Pt2 @K 0 @0JJ(K_, `pPO  0 000 4 4 PR] 0 S3^"Y  &   @8 848 8H1 @j0 @  @8 8@ <0 8 <00,P (0 @000800P0$ 040 00 0  !40 @[0 @p(, -LM10DQ0hk 1h0DQD $hHQW L\J 1 0H\  D\O !\I \D \$@A0 K  DQ 0D\ 10D\D\  D\ D\h@ @ PK DQQ  0-L P00Q P@@ @@P0L00 0-L P0 0Q P@@ @@P0L00 -L0PQ   -L0PQ    -LP -LP -L@PP00 -L@Q`< ` 0P0PP 0pP/ X*Vp# V FpP pp0R  V0P 00 0pV 0pP0.: ` -Lf 0-LM@f  0@@@@PPP!@@@ 4m-0P0@P0PK0) 0 @0@) f0 @) 0 @0@) @f -L,M pp@4; R   0;牑@ p @@@ r r 4[\ @@ !(K0kppg 00p@\ < \L 4P @@0 P8 !P_O U@; ` qW 0Z \ WPx^X!RpP 0Z 0c,( `, 0c0aP)2 @) 0 @@!p@q p8<P 0;P,040 !SOSQW- SU0 @ <0 0h 1h @ D 0D0 L LH $L aHL H 0@QCQ7@8000P,   @!2 0 20 q PK0 @2  @0<<9AQ@8`0 @* 0 @@@ 0``@`H1X -L@@@ 1PP@P@@d g5@@@@ m1``@`@@ V>@/l -LMpp@000 0 傂@A |0 P;P h@Q ~$ P/@ P`a p P!P 0ha r PP U@0 0 P (0(0,0(K@@ ?@ x-L@@@<[8k000x x-LP @@@m=`A/2`Q 4  !x<@C0!x -L M0 @@@@8kp  <PP( 0@`pP0pp@P@`0 U K)x0 @) @ J<0) @) @ J p-L M0 @@@@((0s- ( PP 5 ` (00+ $[.:,P`0 Q  PP0 S `VKp)x0 @) @ J<0) @) @( J -LM0 0 P @@@m-`1`P p!K!p@$0 l,K, K(0 003/P )0 @-) @ ppJm pP pP 00@4+ppp 0-LMP )0$ (0  @@@(PK l\   K03/l] K03/K0@@@(PK l]  KFile name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/aenc.cAeChn >= 0 && AeChn < AENC_MAX_CHN_NUMaenn poll, chn %d not create [AENC] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:46] -----AENC CHN ATTR-------------------------------------------------------------- %5s%8s%8s%8s%8s%8s%8s%8s ChnIdPlTypeBufSizeAttr1Attr2Attr3Attr4Attr5g711ag711uadpcmg726amrnbamrwbaaclpcm mp3%5d%8s%8d -----AENC CHN STATUS------------------------------------------------------------ %5s%12s%12s%12s%12s%12s%12s RcvFrmEncOkFrmErrBufFullGetStrmRlsStrm%5d%12u%12u%12u%12u%12u%12u AENC mod have init already! HI_SUCCESS == s32Retthe frame is not a VB block for VOIEAenc chn%d is disalbeNULL != pstNodeAenc chn%d UserFrmBuf is full aenc chn %d has not been created! the stream's u32PhyAddr(0x%x) is illegal for AeChn %d! the stream's u32Len(0x%x) is larger than CbPackLen(0x%x) for AeChn %d! %s err! Len must be multiples of word(32-bit)!MPP_DATA_AUDIO_FRAME == enDataTypeNULL != pDataaenn chn %d has not been. : created! point num (%d) of this frame is larger than MAX_VOICE_POINT_NUM(%d) for voie encode ERR!!! Aenc chn%d invalid addr:0x%x NULL != pstAencChnAenc chn %d is disable! busy list empty Aenc %d GetFrame failed aenn chn %d stream buf is empty and timeout aenn chn %d has been destroyed 0 != stRdInfo.u32Len[0]0 != stRdInfo.u32PhyAddr[0]0 == stRdInfo.u32Len[1]ioremap_nocache fail, AeChn:%d Error! Length of buffer must be multiples of word (32-bit)! Error! Lenght reserved in buffer must be multiples of word (32-bit)!VALG_CB_Init_Master fail, AeChn:%d AencDoIoctl: ERR IOCTL CMD 0x%x, Type:%d,(%d), NR:%d VOIE[Func]:%s [Line]:%d [Info]:VOIE Irq %d request failed VOIE hal init failed AencChn%d's stream buf is full! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/voie.cNULL != pstNodeAencChn%d's AUDIO_BIT_WIDTH for voie is not 16! AencChn%d's sample num of a frame for voie illegal! voie config error! voie check error! (u32StrmLen+sizeof(AENC_STREAM_HEADER_S)) <= pstAencChn->u32CbPackLenHI_SUCCESS == s32Ret%s err! Len(%d) must be multiples of word(32-bit)!/home/pub/platform_h3/mpp/code/mkp/include/valg_ext.h0VOIE_STATE_BUFVOIE malloc failed ioremap voie list buf failed VOIE_LIST_BUFget mmz name fail! hi3521_aencGNU%b琴K<3w҂A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpth. :read)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4F }P!)F@% H8,G\4 L(CHKdJT2Kh glUc tH qV$m  $W$HW$KHWpHW/wW9Yx] s (*@7A F\S ] bTe jt( b8<b(0by*@ bhll@ T b$ p. :          ` \ ( 0 8 @ H &P ,T 2d 8  >p D J P V \ b h  n bLPt4 T b  b   b  l    b   8 b8Dbb|    b$` b ,    b b##  l P 8 b&&b''b8(<( #, ) / b**5P b;JY,h< wH T ` l   +:I(Xj|1b h h(  b b,///// /. :,/5A S/)41] 7<e t     \  b55b68   0 x b;;b =$=  $ b@?D?8D b@@T b Bb<7< FHUXdls b b///(B7 Kb K K+* ,>$,*(+?,,?0+@4+A8,@<,AD+BL,BP+CX,C\+Dd,DlH+E,EH+E,E4HL`+d,t+ x, +H,H+,G+D,D+, - A4 +8 ,D @L +IT ,IX @` +"d +#h ,"l ,#x +J| ,J 6  + , +D ,D + ,\   - $ h     +" +# ," ,# +J ,J 60 d t +"x +#| ," ,# +J ,J 6  9 9@ 9d 9| + , @ +R ,R @ J MDEh +,@+S,S@ +,@+,@  +$,0@@+TD,TH@d+h,t@+,@+"+#,",#+U,U6+, @+ ,(@TJ  +X,X@( @ P+T,`@p+Yt,Yx@ +,@+Z,Z@ +,@+[,[(@8<@l+p,|@+,@JC181DP`<h<p = <.):  Hx+"+#,",#+J,J6DT+"X+#\,"`,#l+Jp,Jx6|?BMDXWd W W TlxEW+,@+b,b@+ ,,@8+@,H@d+h,t@+c,c@+"+#,",#+d,d6+"+#,",#+e,e6+"+#,",# +U,U6 xJ99W$, D9`999+,@+h,h @ ,9D+H,X@h99+,@+,@+,@+,@ $(pJ+O,OBB J$B\B(W4 D \+`,l@x+,@ +,@+k,k@+,@ +,@4D+H,T@h+ll,lt@ +,@+m,m@+"+#,",#+n,n6( +, ,8 @D +L ,T @| J   B!!W(! P!d!Wp! x!!W! !<!B!!W!  "4"W@" H"X"Wd" t"<" " "#"+""+#","",#"+J",J"6"+""+#","",#"+J",J"6##4#+8#,D#@P#+X#,`#@#J#+ #, ($ `$h$J$ $+$,$@$+s$,s$@$+$,%@%+t%,t%.*: @P% d% t%+x%,%@%+Y%,Y%@8& \&+"`&+#d&,"h&,#t&+ux&,u&6&+"&+#&,"&,#&+v&,v&6&+"&+#&,"&,#&+w&,w&6&&'+','@'+$',,'@X'J''' '''+','+ ', '( ((((S8(h(+l(,x(@(+(,(@(J()P)+~X),~`)@p)|)) )+),)@)+),)@)+),)@)=* * *+*,*@*+*,*@**\++++,+7+$<,/H,RT,3`,l,,,8,,,Q,0,C./X/=00 ,0+40,<0+@0,H0,T0F`0+d0,t0G0+0,0+0+0,0,0@0+0,0@0+0+0,0,1@1+1,1@(1L1+P1,1+1,1+D1,D1+1,1.1!2+*(2,*2B2B 3+3,3@(3+03,43@\33+3,3x4+|4,5 5+ 5,,5@05+85,D5@d5+h5,5+5,5@5+5,5@5+5+5,5,5+5,565556+6,6+6X6+*`6,*6777 77777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7777777777777777777777777777.?:7777788l8W8+8,8!99W :+(:,4:@h:+l:,x:@:+:,:@:+:,:@:+:,:@:+:+:,:,:+:,;6;+;+ ;,;,;+ ;,(;6,;+0;+4;,8;,D;+H;,P;6T;+X;+\;,`;,l;+p;,x;6|;+;+;,;,;+;,;6;;;;+;,;W,<Wd<W<W<<<+<+=,=,=+=,=6 =0=+4=,D=L=x=+|=,=S=:='=(=>=>+>,>+ >4$>,@>X>>`>|>>>>>>>+>,>@>+>,>@?+?,?@ ?+$?,(?@0?@?`?+d?,h?+l?4p?,??=H@+L@,X@@d@+h@,l@@@+@,@@@+@,@@@@@+@,8A+   @ @p i %8 i @0S8 S S D@H\ P0 ` ` P,pp p)(@$P(P$,`HV7 d AT Pu0S0 @ 0S P, XL0 0R$(   P.0 @  P`p p@$P(P,HV@p@dP`@`@ 0@ @0@`\ 40@ 8<``@ DHLP``T X$\(`,@\ 40@ 8``<@ DHL``PT X$\(``,`@HT@@ @ @00@@@@``@@@@\ d0@ Sh0 0lp tx|儐 $匐(,@\ d0@ Sh0 0lp tx|儐 $匐(,@HT@@T  ` \@X` @ @T0@@` ``@ `@@@@d @@h@ @@` `@$`@@(@p @!R pWG @HTp !R Q 0`\p娀2*:崐L H P D @P @ p PpKC` $(p 0@T @Pp Pp$($p(p ,p꜐ 0D \㠀H L `娐尠崀pp` `x P D P@@H@ Lpp `$(HT@p@@@ @ @ 0@@@@@` @`@`@@@@`@`@`@@ @@`$@`@@ @\ Q( @HTE \ 0S0@ 01|0  $P  0@0@1|0  $HT@` T@` d @h00@@`@@@@@ @\ X" @HT; \  R0@ 尐 |崐 嘀圠娐 0@@Ⱐ |崠帐 嘀娠嬐HT@X\` @ @00@@`@@@ @``@`@ta܁㠡㰑^ p0@ (#5LŠ,Š ,Š ,Š   @^ p0@ (#5LŠ,Š ,Š ,Š   @HT@` @ @00@`@`@``@ `@@aR R @1S  R% R Q @HT7 1S  R Q0@ 5.NN.Š 2): R0@ @5.NNœ, HT@` @ @00@`@`@``@ `@``@`@@aR Qa @1S  R5 R RM @HTG 1S  R P0@ 5 œ@ 000@ 0r P0@ @5 HT(K@ 00@ 00@@ 21pp@pp -L4MQ! GP @1SJ @@KP K0 @JJP @J -L@0 @2`KPdtP0 0,3 H0PD$p c 4Pp 3 8  < ! @ @LP T \cd0htl0@(@X```@|@@pPԠ PPP夀娠 0x0̐0P䀌0pZ@@``@@qp0P8L!,1X!! 1$1(a04aDH!<1Ta舠P XXP p0801Aa ,d -L MP@ 3T `T  0 @0@I0 @K -L M@@@2S P Q "R  @  @K@,0 @U  @ 0-LMPP@M QA 00@ P P ' K@PK00 @_Ϡ2<:   @0 @A@ @@@J0 @] @@@@8 i1@@@@@@ Z?@ -L$MPP( Q0 0@,@K p0$ ``@0  0  d0   0  0  0  0  0 $ 0 ( 0 L 0 P 0 T 0 X 0 , 0 0 0 4 0 8 0 < 0 @ 0 D 0 KXHdpN Y0 8 0 4 0 D 0 H 0 Kφ L@  p@8  0  0  0  `@0 Ppp0(K@@< 1@@@ A?@@@@ -LM@ `KPP0#(2K >  0 Pp& @? 0@T P@ 0  $@ PK%K @ @@@ 1@ -LP 00@@@J2 @@P  @  @ -L@P2&:  @ p-L MPPY @@@2SE KK0u!`P% PU  @PR0 @„ @PKp  @PP  @R  @P0 @Ϡ @P @PPJ x-L0@SxP` P<4 U 80P,($x -LQ I @A0`P0p S3*QV 0 S1*Q0 S0l P"`%0`"`% S:`Q0l`P`U0p 0p00@@ T@l 0%3#0"@%0%P0l`0lP`` @ -L0`S S1  G-0 01  !001  ! 0$0 -LPP -L0S S$ \  \ \  \ \SS, \ \  \ \ \S S S@ SO S' Sd Ss  0R$ \(0\  R R $0\  R R $0R \0\  R 0P$0\  R 0R \ ,0Rz  \v$0\r ( Rn 0Rj P ,0Ra \] 0\Y  RU $ RP (0RL \H0\D  P -LGP00@!RJ  1F@@  !!0 @23: J -L M0@@ SQ R 004488 <<@@DDHHLL PP$$TT((XX,,\\`` S,)`****`+))++)) )`*ddh0h0llp0p0ttx00x0|0000000KJddh0h0llp0p0ttx00|0x0|00000000000000phl0d0ttx0x0dlh0p0||0000lld0d0hhp0p0ldt0h0l0p0t0x0|00000000ldp0h0tlx0p0t0x0~d0d0hhl0l0ppt0t0ldp0h0ttx0x0dlh0p0|00^ @JV 0 @0@/0 @ J@ -L M@@ PMQC R? 004488 <<@@DDHHLL PP$$TT((XX,,\\`` P9.`//000.01t1.0-`/d@ 0d@h@h@l@l@p@p@t@t@@x@x@@|@@@@@@@@@@@@|000000000KJd0d0hhl0l0ppt0t0xx0|0| 0000000000000000h@p@dlt@t@xxp@h@ld|@|@@@@@ 20: 00lld0d0hhp0p00dd0 0hd@l@dph@t@h|00xl@@p0t@@@x@0|00000000ohd@pdh@@d@lltpxt|x d0d0hhl0l0ppt0t0txx0|0| 00000bhpdlttxxphld|| } @J$H0 @J0 @ J -L M0@@ SQ R S;|320333t4p3 4,42p33|3200 00$,50 00K00 0 0 0000 00 ,50,J00 00,$0S- 00 00 Š 00$P  00 0 0  50 $P000 00$,50 00 @JH0 @0 @ Jt  -L M0P Q @ D R R 66567l7578 85566      0 0K0 @J` T@@@     % \  R00$0` T@@@      Š$  0 0 `        Š R  \00$0#     %$ 0 0 2%:   0 0x h0 @0 @ J] @JU -LM0P@`S Sp` #Scp`E0S 0PQ4 R\80S Pj<Qg Rf@\c0SbDP_Q^H R[\ZL0SW PVPQS$ RRT\O(0SNXPK,Q\ R ` \D0SP ,*|0Sp2A2Pl Rd0CcPh 0RA:dR?tQx0@(CR0VIWG: S: S3p`S 9 @Ϡ @JKP9 @  @J0SPa0@(CR PPU Q"|0 Sl VW:pt0Q :R:V3W1:Rx SQ:d0CcPh RK:dRIUM dR0dSPd\PdPPdQP dRP0dSPd\~PA7 @0 @JPT7 @  @0JhPPULAP RE6 @0  @JFt6 @!Π @J6 P,6 @ 0 @PJ 5 @Ϡ|0 @PJ PPPPPP P P}L5 @"`0 @ J5 @h0d @dJ42%: @0 @J`4 @f tlp0 @B 4 @_ l0 @3 @Ϡ tpx0 @$3 @n t0 @t3 @60 @Jt03 @t03 @dh02 @x0 @@ɠJI2 @ p0 @J8@2 @d0 @cJ#1 @ l0 @%1 @.01 @F0 @ J81 @?0 1 @u @J 0 @Ϡ0 @0 @ Jd0 @W |0 @,0 @%Π 0 @( -LMP Q  0R KT0 @ @ J @J8 p-L MGP500@!RJ) @ ! r: ,XL!hq QQ Pa PaQ  Q\1:E͂Q 1F͠d   !!Kp!0 @J@@ |=``@`@@d 0@@@< 0PP@P@@ 0@@@@XL 0-LMTpG d0\SX X 0Cd0\\R` ,@p6 P0HSD D 0CP0\HRL @@P0D P0UPLP(@4 80 BT00K0@@8 4@@@ 4@@@@ -LMP 0 ,00 00 00$0 K@@ r4@ -LM0@PpS `@tp h8 W@Dp HL0PD P0 QLP DL^@ DP ^ࠣLL0P D\@ DP \L0WTtQ pW7 Us TpXP\ ` 0d X d0Q`d X`^Tp Xd Q``0d XPTp Xd ^ࠣ`0UT1 %8%&Ȱ`v`000fP0f0 ` `0PV $K@@ 73@@@@@@ 0@@@d 0@@@< 0``@`@@ 0PP@PL -L MP@Q` Q Q Q pTt Y7 V TX`\`0dX d0 Q`d X`QT Xd Q``0d X\T Xd \`0VT &8 (0`0n2 3: 0`00` Sv: `p4p8pS p W p#9@@ 0``@`@@ 4@@@ 73pp@p@@l 0@@@8 0@@@@@@ 0PP@PL -L MP h0 R Sr Si x1\ (KSo S1 x1 \ R`RM4dp8`$<@pqhP(@`a@LlrD0P,Rp HL@00 2x`8Rt< 4"|@D2Pp倀T@"`ImRp@焀Xp`2\PpH2@`2`PL2@ 2 P 1 x1  1  1  1 @@ b3@ -LM`P P 3Pc K300 00@0 @0@ 0-LM@P{ 0@S*0CQA;P P%( B8r 2cR PE(6 @ @0<JK0P80s  C\ P uP:P`P 3P R񟗊tXWWWQ*`5 @&0 @J5 @  @0 KK0 S:S 0RfQ2 &:d: @J0 #ŠLQ  ARL4 @[ 0 @JK K0S:S QP:S$? !%BP3 @$0 @#5 PJYH3 @ @JI3 @ 0 @PJ52 @0 @ȠJ d2 @0 @J 2 @0 @<J1 @>0 @Jx1 @ 0 @@1 @o0 @J0 @y 0 @ 0 @3 @Jx0 @Q 0 @5@0 @ 0 @J -L M@P^ 0S@ #S, `S x1 @0 @K0S6 S9 S 1 @]0 @0S S S 0 @s0S  S  S  \0 @P P@@ I0@ -LMpQ@8 GP#00@!RJ P  0@`S0 @0 @`!JK0 @J!! @J( -LM`Q@P GP;00@!RJ P  0@pS12 <:  @0 @p!JKNQ0 @0 @!J0 @J!! @J8 -L MpQ@_ GP000@!R@@J P 0@` S)P P P 4 @P4! K1 @$0 @`!@@J0 @@@J0 @0 @@!@@JT0 @. @! @@@JH -LMQ@ GPA``@1SPPJ$ p  @P Q7P P P K0 PPA 1 @ @!(KX1 @0 @P!PPJ0 @PPJ0 @0  @P !PPJ PP x1A4  ! !L0 @\P  @ @PPJT p-L M@Q. GP00@!R@@J P aJ @P !Kp0 @@@JL0 @  @ @@@J` 0-LGP00@ATJ0F-0 4 E  PFU0  00 @J0 x-LGP@PP@aVJx 0S x0 @Jx!x p-L MQ R GPB00@ATJ' 0cXQS=  PP`VI cX0\02 ): `V^ SS  PJ X1 KpS1!0 !LAb0 @J1P`R=E ``C1 `aPP`V0SJ SE\0S>\>*0SH S00X0!X1 SS PX1X1`  PP \1`   R P' 0 `V:X10p\0S `V*0S0Ss\: @Jf -LTM00@ATJ$ Q_ @ RQ 0S S `S d;*@@@@!=:@@@@0!S0K \K 03/\0!0P!T D!@ <G-8 4!0 ,!( $!   0 @J @Jl -LPM00@1S Q @P  R RM `R @@@!9@!P  T !H L  D \!@ ^* $( < ,"8 04 4 0 8", <( I $ D" H L  P" 00 0TK3/ K!< 8  4 "0 ,  ( "$    "  00 J @J 0 @Jx -LM00@P`8 QJ Uo 8 Rl p AT| 00SS " !  |!P `S, H0 Kd12*:0QXH <  X< R  X    X0 hRX d1\S0CQd1\P`T0Xd1\`0 h\ p XPPQ-LQ A ER@0S B  ^ Q0 S B QR@D 0 Q BR@Q0S B  d1p!S +`\C@Q@  ^ Q Q@ QPTQX Q@PtTQ@ t 0S hPP8뀀 !(K4P% R"1 0\ XU F-\T0F\S N P0S  YL1I CR8@0 S B \ Y@0 S B YR@Dᔵ0Y BRDᔵDVX ^4\ Q! F=Q 0S\PYL I @R@0 S B \ Y@0 S B YR@Dᔵ0Y BRD!JP Tt10\   R: PI- 0l\1 LP^O!h1X80P  P! d1p!S`CAQpT RA ^ ST RA SQTX SAQX P: !P2?: YL I @R$@0 S B \ Y@0 S B YR@Dᔵ0Y BRDD1XQ BDDX! P: @JD@@ 9@@@@@@` 8@@@8 9pp@p@@ 9``@` 0-LM@Pp0t QS \ 0  4  8 <  @  D  H  L P $ T ( X , `Qzlzzz@d !K0c@8 d 00@0 @SP0 @@@ 3@@@@\`048 <@DHL P$T(X,@@ 3@ -L\MQP4 GP``@ATppJ XK pP| P ` pPX DQ ?Pz@4P PD "h XKJ͈` 4x hd `` d 0`` d dxF=h x 0F-@PP"  1P l0 l0x!Q @ A !@0SSJ SH (Kl4 @  @0 @ppJ00@4P^  0@ Rp P  Q``XKt J̈́xt`  !< 80R:<R03 @]80 @<8  800!2:q2 @  @( I(QJM `@  0 1!c2 @{p @ppJS @ppJK XKp F`h J̈́p 0 `4 X `@P&! P5Qhx1   h0! 0 @{p @ ppJh ! pX0 @  @pJ@@ ?<PP@P p-L MGP0 @QU@@J b0S@ Kp @@@JI (@P@ 40 @ @ -LLM`Q@ GPPP@1S d3 @0 @``J(KXK,  `P 2 @0  @ `Ph =?p PR@4Ps Ppp X\F FI-(0d h J4h`  XK< ` `  d0 P1PJ EX d q@4P !1 @0  @h0 @``J_p0 @h`0 @ ``JL @``JD80 @:0 @3 x-L 10R" \A` RcPC!PS,(0nP P PUxUxP C2: \Q`@Tc C PC -L00@ J0#RR ! -L00@J/0#P00P00 p-L M@Jo0PTP@,E#$s  0K@^02-0 ( Kp -LM 0`\ 3\ (K0S SQT Q,@EJ_$`x (Ȱ@_CK<P8P@@ᑎ) 4(+0K0  F 0 ` ! 0   002S88  !!ꐌ K0K08 K `J$P P@ȟ K"8@r I#@80 / <8噁 K0K0@ K F 0 ` ! 0   002S88 0KK0  -LM 0`\]Qf Q (K,EpP P@ȟKJ8"Ȱr`摔@<2 !20K 0,bᐐ`#K 0 8 8 ` `Ka 0   0` 2V880,0K#K 8 0ᜑ&8` K3\@TQ TpJ$P P@K<@8"Ȱr`@!/0K 0,bᐐ`#K 0 8 8 ` `Ka 0   0` 2V880,0K#K 8 0ᜑ&8` K`K -L,M p1P@  P!R+La^BF`0SL V S0SL S\ @qDᔵ02 : SL\ @a0SL(!D Z0 p , E$< H (080 ϠblV00C"@ ^ X1\ 0@(@2^2nBQ2-i4 4AHaB`ў L 0 0@Y  \ 00@  @P P W 0lAW@ XyZF <f38L 0pR R00  P P0 lc i hXHà X 1A4  (KDh\ 0O@D@nXڃ0S0 S Z4D <0a P P 08 A3R0H S 0(!0 D00p40$`H VL28 @0 < G^ࠣ^~(  Dq0 @@ @80@ -LlM P\`KpጠK@`  @`\ (K\0U0'X0U0#T0U0P0U0L0U0H0U0D0U0@0U0 <0U080U 040S 0 04H,K1gfF` %_NeK@@ @  30 -LtM @0`R R (K R R R\10!S$0(0000\} \ \ @J#!1q q$p (d ` 嘀t 圐x `l` php  PQ P(L\`A`IH R@ P V R@q  PR@ RP@D  PR@PDaJX! 0pp@S, `(  H`5 1EP RaL  `10S2:@P  0(KD` |  ?  ?  @0PK8 08@_@_2S\HK P2Π@ 0!#/1<0 00KK<@8  X.@ KP| \ | P \ \0\0\F\t0K< p B00K K\ "8|!@ @ Kp  Y \pR i တ p0D0 \>,,0WYCrC(Z a< h0P?Y ??@L! ?P?U U?0bڃ〠 ZZ< YY ^ Y YZ Z L`0 d0P(p3 P P  Rp R0 0L\0 RC3P0 $Dl ` lH?0^pPP P0$0P!prP @( 1 ep qpp `d` ` 嘀x 圐| t P h H PQP+LQA`EP@Q R@ P V Q@a  PR@ QP@D  PQ@PD JoX  (1R@$p `l0 `^D  `!0S@QK00 ?L`  ?  P?%K@ 08 08@_@_2S\0HK P2Π,@$K1<0 !<00K8 H X.H KP \  P -\ \\1\x\0 ?#K  x 00KI<噁K\ "8H,x倐 H K X\M 0h p \  P \ 0S0>3Y,0XCC(Z a< h2: 0W00C"L P?Z ??@! ?P?U 10bL`Xڃ㌀ XXPg  l 4apP W p1< d Q0P( 3 P PWQXp 3X00\0PC3D0 \$t ` `N30ZpXD D$D1L  U RQ1 0 \ Z)j`< 1 1Qj00K @\p". "pP>,,0WYCrCD  0D0 U L  X1 S<Sfdx ' @Q\00ê 0a00K B\ ".0S0>3,0PXCC\  0\0 j`< !01S101qD ꈁ!0l 1I#hPYpZP R >#, , SQB2BP!0 (04$L H| '@P\\ ղ 0` P D 8Dqt1!0tDL3`!ZpXD 0S0>3R,0QC"CD ( l$4 @@ @80PP@P -L$M0!0@ J0(8 Y`< ,0$0ʡJS0 SX v @@@ PAT D\L!TPp04  BGTppW R@Q Bp09LqP4p p TT4P@@E 0TD!E0@Q8gFfFF?<c4 (0@4 \ bZ@\3 8P Z"(KD@Qp0 BT^ R@DQ0p S2:T BP R<D0 40`SD0@YPDC(P`$`1T`ʈD0 D08dP`PPPPSE3SP000 @S @0 @ @DQS@@8 J0PP@P@@ 1``@`@Tl -LDM @J` ) 1, 04 pW8p VX v @0@  PAT DXTLPpNKT Z P@QQ@p=`p TNT phQ< H Dp  WDD@qQ\ P@ < (Sࠓࠃ0L Q= `p4T X0 \ T L0B0 0p\00SU(KDQP@Qp@T Z PP@DQPQpQT @Z PP(0SppQLp ,S5qW2 !p@\4 @S @(4 @ @g6f6F`r 4_Qe0X0\ `UT $XL (P 0 P: <PTpp W P2XQ<@HLl,ll0,\0\&l&,60Ɣxhl8Ƅ46hx1lhx  @x lhx"ba Plll hx p-L M,T@Ut0SLt@R1PhKp  @RQh-4S4U&0E0R3R2ŠƀQƀƀƀƀ&&6Õ6h„l hQhbj!a P h@@ G>@2: $ -L4Mb@V`bPdL "@ \0SpW ,XHraP\ R0 4 `P ,T`UPEP4` d!1P 0 4rz`WP p0~p4rQq P pspq*R`\pW hr8 `@Z0`< 4\?PppWt8<@ 2„(KP@2<Ğ0 ?pP?p D0`pD 4\ HP T X@ P ?`P;W9 H80pP D@<4P @ P ? T @O@@ d\\X@HP R pbL0`pPDY -L M`\0@rStRpgz R6@P2 ᘀZZ0Cp됒hRpiWp봢P㾠Z ,\L 䢐 X 0P=ʬ   Y PP P XrtRpr(K赟㹀Xu ,P@1䢓 X{ 0Pʨ   Y P먀PprjV `0 ~`2:4rQpq P ` s` q*Rh ` `  봂pB\L !< X (Pl P PwwꄅXH"< X' (P#l1P PXu2tRr:prjV ` ~1`4pr PqQ ` s1` q\hb `  봂p   0 0PP   0 0PP @  -L M0#P@SSy 0`(!A R_0R(p$ < P3 B aPʄ\}/l*?8 1"0S03': S03#:S03:bS03:rS032: :” S03: S03:$"S03 :(S03:,S 03:0bS 03 0#q8`l` r 120S C 2`\ R``pVt1 }刁d 0S q` @Hg0 0Pyldr刂匢b0S03': S03#:P0”\0"S03:bS03: S03:$S03 :(S03:,” S 03:0"R 0 08` `l2`ct 0PP00S!0 St`Pe`a? 0P 0| -LⰒ@pY `d`R"\Pbh0UPY$ 0  P|pW pp`  @2RPRt 0 u -LP\0@bSt`fi R2p@P2pڈpᘠ Wp Wp 0C` 됂h2`hV` rpWp ,tWpGp2p 0gS0cR0p0bPpa S1:S1S Rp[ PW WPVbtR`b/㲠Z/ ,ZJ p0jS0cWpE Q01:0Q01SH RppP h2”rtR` b"^N2:2 0V| S? 刡 ^  ^ pӔq m0`e`F\ @@嘁 a甡 p Wdd^ XjjSOL V `^@@ \ 0 0 `XddWcc00oS 2 !  `\ @ ` ^Wiix @ɯX@a@ao@00& x^\  X`` Wb b/O Sb  1  0S`T ^0ڐ0Q0 0 @\ 0Z 0TʄS[A ,@K1刡@ ^ RqQ`UK!娑 0 ^7 P @xA Q`@` 0Sg A^ 0Dt V PU N 0C^k q 䠜Z& N 0L^a p CNWP`@0Xq U`pxQ@W0i0iX@j@j䠜ßoZ!@a0PTxq @`SPP p Th hW0e0eO!0^uڐp\Aj,K@p@ph,K| Spp Ap,@K 1|q 夐q^|ڌnK0P @nph` U A lAxN d吁 V@ ^j jXiiOᔑ S!Q ^ XA0 V U0A Xj jKTii00O S!4 !  q   U Vpp @ ^j jXpgpgʯǟp00! U V q ^2": i iXbb/S!!qQxA\a2 |^0 :@T0# |0 `|0SZU|aժZ ժ0Z 0S| S[ @ Bp,PK ꄡZ00^0$ 10 AY 0\ 0SAS,PK@A @ Q 0\Z,K@P@@@ ꠡxQ@@P0 S  0QddSll_z|Q,@K| 1`P倡x@T`` @\ PPT@f@f \ e eį!^p -LMpc@PWWpp K觎Q|1{ r*4 08 Qp\`Q QQ \ڔ`0@@\| 80p:^ x-L B0@P2R=02 $"8(Bhr`D 0$05„!4 ńPN Ŕ`@x  @x  @x$!8A(q`D0 @$`P22RPU.4xx -L M0#p@S 1`V< 㴁 !GP1  dPl1 RPk X0Sg  } u`v1 ePqUur!Q 0S z1 V_/U 0VR``RPP0Qtڵ0S2~pQuPC\~S S 02#:2R0CS0AS50S$ڤP! 5峐Q`v 2 ㈢`dV Z !3Y !Pʰ”0LS(K\1UPP0SPU% %025z Pó„yr Q "i0Pڅa0WP` zsS 2S| 02z\z0"00wS 505yϠP0!SPPUh 02BPbS0Ca"a5S S S0Xs0SW[0";5 R0 %I F 0Ss0 %?@@ >C@ -L,MX1P0@S S S$ ^ pW?T Q ĒYbtbZ u?P- !!q00 S8 刂p4 # S; `S @@8/8``@`,tĂW G X8 b 㠁!0 004 S@ < -^ 8b<ˆ@0024  #-4SnP4dd 4p B`c-4e,0.s0,.-4Sm㷐Y^> `QA4t0Ę@'< *#xX0 A B 10c0S0S0Q00SR Q  X 1cXX P!Q31P00  ~0S 0 `X \ !10p2S\## ##"R -P\a2$: Q 02`„„2S02 -$R\Pt”`b`„(K0`S S @@$+j9@@@@tb̅?PÅ ! 0s넥4Z  J  PĈ80TtPP@P  @>C D -4 ,Z`J`^PL*8$0*l)\1`V.Q "P00 00 00X, `\L !r’蒒<`d0S S `S  @@@(%7@@@@~>{0`2_@r`d`㈢RJh H̅p PR02 pt0 0Wr* R q2%: 4 r:XqX  s1 q*X0 "r: S q !4 r XqX  s1 q X Lp0p ; C q; C4 -\ 0p8p V-p`F`W P 4P 800 8 0  az-\ pV`Fp!`-WD D a0]  @W?q8`p a # 3Wܢwpcp-.P"-ĕ\,t.ĕR4eZ a-4^Nq<bp0S SpptL`3`\!Ϡ1p”00 5%-4E?08 8 0 ꟯៏H HP P,Pa  ` L D0 H L0 0 HR<D0q R 00  %PP 0 0  !000 Y R0   0    @`t@@"S8@@@@@@#T8PP@P -L M `M? `p0S @0PL @0PD P@R pP< @0Ϡ 5!P$%8XE(uP2&:D D$ 0U# ń  @@0@0@ 0 K@|0 @Q @40 @K @ J -L@@@00 -L$MPP@ $ Q ? 0S 00@,P @,P P s`⚏M~< D 8p 9,@K@p000 $ 0  0  0  0 L 0 P 0  0  0  0  0  0  0  0  0  0  0  0  0 H 0 J 0 I  0 K `0  0 @Z p0 `0  0 @Z p`0 0 0  0 40 80 <0 0 0 0  0 0 0 0  0  0  0  0 ~/ 0 0  0  0  0 2': 0 8 0  0 < 0 0 @ 0 0 D 0 0 H 0 0 L 0  0 P 0 $0 T 0 (0 X 0 ,0 \ 0 00 ` 0 40 d 0 @ 0 G 0 S 0 H 0 T 0 I 0 U 0 J 0 V 0 K 0 W 0 L 0 X 0 M 0 Y 0 N 0 Z 0 O 0 [ 0 P 0 \ 0 Q 0 ] 0 R 0 ^ 0 h 0 t 0 i 0 u 0 j 0 v 0 k 0 w 0 l 0 x 0 m 0 y 0 n 0 z 0 o 0 { 0 p 2(: 0 | 0 q 0 } 0 r 0 ~ 0 s 0  0  0  0  0 E 0 F 0 D 0 _ 0 ` 0  0  0 T 0 V1p 0 Z 0 U 0 VϠp 0 [ 0 W?0 `0 d 0 Z/ 0 j 0 [? 0 n! 0 Π 0 r1 0 ]/ 0 v 0 ^? 0 z! 0 _Ϡ 0 ~1 0 . 0  0 m? 0 ! 0 nϠ 0 1 0 o/ 0  0 = 0 ! 0 qϠ 0 1 0 - 0  0 a? 0 ! 0 bϠ 0 1 0 c/ 0  0 > 0 !2): 0 eϠ 0 1 0 f/ 0  0 g? 0 ! 0 Π 0 1 0 i/ 0  0 j? 0 ! 0 kϠ 0 1 0 r/ 0  0 s? 0 ! 0 Π 0 1 0 u/ 0  0 v? 0 ! 0 wϠ 0 1 0 y/ 0  0 z? 0 . A0 /00@D0}@D/8@80 @ 8 @ 8@@d800@ <(K`N.D HG8 <@  @  J @@ @0@@@@ @@ @0@ -L\!0S !1  !1   -L$0(  -L 0-LM @]? P@0S @P 00@P P0 $ @ @(P@P K00 0 @0@ @ J -L@ 2*:-L`@Pp"4d 5,1E88h  h<<l@l@pD2pDtHtH xLxL(0|P|P0,T0T0XX0\\0`00`d0 -L`@"Pd @,Ep!Ȱ "Aq (p0,0$0 0000 00 00 1  -L(MŸ`PPDK @ U @? 0SI00@4PL P@Z "p ,p,51E p(ppp4 @d !00  P< 0@00E0@ @ @ 0$K@4P @1 @' @0 @ @ J0 @7 @ @@0PP@P @@0@ @ -L@X0PSp p$`0!qV*  0Rx* 0$`V9 p$p\! p`V E NnL(l0bSaQ(?LKSX`ࣚ 0dp` p W: W 151E  laX!pW 0S^p\!p ` p` ` V V V 0R:0R01\ 01  0R/* 0 S*! 2 00R01 0P7` h3>Cȁnx0೅`X``2+: ! S 1 2 00R01 0 S:1` Y5 1EAd aO0hCÁa`b -LR`@(,8ȌLx|(P pQ   0-L; C@+P@RPES0lR5ClB̠QTCQ4SS P K-S@@00 C(K0`K,PKp0Uq1p 0S  0B| XUq!p 00 Cr X.S +S-S eS.R +R-R eR@2. : 00S%(Pk,0S Sm*P jpPS:uP`pPe({pJm,Pp%e PD*P ApPP:uP+pe({p(P0_ D@1C@p `{M,0Sp PP -L -L -L;0CHS  0-LP@0 -L0 0 0 x-LP@`  x x-LP@`  x -LM@P`p, p( p $  p ,K K -LM@P`p, p( p $  p ,K K -L@`P`p p p   @P -L@P ``P0  pp 0 -L,M<`K` LPK@p  Pp  Pp 0    p  $< (8 ,4 80 <0< 4<4 P04< P4 <TL 4XH <\D 4H@ L2/:@< D<4 4 (K -LPPP@+ @0 0R \@@`\ @ p`W@ W 0 R  0R\ @@V@00@PP@P@ p-L0 0B+R-R|@ T  0B+R-R|@ TPp0BP0`10@ 0 0B| \0@-R-R+R\PS @0 D 0r R-T  -T+TRPU0`p -LΠ%0R%0QR -LΠQ  0P  -L,T0X"@UPE Pap0  S   RPA` -L,4@S C Q 2lubWU!1pGpUpld9%B1\p=e0Qa W0G0 !peZjZp S0C0 !p eR bRp PS0C0peQaQp"lt 0p^l , p0UpX``q0 x-L,4@ŐQR\1PS `l `P 8` Px -Ll!0I @@ -Ll!0S X Q r, -LMM@@@\`K0PpK`P`` K` SK 0? 0S @,Pq  @,Pi Pk s⚯M^@9`pO20<:  p  Opd  p   pd d $pd(dd ,dpd0  4p8  0@07 0`< pGpSHpTpIؐUpJpV̐KpWpLXpMpY崐NpZpO娐Pp\圐Qp]pR吐^LqhpHtDi@qup<j8v4qkp0w,l(qxp$m yqnpzoq{p p|qqp}rp~p@ps ED` 0_ 0Fp``  L p P p   p  p  p   p p`  0 KqHqJqIq`  AR` !q  0r ORV?V!Wdp`UqTqp[aZa`d `dP P!dKdP P1P P!~?!Kaq4P P =2\ "  8X „  <T21):  @P02  DL|  HH "x  LD „t  P@$p  T<0(2l  X8,h  \4 0"d  `04`  ZϠ[K0  r ]  _zdn0^ v1~d _? !m}?0o/n001pa?q}ϠcϠP 1 db/j!90Π000/pdeϠq0dppfg~0i0KqϠjϠ ppkqrϠ0s?~1uϠKv?pqw? y?dp(pz?ppΠ12

N N N N   RcGetVirInstBitsRCReEncDecisionMjpegVALG_QueueSearchFromHeadRCReEncDecisionVbrRCReEncDecisionCbrRCDecisionInitRcExpMpeg4GetCostFromQpAndBitsRcExpMpeg4GetBitsFromQpAndCostRCEXPGetTRRCExpPMhbParamUpdateEstRCExpPCostEstRCExpOutPutRcExpMpeg4GetQpFromBitsAndCostRCExpReEncodeRcExpGenOsdRoiParamRCExpSpecial23?: EstRcExpUpdateIResultRcExpUpdatePResultRCExpRQCalRCExpCriticalCheckRCDecisionExpCbrInitRCDecisionFileExpParamRCDecisionFixqpInitPPPPPRcDecisionExpVbrInit?@?@;?X@> N N N N   @0($ !$( 00@@P`@0(   0(@2RC_DRV_DecisionDefaultParamRC_DRV_GetSpecStatFromHistversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 rcunload rc.ko for %s...OK! Hi3521[Func]:%s [Line]:%d [Info]:Create rc proc err. rc register module fail. <6>load rc.ko fail 111! load rc.ko for %s...OK! [RC] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:47] ----- BASE PARAMS ------------------------------------------------------------------ %7s%7s%8s%6s%12s%8s%8s%10s%8s%5s%5s%8s%8s%8s IDGopStatTmViFrTrgFrProTypeRcModeBr(kbps)FluLevIQpPQpMinQpMinIQpMaxQp%d/CBRCBRV2%7d%7d%8d%6d%12s%8d%8s%10d%8d%5s%5s%8d%8d%8d N/A%7d%7d%8d%6d%12s%8d%8s%10s%8s%5d%5d%8s%8s%8s FIXQPVBRVBRV2%7d%7d%8d%6d%12s%8d%8s%10d%8s%5s%5s%8d%8d%8d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_ext.c0 -----RUN COMM PARAM ------------------------------------------------------------ %5s%10s%32s ChnIdQpDeltaThrdI(12)%5d%10d [%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d] PARAMThrdP(12)DEFAULTTXT%5d%10s [%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d,%3d] -----RUN CBR PARAM1 ------------------------------------------------------------- %7s%10s%10s%8s%10s%8s%12s%12s%8s%12s%8s%8s%15s MinIpropMaxIpropMaxStQpMaxPPDltQpMaxIPDltQpbLostLostThrIPDltQpQLevelMaxR24%:eEncTimes%7d%10d%10d%8d%10d%8d%12d%12d%8d%12d%8d%8d%15d -----RUN CBR PARAM2 ------------------------------------------------------------- %7s%12s%10s%10s%10s%10s%10s%10s%10s%10s%10s%10s SprFrmModSprIFrmSprPFrmRQRtio0RQRtio1RQRtio2RQRtio3RQRtio4RQRtio5RQRtio6RQRtio7%7d%12s%10d%10d%10d%10d%10d%10d%10d%10d%10d%10d -----RUN VBR PARAM -------------------------------------------------------------- %7s%8s%8s%12s%10s%10s%10s%10s%8s%12s DltQpChgPs%7d%8d%8d%12s%10d%10d%10d%10d%8d%12d -----RUN INFO----------------------------------------------------------------- %7s%14s%8s%8s%12s%12s%14s%10s%8s%8s InsBr(kbps)InsFrWatLCfgBt(kb)RealBt(kb)MaxRlBt(kb)StartQp%7d%14d%8d%8d%12d%12d%14d%10d%8d%8d -----RUN INFO2---------------------------------------------------------------- %7s%8s%8s%8s%8s%8s IpRtTrDeltaTbTarTb%7d%8d%8d%8d%8d%8d -----IMG INFO----------------------------------------------------------------- %7s%10s%10s%10s%10s%10s%10s%10s InterRlIntraRlInterSumIntraSumMvCntInterMbStatus%7d%10d%10d%10d%10d%10d%10d%10d RC NULL PTR chn id %d err NoneLostReEncode[Func]:%s [Line]:%d [Info]:enType %d for index err. Rc mode has not been loaded. module info has been changed... param release succesul ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_param.cHI_NULL != ppPtrHI_NULL != sInfo0find string 'mode_exp' err. Read exp param from file err. module type err. HI_NULL != pFileSrcfile error, too large size to read. malloc file size err. :,RC decision exp default param fail. RC decision module type %d err. RC decision default param init success. RC decision default param fail. RC config file name null. Rc param has been initialized. RC default param fail. RC init param default. RC read param form configuration file fail. RC init param from configuration250: file. param load sucessful chn id %d err [Func]:%s [Line]:%d [Info]:venc rc mode %d err, should be in [%d %d]RC NULL PTR RC Mode %d err enTYpe error in RcCheckParam Param Thrd set thrd[%d]:%d %d error for out of [0 ,255] Param QpDelta set %d error for out of [0 ,%d] eSuperFrameMode set %d error for out of [%d, %d] bLostFrmOpen set %d error for out of [HI_FALSE,HI_TRUE] LostFrmBpsThr set %d error for out of [%dk,%dk] IPQPdelta set %d error for out of [%d %d] MaxIPDeltaQp set %d error for out of [0 %d] MaxPPDeltaQp set %d error for out of [0 %d] MaxQp set %d error for out of [%d %d] MaxStartQp set %d error for out of [%d %d] MinQp set %d error for out of [%d %d] minqp set error for less than maxqp MinIQp set %d error for out of [%d %d] min prop set %d error for out ot [%d %d] max prop set %d error for out ot [%d %d] RQRatio set RQRatio[%d] %d error for out ot [0 100] quality level set %d error for out ot [%d %d] max re-encode times set %d error for out ot [%d %d] ChangePos set %d error for out ot [50 100] DeltaQP set %d error for out ot [0 %d] ABR not support now mode not support Param Chn type isn't be allowed to set. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/include/valg_tool.hHI_NULL != pstMatch!IS_FRACTION32(u32InRate)pstMatch->u32InRate >= pstMatch->u32OutRate/home/pub/platform_h3/mpp/code/mkp/rc/rc.cHI_NULL != pstRunInfopstQue != HI_NULLHI_NULL != ps32LostPicNumHI_NULL != pstCtxHI_NULL != pstStartOutPutHI_NULL != pstRcAttrHI_NULL != pstStaticInfo/home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hs32MaxLen > 0RC_MODE_FIXQP == pstRcAttr->enModeHI_NULL != pstRcCtx0gop %d err,shoule be in [%d %d]. stat time %d err, should be in [%d, %d]. vi frame rate %d err,shoule be in [%d %d]. target frame rate set error for out of [%d, %d] fraction target frame rate set error for out of [1/%d, %263: d] target frame rate:%d should less than ViFrmRate:%d enType %d isn't supported. bit rate set %d error for out of [%dk,%dk] flucuate level set %d error for out of [%dk,%dk] vbr u32MaxQp set %d error for out of [%d,%d] vbr u32MinQp set %d error for out of [%d,%d] vbr maxqp:%d less than minqp:%d vbr max bit rate set %d error for out of [%dk,%dk] fixqp I set %d error for out of [%d,%d] fixqp P set error %d for out of [%d,%d] RC mode error! Only support CBR/VBR/FIXQP RC mode error! Only support CBR/VBR/FIXQP. mode: %d err. type %d, mode: %derr. venc chn %d rc mode %d not support !!venc chn %d rc priority mode %d not support !!chn %d :rc mode is %d,which is FIXQP,HI_MPI_VENC_GetRcPara not support !! REV trans param err. chn %d :rc mode is %d,which is FIXQP,HI_MPI_VENC_SetRcPara not support !! rc trans param err. rc check param err. Rc get attr err mode %d not ready function: %s, line: %d, enType: %d err. type: %d err. pstStartInput->pstMadMseHistInfo->u32Length >= (sizeof(HI_U32) * (RC_MAD_HIST_SIZE + RC_MSE_HIST_SIZE))HI_SUCCESS == s32Ret-1 != s32IndexRc mode %d err. Trans attr err. RC attr err. RC static attr err. malloc new context err. init rc decision err. RCparam MinIQp :%d err out of [%d,%d]. RC_UpdateAttr failed. The chn %d has been created! chn %d trans users attr to interal attr err. chn %d user attr err. chn %d malloc failed! chn %d init decision context fail. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_new_cbr_mode.cpstQue != HI_NULL[Func]:%s [Line]:%d [Info]:bits fifo is empty. Because bitsfifo is empty,Recode failed /home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hs32Index >= 0%02x kfile_write: buf = NULL! rc decision chn close succesul ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_dec27&:ision.cHI_NULL != pstRcCtrlCtx[Func]:%s [Line]:%d [Info]:malloc rc decision context err. rc module %d err. rc mode %d err. rc decision create chn fails. rc decision create chn succesul RC TRB feed back mode error,use linear instead ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_decision_exp.cI_FRAME == enPicType || P_FRAME == enPicType0cost-cost filter mode not exist s32Count!=0rate control fail : max QP contrain and rate expire rate control fail: min QP contrain and rate empty rate control fail : bitrate and quality constrain error RCTLBStatus error I_FRAME == enPicType ||P_FRAME == enPicTypeuse max startqp %d to encode,outputsize: %d can't small than thresh bits:%d... entype %d err. %s %d kmalloc size : %d failaure reset data... RC control type error RC control type unknown 0!=pRcContext->stStaticInfo.u32MacroBlockNumthe first frame is not idr HI_NULL != pstRcExpCtxHI_NULL != pstRcCtrlCtxeRCCTRStatus mode %d error enType has been changed,encode mode not support [Func]:%s [Line]:%d [Info]:malloc cbr context error. Rc index err. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_decision_exp_param.cHI_NULL != ppPtrHI_NULL != sInfo0kmalloc for exp param fail. [Func]:%s [Line]:%d [Info]:malloc fixqp context err. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/rc/rc_decision_vbr.cHI_NULL != pstRcDecisionCtxHI_NULL != pstRcCtrlCtxCMPI_Kmalloc error, memory not enough Rc index err. Rc init ctx err. kmalloc with GFP_ATOMIC error,memory not enough [Func]:%s [Line]:%d [Info]:kmalloc for exp param fail. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/rc/rc_drv.c0dumpksem_up28&:ksem_downksem_initkfile_tellkfile_seekkfile_writekfile_readkfile_closekfile_open(?0?d,?B?X?o?[???<Ȁ?ހ??A ?!?8?hN?d?@{??(??Ձ??&??N?e?+}??(?Ç?5ۇ??S ?!?9?Q?h?e???nLj?#߈???]&?$>?U?m??f?A? ͉????,?D?\?t????Ԋ????#5?DM?je?}?•??+Ƌ?eދ???/'?z??W?p?v?Ҡ?3?ь??n??U3?K?Md?|?V?᭍?qƍ?ߍ??8?(?}A?%Z?r??:??Վ?t?;? ?8?Q?j?]?>?#? Ώ????1?J?c?|???Ȑ?/?M?n?,?E?^? x?X??Ñ?ݑ?a??)?VB?[?u?r?ڧ?F?ڒ?,? ?#'?@?+Z?s?F?٦?r?ړ??U ?&?@?`Z?t?ԍ??Y?"۔???(?tB?S\?7v? ? ?Õ?ݕ???+?E?`?z?-?G?fȖ????1?CK?}e???F?Η??8??7?SR?l?'?? ?֘?? ?&?@?,[?u?\??ř?F???Y0?K?e??^?+?К???!?q?Z?bu???Sǝ?? ?n?4?CP?k?*??%?ٞ?2??S,?G?c?(?Κ?y?(ҟ?? ?S%?A?\?x?{?Q?,̠? ???;?W?s???ǡ????8?T?Cp?k??Ģ??>??5?R?_n?? ?kã?ߣ?7??5?Q?n???ä?)??X?5?R?Bo???Yť????h8?8U?r?莦?ǫ?Ȧ???v?o?\?:z???vӫ??? ?,?J?h?z?b?O¬?A?9?6?8:??X?Kv?]?t?Э?? ?+?4I?kg??磮?-®?x?293: ??y;?Y?>x???ӯ? ??/?M?(l??W?ǰ??F?#?B?ea?$?鞱??ܱ?W?2?9?W?v?Е?Ŵ?Ӳ???0?O?n??.?T̳?~? ?)?I?`h???Bƴ???T$?C?'c???? ?? ???J_?~??1?ݶ??J?=?\?|?c?7?ܷ???;?[?{???۸???;?[?|?;?h?ܹ???S=?]?}?>??޺?[??5@?`?&??-»??J?#?D?!e?ʅ?x?+Ǽ???h)?3J?k?؋??ͽ?|?h?Z0?RQ?Pr?S?\?kվ???8?Y? {??$h??+??O?7?a?;???h?12?\?ׅ????z-?uW?w????)?S?~?S???'?rQ?{?-???}%?O?z???@?$?O?Az????U%?-P?2:0: {????&?Q?|???0?Z)?T???J??,?MX?? ???1?]??L?? ?H7?c???W?.? >?i?????E?q??4?_?"?N? {?V???? ????!?'?,?2?7?=?C?H?N?S?Y?^?d?i?o?t?z?????????????????????????? ???? ?&?+?1?7?<?B?G?M?R?X?]?c?h?n?t?y?????????????????????????? ?????%?+?0?6?;?A?F?L?Q?W?\?b?h?m?s?x?~??????????????????????????????$?*?/?5?:?@?E?K?P?V?\?a?g?l?r?w?}?????????????????????????? ????#?)?.?4?9???D?J?P?U?[?`?f?k?q?v?|?????????????????????????? ????"?(?-?3?8?>?D?I?O?T?Z?_?e?j?p?v?{?????????????????????????? ????!?'?-?2?8?=?C?H?N?S?Y?^?d?j?o?u?z?????????????????????????? ????!?&?,?1?7?<?B?G?M?R?X?^?c?i?n?t?y?????????????????????????? ???? ?%?+?0?6?;?A?G?L?R?W?]?b?h?m?s?x?~???????????????????????? ? ? ? ? ? ?$ ?* ?/ ?5 ?; ?@ ?F ?K ?Q ?V ?\ ?a ?g ?l ?r ?x ?} ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?2;%: ? ? ? ? ? ?$ ?) ?/ ?4 ?: ?? ?E ?J ?P ?U ?[ ?a ?f ?l ?q ?w ?| ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?# ?( ?. ?3 ?9 ?> ?D ?J ?O ?U ?Z ?` ?e ?k ?p ?v ?{ ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?" ?' ?- ?3 ?8 ?> ?C ?I ?N ?T ?Y ?_ ?d ?j ?p ?u ?{ ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?! ?' ?, ?2 ?7 ?= ?B ?H ?M ?S ?Y ?^ ?d ?i ?o ?t ?z ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?? ???? ?&?+?1?6?<?B?G?M?R?X?]?c?h?n?s?y?????????????????????????? ?????%?+?0?6?;?A?F?L?Q?W?\?b?h?m?s?x?~??????????????????????????????$?*?/?5?:?@?E?K?Q?V?\?a?g?l?r?w?}?????????????????????????? ????#?)?.?4?:???E?J?P?U?[?`?f?l?q?w?|?????????????????????????? ????#?(?.?3?9?>?D?I?O?U?Z?`?e?k?p?v?{?????????????????????????? ????"?'?-?2?8?>?C?I?N?T?Y?_?d?j?o?u?{?????????????????????????? ????!?'?,?2?7?=?B?H?M?S?Y?^?d?i?o?t?z?????????????????????????? ???2<?: ? ?&?+?1?6?<?B?G?M?R?X?]?c?h?n?t?y?????????????????????????? ???? ?%?+?*: |8;K;#N;D;4 <6!<7<'N<e=P3=dl>Ѿ>>b>J>>oV> >` >fG > >>5>> >J!>=o>>? >OW>>><>>>>!>j">P#>$>I&>ȓ'>](>&*>o+>b,>.>H/>֐0>k1>3>f4>x5>6>:8>9>:> <>O=>>>9?>oA>_aB>C>hD>+F>WnG>H>,I>-5K>vL>]M>N>u:P>{Q>wR>S>c;U>zV>;W>?X>7Z>yv[>\>]>N0_>m`>۪a>b>Y$d>`e>ǜf>g>'i>rOj>zk>?l>m>9o>sp>q>+r>_ t>QYu>v>nw>y>:z>+r{>|>}>>'>M€>]]>L>>->Wȃ>b>>?>L1>8ˆ>e>>?>1>ʉ>&d>4>">.>nj>.`>>퐎>)>0>"Y>>>= >> O>A>Z}>S>.>A>ؖ>o>g>>1>Ǚ>]>}>&>>>mI>ޝ>s>>z>22>Ơ>I[>>胢> >>?>Ӥ>og>>p>!>>H>ۨ>m>>W>%>I>J>ܬ>n>>>i$> >G>ذ>?j>n>>t>M> ?>ϴ>-`>>߀>>!>1>>P>U>o>G>>>ᬼ>;>ʽ>Y>+>v>+>>!>ݯ>=>>Y>L>t>`>>>4>D7>:>Q>>yj>>s>>>"(>'>@>>W>3>n>>g>>>&>>[<> >Q>>|f>>z>>>>>S,>>`?>>R>3>Gd>A>"v>>>,>> !>S>1>>A>}>IQ>>`>>o>>~>%>*>>> >I>->F>:>> G>>S>>^>h>i>~>t>3>j>>>~>U>>>K!>¥>"*>j>2>>:>>qB>+>I>Z>P>+>qW>>]>>c>p>*i>>,7?gx???;?|?߽?????q?9?B??M??wE??t??DG???(?^H????H?È???zH?L?? ?G ?2=*:% ? ?P ?E ?O ? ?" ?|C ?ʂ ? ?F ?t@ ? ? ? ?< ?{ ? ? ?a8?.w???V3?q???-?l???D'?e?գ??= ?b^?{???V?z?`?<? N?Ӌ??B?D????";?x??a?0?n?D?{?%?b????V??? ?yJ?B???_=?z??#?/?l???N!?]??%?Y?N????>?z???t. ?Gj ? ? ?!?0Y!?Ҕ!?j!? "?~G"?"?l"?"?45#?p#?ի#?#?Q"$?]$?$?$?%?I%?߄%?ֿ%?%?5&?p&?S&?&? '?['?:'?'?v (?F(?(? (?~(?/)?Jj)?)?)?8*?tS*?*?*?+? <+?v+?!+?+?$,?],?ݗ,?,? -?KE-? -?-?h-? ,.?e.?4.?.?:/?K/?/?/?/?,10?uj0?0?0?1?@O1?\1?p1?{1?}32?wl2?g2?O2?.3?P3?҈3?3?S3?34?k4?S4?4?}5?N5?5?5?i5?/6?+h6?6?6?7?II7?{7?7?7?)8?a8?8?8? 9?A9?y9?9?o9?;!:?X:?:?m:?;?7;?So;?;?m;??+?>?Qv>?n>?>???R??????q??U.@?1e@?@?@? A?O@A?wA?A?PA?B?}QB?B?B?B?x+C?aC?EC?C?D?=;D?qD?D?D?E?;JE?UE?hE?sE?w"F?rXF?eF?QF?4F?0G?eG?G?tG?1H?X? rX?hX?X? Y?Z?Y?rY?إY? Y?: Z?`?Z?rZ?Z?Z? [?>[?q[?[?[?y \?X=\?1p\?\?\?]?N;]?n]?]?Z]?^?8^?(k^?^?9^?_?/5_?g_? _?k_?_?1`?jc`?`?`?+`?^,a?^a?a?a?a?&b?Yb?b?b?b? c?Rc?c?c?\c?)d?Kd?}d?id?d?e?lDe? ve?e?3e? f?A): v?Zw?=w?lw?$w?[w?w?)x?Xx?x?x?'x?4y?;Dy?84D8TI8O8ރU8"I[8fa8f8l80^r8r#x8}8ց88<8~8}a8D8&8\ 88Λ8:8ٓ8xv8Y8;8S888,Ƶ8ʨ8g8n8P8>388w888K88e8H8*8T 888#88Xz8\8?8%"88W8d9D9G9ݸ9)*9u9 9 ~ 9Y 9` 99;C99%99h9y99I\99>9)9t! 9!9 #9Su$9%9W'91(9{:*9ū+9-9X.9/9p19429}S4959679Y89:9;93<9|l>9?9 OA9UB91D9E9-G9uH9I9hK9ML9JN9ܻO9#-Q9kR9T9U9@V9cX9Y9F[9[\9(^9_9/ a9u|b9c9_e9Hf9Ah9Բi9$k9_l9n9wo90p9uZr9s9=u9Ev9x9ϐy9{9Xs|9}9U9c959ԁ9y9F99_9p9(9E9癇9R9* 9É9m|9599R9^996Ў9׈9yA999\k9#9ܓ9?9M99"9w9c0999EZ99˛9'9<9h99f9H9נ99)I99i9 s9+9I9霦9U9(9ƨ9h9899F9a99%ӭ9ċ9cD999An9&9߲99P9\ 99z99399v9]99Rκ99?9-9̰9ji9"9ڿ9E9K999u9[.9995X99q99:9J99d9"99]9F9959p9p)9 99GS9 99}959W99_9.99g9B99<9k9u$999JN999x909W99Z9*99b9<9959f9l999?I99u9s9+9G99}U999N97999a9U999%D99Z9m9&9)9×9^P9|:`::c:u::J.:::1C:~::X:e::l:K:%::1:~::ʖ::dO:: :Id : : :/y :{ :1 : :` :F : :E :[ :޷ :*:wp::):[::=:?::R:$:p :g::S :|::75:::J:f::^:I::s:,:x,:Ĉ::[A:::=V::: k:k:#::M:8::/:zM:ũ::\b:: :=w : :/!:!:i!:D":":J":Y#:#:+$:vn$:$: '%:V%:%:;&:2?<: 6&:&:P':':a (:e(:(:A):z):): 3*:k*:*:H+:J+:,:\,:),:s-:q-:-:R*.:.:.:1?/:{/:/:T0:Y0: 1:h1:71:!2:}2:2:_63:3:3:=K4:4:5:`5:d5:6:t6:A6:-7:Չ7:7:hB8:8:8:EW9:9:::!l::k::$;:;:G;:9<:ٕ<:#<:lN=:=:>:Hc>:>:?:#x?:m?:0@:@:H@:EA:ڡA:#A:lZB:B:C:GoC:C:'D:!D:jD::3l:S:rȫ::$:R:::1ݬ:Q :q9:g::í:: :/N:O|:n:خ::4:b:2@: :,:K:k:I:w:ʥ:Ӱ: :(0:H^:g::::D:s:$:Cϲ:b:+:Y::൳:::>@:]n:|:ʴ::&:T::8:Wߵ:v :;:i:ԗ:Ŷ::1":PP:o~::ڷ::6: e:hi3521_rcA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo.rodata.str1.4__ksymtab_strings.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment402A:  Xxx)d<% \P8\4 8C$Z$ PV hpd   p8y2ؚ%e\l@ $ TWp/ 6 A  < # ( -\8 B( GD LV\ [x ` e j p v |T             , l h `     t  0     $ * 0 6 < B  H NH T Z ` f 2B: l r x  ~  $ 4 0  d         ( 0 8 @ H |     0    & , 2 8 > D J P Vp \ b h n t { @  0 8 X L h ` p   ,    d  p  |  * ;1 K(X(D h8 L # h( BL ( 8<p8 |X e Gd V ` [  v l ,0  <  4 j | ` ! m |         !8L ( )2C:h #\ L (x --<2@222$5(5l55B 88   V j G ( `P [    v  e p L T x |   P  tDxD EE   L    FF$ 4H8H8 T HHh II  JJKK  PN\N  RR$$ $U(U08 UUB VWZ, N  ` xd   *< <` 6 H` ~ f l T r@ x\|\\ L 8^<^t \_`_ ``  bb| 0  dd ee  2D: PlTl nn x yy\zlz  {{ $      &P tx,h 2 8 > D          (  8 !L  0X ?l  N| ]  l {           ( 8 H  T  /`  >l  Mx  \ k  z     L $$8XL  #h ( ē|h B G V [L ̸   0 0 %@ 4T Cl R   X8#d \ (h 8W@a@u 007 HH  , ! 5! JC _N uZ 2E:\ ((88W BH 8 [ ` V e Gd # ( h0    lܿ  @ 0#$ (| 8 h B OHG `V  x  e p [ `P |  P @  vd  04jh! H! |%%++ ! 0! ! ! ! 0 +  :  I   X  g $ v 4  @ ` p         0B" ! #<" 2F:8 h" (|"   ! M" 8  #" [# V# `# (" hT# G# B# 0U    *   6 @ " 8U $  $ Z8X @jXjX Drx8WWE Wz8p @$ #\$ dh(|$ h$ B% ,p V p0 b 0 n ` z 0`   @$  D D# h |!     Z LL , 48+ : \C X_L |kXW l b $q '  H h 0( Fd $ 8  8 #(' ȿ6 $,J U 0c n z  h xcX PN( T  d 8x xD d < l   @) e5 @ G tP V `z4i X~ f 0 Dr,    h4 8  xN2G : qD~D\!c.\8BOJ]m` yi\q,LvLY\Ux (5l\ #({88ZJ[hm(x~X@S|bx(O,h 8 ""L5FlRMtcr,sd`dhai0 m(Rdl|j'4,A$O,TW$f\Nhu4Ykla[r\,., XHH1D'?|ltKE]<$guq|\xLHKT` N @,3,0;lD{OY(UgzHz<^$`R~4OHc`nd XP&h,=tMqTl0\Z e,sf n@8UdIXc zy,th|&<2H : :pr\CjKQP_`#s{4gH(`_8Tl(s!x3`}Hn YbHe̸l~8Hg$X l4@2$aRC_GetVerMagicRC_ModExit.LC0.LC1.LC2RC_ModInit.LANCHOR0.LC4.LC5.LANCHOR1.LC6.LC7.LC8.LC9.LC23.LC10.LC14.LC11.LC12.LC13.LC15.LC16.LC17.LC18.LC19.LC20.LC21.LC22.LC24.LC25.LC31.LC35.LC34.LC33.LC29.LC28.LC26.LC27.LC36.LC30.LC40.LC44.LC41.LC42.LC43.LC45.LC47.LC46.LC49.LC48.LC50.LC53.LC51.LC54.LC52.LC55.LC56.LC57.LC58.LC59.LC60.LC61.LC62.LC63.LC32.LC66.LC64.LC67.LC65.LC68.LC69.LC70.LC71.LC72.LC73.LC74.LC75.LC76.LC77.LC78.LC79.LC80.LC81.LC82.LC83.LC86.LC84.LC85.LC87.LC88.LC89.LC90.LC91.LC92.LC93.LC97.LC94.LC95.LC96.LC99.LC98.LC100.LC101.LC105.LC102.LC103.LC104.LC107.LC106.LC109.LC108.LC110.LC37.LC38.LC39$d.LC112.LC111__func__.31806__func__.31560auSuperFrameMode.31550__mod_version641__mod_license640__mod_author639s_stRcModules_stExportFuncs.LC3__func__.47224__func__.47436__func__.47347__func__.47259__func__.47372__func__.47391__func__.31646__func__.31513__func__.31443__func__.31334__func__.30903__func__.30772__func__.15150__func__.32694__func__.31064__func__.31861__func__.31842__func__.31281__func__.31273__func__.31050__func__.15586__func__.31180__func__.31088__func__.30787__func__.30802__func__.30721__func__.32761__func__.32725__func__.32634__func__.32586__func__.32554__func__.32098__func__.32056__func__.31907__func__.31135__func__.32426__func__.32399__func__.31725ReCalcStartQP_ReEncodeRCDecisionInitMjpegRCDecisionRunMjpegInitFirstIStartQP__func__.30605TabLnxC.367.30742C.368.32I:0743__func__.30624__func__.31974__func__.20328__func__.31686__ksymtab_ksem_init__kstrtab_ksem_init__ksymtab_kfile_write__kstrtab_kfile_write__ksymtab_ksem_up__kstrtab_ksem_up__ksymtab_kfile_seek__kstrtab_kfile_seek__ksymtab_dump__kstrtab_dump__kstrtab_ksem_down__kstrtab_kfile_tell__kstrtab_kfile_read__kstrtab_kfile_close__kstrtab_kfile_open__ksymtab_kfile_read__ksymtab_kfile_tell__ksymtab_kfile_open__ksymtab_kfile_close__ksymtab_ksem_down__key.39565__func__.30641RCMaskRectOverLapRCExpGetTBISizeRcExpMpeg4GetCostFromQpAndBitsRCExpICostFilterRCExpPMhbParamUpdateEstRCExpICostEstRCExpPCostEstRCExpH264RQCalRCExpH264CriticalCheckRCExpFailProcessRCExpOutPutRCExpReEncodeRCExpTestRCRCExpMPG4RQCalRCExpMPG4CriticalCheckRcExpGenOsdRoiParam__func__.48595__func__.48624__func__.47416__func__.47851__func__.47924__func__.49095__func__.50071__func__.50252__func__.49721__func__.47547__func__.48668__func__.48810__func__.49530__func__.48579__func__.47226__func__.47204__func__.47364C.639.47253__func__.47252next_start.10504C.361.30602C.362.30603C.363.30604C.364.30605__func__.30583__func__.30506__mod_srcversion23__module_depends__mod_vermagic5RcGetIndexFromTypefilp_openparseFloat2StringdumpRC_NewModeResetQfactorToQstepRCExpCalIspMSEaddFloatsubFloatfloatToIntg_f32Log2eRCDecisionInitRC_RevTransParamCMPI_RegisterModRcOutputRC_DRV_GetSpecStatFromHistRCDecisionExpParamReleaseRcUpdateAlgModel__this_moduleRC_NewModeDecisionsnprintfkfile_tellRcStatusConvertRCExpCalIspMADRC_IsNeedResetModelkfile_openg_astAbrParamVB_UserAddfinish_waitRC_CheckAttrbigMultipowerRCDecisionFQPCtrlRCF32_CLIP3kfile_writeintToFloatkfile_readRcCheckStaticAttrg_f320dot0cleanup_modulefLn2_10prepare_to_waitRcDefaultParamRC_ResetChnRCExpGetTBmemcpyRCMulMatkfreeRC_DRV_CheckIBlinkRCDecisionExpABRCtrlRC_DestroyChnRcDecisionDefaultParamRCTransPoseg_stRcDecisionParamg_apstRcCtxsigmoidRcCheckParamRCDecisionFQPDestroyabsFloatRC_DRV_RestoreHistRcFileParam2J:bytesToFloatksem_down__wake_upg_bInitParamRcInitRunInfoCMPI_RemoveProckfile_closebinaryRoundRCDecisionExpCbrDestroyinit_moduleshiftFloatVB_UserSubRCKalmanUpdateRCDecisionExpABRInitRcCheckAttrRC_CreateChnCMPI_CreateProcRcTransAttrg_f322dot0RC_DRV_LinearviICostparseString2Floatschedule_timeoutg_astModulesRCExpExponent8uRC_DRV_DecisionDefaultParamkfile_seekRCExpCalRoiOsdg_RcRunTimeCtxgteFloatRcExpMpeg4GetBitsFromQpAndCoststrtolRCDecisionExpVbrDestroyg_f324dot0u32RCChnUniqeIndexRcFrameRateControlkmem_cache_allocRCExpInitRQRCDecisionFQPRunupdateRateFloatpower_0dot5RCReEncDecisionVbrRC_GetParamRC_GetAttrisOneRC_FloatingEmulation_TestRCDecisionFileExpParamRC_NewModeInitRCExpExponent8sRcUpdateRcHwCfgRCExpExponentRC_ReadHw__aeabi_idivRcTransParamRCDecisionRunRC_ExitRCDecisionCtrlRcInitAlgModelRCDecisionExpABRDestroyfloatToInt64RcParamExitsCharToIntmulFloatRCAddMatRCReEncDecisionCbrRCDecisionExpCbrInitRcCtrlFileParamg_astCbrParamRCExpSpecialEstRC_NewModeGetRcPriorityRC_RequestIdrRCExpFAdd8uRC_RequestIdrInstksem_initRCInvMatrCMPI_UnRegisterModpanicRcGetRcModestrtokRcExpMpeg4GetQpFromBitsAndCostRC_UpdateAttrRC_NewModeSetRcPriorityRcInitAlgInstrantprintkg_f320dot5RCDecisionFixqpInitRCDecisionDestroymemsetksem_upfExp2_10RC_SetAttr__memzeroRcGetMaxMinQpRC_DRV_CheckPBlinkRC_GetPriority__aeabi_uidivRcDecisionExpVbrInitRC_DRV_ClearHistHI_LOG__init_waitqueue_headRCDecisionExpVbrCtrlfloatToBytesstrtof_kernelg_RcLockRCEXPGetTargetBitsminusg_enRcModuleTypeRCKalmanPredictstrtoffLn2_20divFloatg_astVbrParamint64ToFloatabslteRCDecisionExpABRRundiv_s64_remfilp_closeQstepToQfactorRcInitStaticInfoseq_printflteFloatRC_DRV_ExpPCostFilterRcInitParamRCEXPGetTRRcCtrlDefaultParamRcDecisionFileParamRCSubMatlnFloatRCDecisionExpVbrRunRC_UpDateEndOutInfoRC_InitRCParamInitRC_EndOneFrameautoremove_wake_functionRcProcShowg_bParamFromFileRCDecisionExpCbrCtrlstrlenRC_SetPriorityRCExpMJPGInitRQRC_ConfigHwRCMulMatTranR2K: cInitAlgBufferLineRC_DRV_LinearviPCostRC_StartOneFrameRC_SetParamRC_NewModelReEncDecisionRcComputeFrameLostedexponentg_f321dot0__kmallocfExp2_20RCDecisionExpCbrRunRcRevTransAttrkmalloc_cachesRCReEncDecisionMjpeg8+<,Xl+,+<+,+<++,,+,,,+,+,+ , +!,!+"$,"(+#0,#4+$<,$@+%H,%L+&T,&X+'`,'l<p+(t,(x+|+),,)+*++,*,++,+-,,,-+.,.N+/,/+.,. D+0L,0<+.,.X+1`,1<+2,2+3,3<+4+5+6,4,5,6<+7,7x<+7,7<+2,2+8 <(+4,+50,44,58+9<,9@,8H<L+LP+:T+;X,L\,:`,;x+<,<< +<,<<+=+>,=,>+?<+@+,@,,?+A,A+B,B+C,C+D,D +E(,E4+F<,F@+GH,GL+HT,H`<+I,I<<H+JP,J< +I ,IL <\ +K` ,Kd +Lh ,Ll +Mt ,Mx < +N + ,N , +O +P ,O ,P +Q ,Q +R ,R +S ,S +T ,T +U ,U +V ,V +W ,W + , <\ +Xd ,X < +X ,XL <\ +Y` ,Yd +h <x +Z ,Z + , +[ ,[ +\ , ,\ < +] ,]l < +] ,] < +^ ,^ +_ < +` + ,` , +a ,a ,_( +b0 ,b4 +c< ,c@ +dH 2L:,dL +eT ,eX +f` ,fh < +g ,g<$+g,,g<+h,h+i<+j+,j,+k,k,i+l,l+m,m+n,n<+o,o<+o,o0<@+pD,pH+qL<T+rX+\,r`,d+sh,sl,qp+tx,t|+u,u+v,v+w,w+x,x<8+y<,y<+o,o+o,o+y,y$<@+yH,y`+yh,y|+z+{,z,{+|,|+,+,',P+T,X't+x,$+(+,,0,<'L+P,T'|+,+,'+,'+, +,'$+,,0'8`+d,|+,'+,'+,'+, '8+<,H'T+X,\'h+l+p,t,+,++,,+,+,+,0@Pd| ,<L\l| ,<L\l| 0@P`(8L|++,,+,++,,+,+, T[tB+,'2M: +,'++ ,,+ ,(,D+H,`+d,h't+,'+,'A+,' + ,,  8  D  T ` l x + , ' + , ' + , ' + , '  !+!,!'(!+0!,4!'H!+L!,X!'d!+h!,l!'!+!,!'!!X'+\','+',''(((((())) ))))) ,+$,,(,'@,+D,+H,,L,,X,'h,+l,,,'--------------1+1,1'1+1,2'2+2,,2'<2222222222222224+4,4'4+4,4'4+5,5'$5l5p5t5x5|55555555555+6,6'(8+,8,88'H8+L8,`8'x8+|8,8'8:+:,:':+;,;'$;+(;,4;'@;+D;,H;'<+<,<'<+<,=' =+$=,0='<=+@=,\='=+=,='=+=,='>+>,>'>+ >,$>'H>+L>,X>'p>+t>,|>'>+>,>'>+>,>'(?+,?,8?'@?+D?,X?'t?+x?,?'?+?,?'?+?,?'?+?,?'@+@,$@'(@+@@,T@+X@,d@'h@+x@,@+@,@'@+@,@+@,@'@+@2N: ,A+A,A'$A+(A,,A'HA+LA,XA'pA+tA,A'A+A,A'A+A,A'A+A,B'B+B,B'0B+4B,HB'XB+\B,pB'B+B,B'B+B,B+B,B'B+B,B' C+C,$C'@C+DC,PC'hC+lC,xC'C+C,C'C+C,C+C,C'C+C,C'D+D, D'$D+4D,HD+LD,XD'\D+lD,tDD+D,D'D+D,D'D+E,E'E0E+4E,F+F,F',F+0F+4F,8F,DF+HF,PFTF+XF+\F,`F,lF+pF,xF|F+F+F,F,F+F,FF+F+F,F,F+F,FFF H+H+H,H,$H+(H,0H4HH+H+H,H,H+H,HH+H+H,H,H+H,HHH+I,lI+pI+tI,xI,I+I,II+I+I,I,I+I,IIJ$4J+8J+e,>e'e+e,e'ee+e,(f4f`fxf+|f,f'f+f,ff+f,f'g g\g+`g,hth+xh,|h'4iLiliWiiFdj+hj,lj'j+j,j+j,j+Aj,Ajj+j+k,k,k+k,kl+Bl,B l'8l+***3*+*,*'**** ++|+++++++,2V<: ,4,@,3H,,,,,,,,3-<-l-t----3`.+'d.,'h.'t.+x.+|.,.,.+(.,(..+.+.,.,.+).,)..+_/,_//+_ /,_4/H/X/+\/,h/ ///// 0 0+0+M0, 0,M$0+],0,]X0+*\0,*h0't0++x0,+|0'00+*0,*0'0+,0,,0'00+0,0D1+_H1,_\1d1+_h1,_|11 11122(282H2X2d21t2212212212212213 313(3183D31T3`31p3|313313313313344 404@4P4`4|4444445 5051@5L51\5h51x551551551551551661 6,61<6H61X6d61t661661666666 7707@7T7`71p77777777177 881(888H8T81d8t888188881888919(989D91T9d9t9919999199991::(:4:1D:T:d:p:1::::::::;; ;0;@;P;`;p;;;;;;;;;<< <0<@<P<`<2W):p<<<<<<<<<== =0=@=P=`=p=========>> >0>@>P>`>p>>>>>>>>>?? ?0?@?P?`?p?????????@@ @0@@@P@`@p@@@@@@@@@AA A0A@APA`ApAAAAAAAAABB(B8BHBXBhBxBBBBBBB1BB1 CC0C@CTCdCxCCCCCCCCDD,D@ 0-LM@@@0S( PP@l0S9 0SJ 3/P<"R 0S R 3/P\!R 0S P 3/PK0@@ 8@@@ 8@@@` >@@@8 8PP@P@@ 8@@@@ -L0M@@@0S~PP@l0S  R P `p8` HHp D @ @HK< 1/`Pt2S R Q 0 4K, 4p 03/`P\1S P `V p( 4p @0 @4K, @@@@3): @5 @0 @`H@``J(Kp@`03/`Pm0`S NSQ!  UP0 @PPJ@@ U5@@@@ p-L3&: M@PP Q PP< PP7 0RD$P@0 ``SSVSS  @RMHPYKpVV 1 @0 @`LJ0L71 @o0 @JD1 @{c`0 ` @$` &Jƅ0 @Ϡ0 @J@ @00 @@J@@8 i3@@@@@@ ?@ -LM`QP@C PpP+P@K0 @0 @J0 @u0 @@J`0 @~0 @J@@ l4@ 0-LMPQ@Pv 0S-P_ P: 0S  PC 0 R P K01 @ 0 @J41 @0 @J0 @0 @J0 @0 @J`0 @=Π0 @J@@ 3@ p-L M@PP Q 0S X RR ` FR'HPm0S1QA RPKp+RR 2 @0 @XJ1 @0 @`Jl1 @/0 @J 1 @70 @3%: J0 @? 0 @J0 @'0 @J@@8 1@@@ C?@@@@ p-L MW>@0PSN 5P6Sxő@|%E@p aP PB\Q X dPC- 0S! 5%SQŔ@0a5Kp@@ [2@@@@@@ I2@@@@@@ I?@@@h 0@@@8 %>PP@P@@ W2``@`HX0 -LM`P@ Q p 0S 4 & @RP @ PPJ!KŔ\t 0SK uPP[  0$RPPRt 5%SPRxC|EP@Uń !X XPP P\ R d XP$0$7 PPW0 hǔ\L P; !PdPlQ 3 @ @PƔ2 & @  @2 & @_P @ PPJp!oH&6PV!lW El'R  P ' DŽPb\Q X dPc(7(  5| SP0@x5!6@@P!1>pp@p@@(!?@@@@@@!2@@@@@@ =@@@ 2``@`@@ +3``@`@@` #3@@@@@@8 73pp@p@@ =3PP@Pl 30:-L|MGPPp}@@0SL@`v X  R06 x2 @d`0 @ ``J K `PᔀK( X XQb& `1 Ƅ @  @p1 @0 @``JLP1 Ƅ @d`0 @`0 @0 @`H@``J|0 @0 @``J-80 @- 0 @``Jn| -LxMGPPpq@@0SX@`v Wx &06`P”\b* X +R PKX 0 0  ^6 4`K`K1 @ 0 @0HPƔ1 @d`0 @`X01 @0 @``J0 @0 @`H@``J-0 @- t0 @``JX0 @0 @``JP``Jm~ -LDM@KGP@P`@@@@ 4@ RM S6 @G$ "06pPR H Y Ɣ06 @gp0 @HO H ! ppJD0Sb  Q$ ^G5 @nϠ0$` P @P `&06H  06 !Ɣ4 @ 0 @&30:(KH! ppJH0!HP W.0S Q4 PG pp&06p 4 @Ƅ0 @3 @qp0 @H@ppJ&06Xd3 @uϠ0  @~Y T  L P @P0Kl 03/P `RRX 0 PX ]X0 $ @0^_ S L \ l 'X DQ`KX 8 K+04` ,P 0 8 0P H QZ 7X0LQ(  HQ70DQn  DQ ' DQh`KX 8 Ks?K8` 0P ( , P!R !(l1 P0!1 ,0 zws`KX 8 K4` 8 ,P 0P 40 PP^ @@ 3 %: 0@@@@P -L000 -L -L8@< 080Sبpp@l`6/c 0?`Rp@WVب#8ب -LPP00PP0PP -LM00@2S     0S K3/P K @@ @~8@ -LM0|p<  RM R=`bPPE U]GڈbEp@ \- l@`UW \  l@`U \ l@ \ lU@`T" `b`b\`lЈbK``PQPQPERZ@@0 ?@bUʈb p-L M`@P+P Q0a.s0 @0 @PKpx0 @0 @P40 @0 @ 0-LM00@W@0#P  R. ^ % RE @1X 0 0 @@0 8!K00 @0@@8 8PP@P@@ ?@@@@ 0-L0M00@'@0,@@0 , _ P @4 @0( 0@$0 080 `R R+ R0<0 00@<K$0 @J81 @G0 @Js0 @,0 @Jb0 @#0 @JQ@@` a>@@@@@@8 6@@@ j6PP@P( -L M@Pg  0-Q BR7 0CSIK1 @0 @JL1 @S0 @J1 @80 @J0 @G0 @ ʠJp0 @N 0 @-80 @*- 0 @J< p-L M0PS Kp@@@P 00@g 5& Q)$ P0 @$  @0 Jx0 @0 @ J40 @ 0 @X 0-LMGQP@0MGP%@$HQY`P: P0 #P @ 403/K0P @@$!3@@@@1 @ySP0 @@@@ z3@@@@1<3PP@P -LMGQ`PTRg @G$2S& 0`S S JKS S@1( 0ǔH2  @0  @@ ^h\h7Sb  PPe ' \ J 5%SQ@%H Ɣ0 6D1 @YP0 @@@@ 9@@@@@ 9@@@ 9@3 ): @@ 9@@@d I?PP@P@@8 >``@`@@ .:@@@@ 0-LMGPP@P v@P0S] 0S P1 JQŕ@ 5E@10 PPs0\ R X dP0|WPZ %|RP@x1h7S K0@@!8PP@Pp'BpPh @@h!8@@@@@@@!8@$1 @0 @J0 @0 @H J@@ I?@@@` 8@@@@@@@ ?@@@@@@ 8PP@P -L$M`Qt 00@   2S\ QY , @( 0@ 0K< K)PtHX PX4&T0Ƅ倆@ㄖƄ㈦vHT 043/P 1  @~  @8x 070043/a t L 8 42/P $1 @  @4Q@HT P <1 @]0 @ @@J KpP@0S! @0Q \@-0 @- X0 @@@J@ @0t0@P0 tpp4(  x-L@P@@`5SPHU@`D`M@x -L$MGPP@2 @0 @HJ(Kw``@@w PO R<@0sLW PZ %R 0S ?@0 @K0 0@0 80 < 4   R 1 @0 @ 0 @Ϡ0 @ Jh0 @q0 @ J@@ 1@@@@LP -LMpp@@ Pg  =P`ww |WPP@@D|8 40 87W@@@40w.w 0  |W PyNP0'D|'HY|0xP0PP|0(K4  -L@@@ 0-LMlQ@@@  0 @0@0,P$0 P  0 @0@  @4@@P 0 @0@  @3 :h@P  0 @0@ @@@@$@@K0GROUP_ModInitGROUP_InqStatInfoVALG_QueueGetRealLenGROUP_InqTaskCallBackGroupFormatData2FlashGroupFormatData2FrameGroupCropPicGroupPreScaleGroupValueVpssInfoByModeGROUP_ExitGROUP_InitGROUP_StartSnapPicGROUP_StopChnRecvPicGROUP_StartChnRecvPicGROUP_UpdateRgsInfoGroupCheckOsdGROUP_UnregisterChnGROUP_RegisterChnGROUP_IntHandlerCallBackGROUP_ReadRegsCallBackGROUP_ConfigRegsCallBackGROUP_StartOneFrameCallBackGroupCheckVideoInfoGroupCheckOtherSendInfoGroupCheckVpssSendInfoGroupCheckVpssQueryInfoVALG_QueueGetFromHeadGroupAddOnePicVALG_QueuePutToTailGroupSendPicGROUP_ReceivePicGROUP_VpssSendGROUP_VpssQueryGroupIoctlGroupPutOsdGroupFrmRateCtlGroupCheckTimeRefVALG_QueueIsEmptyGroupQueryOnePicGroupReigster2ChnlGroupCheckCropCfgGROUPCheckColor2GreyConfGROUPCheckColor2GreyGroupReadOneChnGroupConfigOneChnGroupStartOneChnGroupColor2GreyGroupDsuCallbackVALG_QueuePutToTailGroupReleaseOnePicGroupGetOsdGroupSendPic2DsuYUV420YUV422YUV444NAYESVALG_QueueGetRealLenGROUP_GetCropCfgGROUP_SetCropCfgGROUP_GetColor2GreyConfGROUP_GetColor2GreyGROUP_SetColor2GreyGroupGetFrmRateGroupSetFrmRateGroupCreateVALG_QueueInitGroupBallocColor2GreyBufVALG_BallocGROUP_SetColor2GreyConfGroupDestroyversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 grpunload group.ko for %s...OK! Hi3521%s[Func]:%s [Line]:%d [Info]:Group register device failed. Group create proc failed. Group register mod failed. load group.ko for %s...OK! load group.ko for %s...fail! Unsupport group :%d ,shoudl be between %d and %d Check group :%d has not been created ASSERT failed at: >Fi3: le name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLGroup %d has stopped to receive pic. /home/pub/platform_h3/mpp/code/mkp/group/group_ext.cHI_NULL != pvDataHI_NULL != pstGrpFrmInfoHI_NULL != pstCropCfgCrop err, rect(X,Y,right, bottom)=(%d %d %d, %d) out of vi img(%d, %d). PIXEL_FORMAT_YUV_SEMIPLANAR_422 == enPixelFormat || PIXEL_FORMAT_YUV_SEMIPLANAR_420 == enPixelFormatMULTI_OF_2_POWER(pstPic->stVFrame.u32PhyAddr[0], BUS_VHB_ALIGN_BYTE)MULTI_OF_2_POWER(pstPic->stVFrame.u32PhyAddr[1], BUS_VHB_ALIGN_BYTE)HI_NULL != pstGroupHI_NULL != pstInstInfoHI_ID_VDEC == enModId || HI_ID_VIU == enModId || HI_ID_VOU == enModId || HI_ID_USR == enModIdHI_TRUE == CKFN_SYS_ENTRY()HI_TRUE == CKFN_SYS_UnRegisterReceiver()HI_SUCCESS == s32RetGroup has already been initialized. HI_TRUE == CKFN_SYS_ENTRY() && HI_TRUE == CKFN_SYS_RegisterReceiver() && HI_TRUE == CKFN_SYS_UnRegisterReceiver()Group regist to sys failed. Group regist to rgn failed. Group regist to vpss failed. Group init failed. Group init success. HI_SUCCESS == CALL_VPSS_UnRegister(HI_ID_GROUP)HI_SUCCESS == CALL_RGN_UnRegisterMod(OVERLAY_RGN, HI_ID_GROUP)HI_SUCCESS == CALL_SYS_UnRegisterReceiver(HI_ID_GROUP)Group %d is empty for starting to receive picture. Check group %d is receiving pic. Check group %d ReceiveNum %d is illegal. Check group :%d is empty,no chn has beend registered to this group Group %d stop recv pic ok Check group %d is snapping... Group %d start recv pic ok Unsupport vechn :%d ,shoudl be between %d and %d function %s :NULL pointer detected Group %d has not been created. Rgs info %d %d err. grp %d : only h264 support OSD protection,must set u32AbsQp 0,s32Qp 0 !! Group: %d is empty! Can't unregister chn :%d! Group: %d is registered by chn: %d, can't unregister chn :%d. Group: %d has been start recive picture, not surpport unregister Group%d 3:color2grey is enable now, not support unregister Group%d crop is enable now, not support unregister 0ChnlStopSchedule failed with s32Ret (%d)!enChnlType : %d ,VeGroup : %d mod %d unexist can't register chn:%d to group:%d,had registerd, can't register chn:%d to group:%d,please register regularly Grp %d register chnl err. register chn:%d to group:%d ok not surpport coding type HI_NULL != pstVideoFramegrp %d :pic vb is invalid grp %d :Src pic is small,lost this frame,src(%d,%d),grp(%d,%d). grp %d :Group entype %d don't support format %d. grp %d :video field is invalid grp %d : %s GroupCheckTimeRef err. grp :enDataType %d err. grp : Video info err. Flashed sign %d err. HI_NULL != pstSendInfo && HI_NULL != pstGroupgrp %d : Sendinfo bSuc %d err. grp %d :Sendinfo destpic is null. grp %d : Sendinfo pic info err. grp %d :Hist vb is invalid. grp %d :Hist virtual address %d length %d err. HI_NULL != pstQueryInfogrp %d : Vpss query info: src picture mode id: %d err. grp %d : Vpss query info: picture format: %d err. grp %d : GroupCheckTimeRef err. grp %d : Vpss query info: bmalloc %d err, shoule be HI_FALSE or HI_TRUEgrp %d : Vpss query info: bScaleCap %d err, shoule be HI_FALSE or HI_TRUEgrp %d : Vpss query info: bTransCap %d err, shoule be HI_FALSE or HI_TRUEGroup has stopped to receive pic. Group picture queue is busy. This frame not flashed is dropped while the jpeg mode is flash. Group crop err. (s32SrcWidth >= s32Width) && (s32SrcHeight >= s32Height)HI_SUCCESS == s32RetTmpGroup %d receive picture err. group %d lost this frame because of frame control GRP %d vpss Send info err. grp %d :Vpss query info err. grp %d :Vpss query src pic(%d %d) small than group pic(%d %d). Grp %d picture queue is full. Group %d gets VB of u32PicSize: %d from ddr: %s fail when Vpss Query. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mp3:p/code/mkp/group/group.cHI_SUCCESS == s32Rets32DiffTR >= 0[Func]:%s [Line]:%d [Info]:Current timeref(0x%x) is odd number Current timeref(0x%x) ,GrpTimeRef(0x%x),timeref has return! Current timeref(0x%x) is not larger than GrpTimeRef(0x%x) /home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLGroup: %d get one picture err,Venc queue is empty s32Ret == HI_SUCCESS0grp:%d register chnl err HI_NULL != pstGroupHI_NULL != pstCropCfgCrop enable %d err, shoule be HI_TRUE or HI_FALSE. Crop rect startx %d err, should > 0. Crop rect starty %d err, shoule > 0. Crop rect width %d err, shoule be bigger than %d. Crop rect Height %d err, shoule be in %d. Crop rect startX %d err, shoule be multi of 16. entype %d ,width:%d and height:%d must be multi of 2. entype %d ,width:%d and height:%d must be multi of 4. function %s :NULL pointer detected SetColor2GreyConf: u32MaxWidth(%d)err,should be 2 align SetColor2GreyConf: u32MaxHeight(%d)err,should be 2 align SetColor2GreyConf: bEnable(%d)err,should be HI_TRUE or HI_FALSE SetColor2GreyConf: u32MaxWidth(%d)err,should be [%d,%d] SetColor2GreyConf: u32MaxHeight(%d)err,should be [%d,%d] group %d: SetColor2Grey not permitted,you should SetColor2GreyConf first group %d: SetColor2Grey not permitted, group's Width(%d)should less than Color2GreyConf's u32MaxWidth(%d). group %d: SetColor2Grey not permitted, group's Height(%d)should less than Color2GreyConf's u32MaxHeight(%d). Unsupport vechn :%d ,shoudl be between %d and %d s32GroupId % err s32GroupId >= 0 && s32GroupId < VENC_MAX_GRP_NUMHI_TRUE == pstGroup->stVeGroupCfg.bVeStartstart ok, but config fail, chn:%d, u32MemIndex < SYS_DDR_MAXNUMg_u32Color2GreyChroma[u32MemIndex] != 0 && g_pVirtColor2GreyChroma[u32MemIndex] != HI_NULLg_u32Color2GreyStride != 0NULL != pstDsuTaskVeGroup % err VeGroup >= 0 && VeGroup < VENC_MAX_GRP_NUMGrp: %d chn: %d Dsu finish this task error. Grp: %d chn: %d timeref err %d %d. 3: Grp: %d chn: %d status %d err. Unsupport group :%d ,shoudl be between %d and %d Check group :%d has not been created HI_FALSE == VALG_QueueIsEmpty(&pstGroup->stPicBusyQueue)HI_NULL != pstVeChnCfgGet osd err. DSU module isn't exist. Dsu begin job err. get VB fail,for grp %d DSU scale Dsu add scale task err. Dsu end job err. [GRP] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:46] -----GROUP COLOR2GREY CONF------------------------------------------------------------ %8s%10s%10s EnabledMaxWidthMaxHeight%8d%10d%10d -----GROUP CHN ATTR------------------------------------------------------------- %4s%8s%8s%8s%8s%8s%8s%8s%8s%8s%12s%8s%10s NO.ChnIdEnTypeWidthHeightC2GEnVeStrOsdStrSrcFrTarFrTimerefPixFmtPicAddr%4d%8d%8d%8d%8d%8d%8s%8s%8d%8d%12d%8s 0x%8x -----GROUP CHN RECEIVE STAT------------------------------------------------------------- %4s%12s%12s%12s%12s StartStartExRecvLeftEncLeft%4d%12d%12d%12d%12d -----GROUP VPSS QUERY----------------------------------------------------------- %4s%12s%12s%12s%12s%12s%12s%12s%12s%12s QueryQueryOkQueryFRInvldFullVbFailFailInfoErrStop%4d%12d%12d%12d%12d%12d%12d%12d%12d%12d -----GROUP SEND1---------------------------------------------------------------- %4s%12s%12s%12s%12s%12s%12s%12s%12s%12s%12s VpssSndVInfErrOthrSndOInfErrSendCropErrDrectSndSizeErr%4d%12d%12d%12d%12d%12d%12d%12d%12d%12d%12d -----GROUP SEND2---------------------------------------------------------------- %4s%12s%12s%12s%12s%12s%12s%12s%12s%12s%12s%12s SendDsuStartOkStartFailIntOkIntFailSrcAddSrcSubHistAddHistSubDestAddDestSub%4d%12d%12d%12d%12d%12d%12d%12d%12d%12d%12d%12d -----GROUP PIC QUEUE STATE------------------------------------------------------ %4s%8s%8s%8s Freebusydsu%4d%8d%8d%8d -----GROUP CHNL INFO------------------------------------------------------------ 3: %4s%12s%12s%12s%12s%12s%12s InqInqOkConfigGrpInt%4d%12d%12d%12d%12d%12d%12d -----GROUP CROP INFO------------------------------------------------------------ %4s%8s%8s%8s%8s%8s CropEnStartXStartY%4d%8s%8d%8d%8d%8d Group%d isn't exist for getting crop cfg. Group%d isn't exist for setting crop cfg. Group%d is empty for setting crop cfg. Group%d crop cfg info err. GetColor2Grey :group %d has not been created SetColor2Grey :group %d has not been created Group %d is empty! Can't SetColor2Grey,register a chn first! grp %d: s32ViFrmRate(%d) wrong,should be [%d, %d] grp %d: s32VpssFrmRate(%d) is wrong,should be [0, %d] grp %d: s32VpssFrmRate(%d) should less than s32ViFrmRate(%d) mod %d unexist grp:%d has been created. pBase != NULLGroup %d create ok. Grp %d initialize picture queue fail. Group %d create failed. %s GetMemDdr failed COLOR2GREY%dvalg alloc mmz buffer failed! valg alloc mmp buffer failed! %s VALG_Balloc COLOR2GREY memory from ddr %d failed %s GetMemIndex failed group %d has enabled Color2Grey,cannot SetColor2GreyConf grp:%d has channels,can't be destroy Destroy group %d ok. hi3521_groupGNU_en̶UUAA.aeabi$7-A A ,GCC: (Hi3:silicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 `P)ܖD% TX8 4 HUC\KT2&gc V q|$m W $8 p/&  <h( 25,FPbDp u z$ 2@, 0 L l 2Dh @   2px 2 @ 23:2pt  T p  < 2% 2+ 1 2<@7 =X Ct 2  I OT U [T a gt m s y  2     2\  2 x 2 8   2P 2     P  2 P    2   2L#P#2$$2%%2''h ! '$ - 3 9 2**? E K 2++Q Wd ] c i o4 2. .u< {x    l  $ 200222  @   T 277  2:: 2==3: <    2DD2G2 $<)T8lG Vet  0@Th (7FUds0HXl | 12  0h ;l( K 2 2[l,Gp u@ (zt  2JK    2LLF8 {  \  28M@M  2NN X <   $  t $  2QQ=h 1 +, C 7 % 2SS[ U$ sp 28$ Ed$ 2ltL$ S$ Z8% a% h$ op% 2Čv% 2dl}% % 28@22 (<Xp!0?N]l { Ph|    ( / 4> L 2 2 28M 4 22DY D#l h} |!2    0  Nl lI  $  X P#< , 7 C M *\e =u l  p D     G 4 $H$ W6 @ P @f r } @U  2   D  ~ .  $ . @MHA ВpN X_ 7p 0  lc x 3:  $H  Č 8@ t` ' (  2 XH ^ 4r   %   | z    &SL;H [Hg'{H<e@tPtT 2@ldJxL`jny [@tL,:Q,}l)  7KI(d+,{H@h$agroup_opengroup_closeGROUP_Notify.LANCHOR0$dGROUP_QueryState.LANCHOR1GROUP_GetVerMagicGROUP_ModExit.LC0.LC1.LC2GROUP_ModInit.LC3.LC4.LANCHOR2.LC5.LC6.LC7.LC8.LC9group_IoctlGroupIoctl.LC11.LC10.LC12.LC13.LC14.LC15.LC16.LC17.LC23.LC20.LC18.LC19.LC21.LC22.LC24.LC26.LC25.LC29.LC27.LC28.LC35.LC39.LC30.LC32.LC36.LC33.LC34.LC31.LC38.LC37.LC41.LC40.LC42.LC44.LC43.LC46.LC45.LC49.LC50.LC48.LC47.LC51.LC57.LC58.LC53.LC52.LC54.LC55.LC56.LC60.LC61.LC63.LC62.LC59.LC64.LC68.LC66.LC67.LC69.LC70.LC65.LC73.LC71.LC72.LC79.LC75.LC77.LC78.LC76.LC74.LC81.LC82.LC84.LC85.LC86.LC83.LC80.LC87.LC89.LC90.LC88.LC92.LC91.LC93.LC94.LC95.LC97.LC96.LC98.LC99__func__.31418__func__.31243__func__.29279__func__.30772__func__.30676__func__.30665__func__.30330__func__.30302__func__.30118__func__.31348__func__.31271__func__.31211__func__.31182__func__.31157__func__.31020__func__.30804__func__.31053__func__.30974__func__.30921__func__.30898__func__.30876__func__.30841__fun3:c__.30505__func__.30691__func__.30567__func__.30075__func__.29127__func__.30274__func__.29150__func__.30391__func__.30717__func__.30607__func__.30157__func__.30014__mod_version2350__mod_license2349__mod_author2348s_u32GroupStategroup_fopss_stGroupModules_stExportFuncss_stGroupUserRefg_stGroupumapd.LANCHOR3.LC100.LC101.LC102.LC103.LC104.LC105.LC106.LC107.LC109.LC108.LC110.LC111.LC112.LC113.LC114.LC115.LC119.LC116.LC117.LC118.LC120.LC121.LC122.LC123.LC124.LC125.LC126.LC127.LC128.LC129.LC134.LC130.LC131.LC132.LC133.LC135.LC136.LC137.LC138.LC139.LC140.LC141.LC142.LC143.LC144.LC145.LC146.LC147.LC148.LC149.LC150.LC152.LC151.LC153.LC155.LC154.LC156.LC158.LC157.LC163.LC164.LC162.LC160.LC159.LC161.LC166.LC167.LC169.LC168.LC165.LC170.LC171.LC173.LC172__func__.30990__func__.30279__func__.31187__func__.29299__func__.31009__func__.30923__func__.30622__func__.30467__func__.30393__func__.30234__func__.30196__func__.30156__func__.30127__func__.31212__func__.31036__func__.30945__func__.31097__func__.30715__func__.30686__func__.30610__func__.30448__func__.30417__func__.30372__func__.30336__func__.29999__func__.29093__func__.30521__func__.27448__func__.30564__func__.30086__key.29947__mod_srcversion23__module_depends__mod_vermagic5GroupAddOnePicGROUP_InitGroupCheckCropCfgGroupFrmRateCtlCMPI_RegisterMod__this_modulesnprintfGroupFormatData2FrameGROUP_ReadRegsCallBack__arm_ioremapVB_UserAddfinish_wait__iounmapGroupCheckOtherSendInfoGROUP_VpssQueryGroupGetFrmRateupGROUP_IntHandlerCallBackcleanup_moduleprepare_to_waitmemcpyCMPI_MmzMallocCMPI_UserCopyGroupFrameRateInitGROUP_UnregisterChnGROUP_ConfigRegsCallBackGroupConfigOneChn__wake_upCMPI_RemoveProcg_u32Color2GreyChromainit_moduleVB_UserSubGroupReadOneChnCMPI_CreateProcGroupSendPicGroupValueVpssInfoByModeGROUP_StartSnapPicscheduleGROUP_SetColor2GreyGroupCheckVpssQueryInfog_astModulesg_u32Color2GreyStrideGroupReigster23  :ChnlGroupDestroyGroupStartOneChnGROUP_ReceivePicg_u32VeduVersionVB_GetBlkBySizeGroupGetOsdg_u32PhyAddrGroupIsSendRateOverflowGROUP_SetColor2GreyConfGroupFreeColor2GreyBufg_stVencGroupGroupReleaseOnePicGROUP_StopChnRecvPicg_stGrpSemGroupFormatData2FlashGROUP_StartChnRecvPicGROUP_UpdateRgsInfoCMPI_UnRegisterModpanicGROUP_StartOneFrameCallBackprintkGroupCreateGROUP_GetColor2GreyConfGROUP_SetCropCfgGroupCheckOsdVB_IsBlkValid__memzeroHI_LOG__init_waitqueue_headGROUPCheckColor2GreyCMPI_MmzFreeg_stColor2GreyConfGroupPutOsdGroupCheckVideoInfoGroupProcGetPixelFormatGroupSendPic2DsuVB_Handle2Kerng_pVirtColor2GreyChromaseq_printfGroupBallocColor2GreyBufdown_interruptibleGroupCropPicVB_Handle2PoolIdGROUP_RegisterChnGroupPreScaleGroupExitGROUP_InqTaskCallBackGroupProcShowGROUP_GetCropCfgGroupDsuCallbackautoremove_wake_functionGROUP_ExitGROUP_InqStatInfoGroupQueryOnePicGROUP_VpssSendGROUPCheckColor2GreyConfCMPI_UnRegisterDeviceGROUP_GetColor2Greyg_s32PixelFmtGroupCheckTimeRefGROUP_DestroyGroupCallBackGroupCheckVpssSendInfoGroupCheckRegVeChnGroupSetFrmRateVB_Handle2PhysGroupInitCMPI_RegisterDeviceL+P+2T,X,22+ , + , $+2,,2+,C+!,!C+,C +"$,"8CH+#L+$P,#T,$`+%d,%l:pt+2,2 +,C,+(0,(4CL+P,\Cl+"p,"C+#+$,#,$+%,%:+#++,#,++, ,,:H+#L++P,#T,+`+,d,,l:pP+#T++X,#\,+h+1l,1t:+,C+2,2C$+#(++,,#0,+<+3@,3H:L+#P++T,#X,+d+4h,4p:t+#x++|,#,++5,5:+#++,#,+3!: +6,6:8+#<++@,#D,+P+3T,3\:`+#d++h,#l,+x+9|,9:+#++,#,++<,<:+#++,# ,+,+=0,=8:<P+T,d+%h,%U +# ++ ,# ,+( +@, ,@4 :8 +#< ++@ ,#D ,+P +@T ,@\ :` +#d ++h ,#l ,+x +A| ,A : +# ++ ,# ,+ +@ ,@ : +# ++ ,# ,+ +B ,B :  + , +% ,%H +*P ,* +  ,  +^ ,^ i( +, ,8 CD +EH ,EL C +# ++ ,# ,+ +F ,F : + , C +G( ,G, CL +P ,\ Cd +Hl ,Hp C + , C +I ,I C + , C +J ,J C + , C +K ,K C$ +#( ++, ,#0 ,+< +L@ ,LH :L +#P ++T ,#X ,+d +Mh ,Mp :t +#x ++| ,# ,+ +N ,N :  + , C +" ,"C+2$,28P +,C+!,!C +,$C(+Q,,Q<CD `+d,pCt+R,R+,C+S,SC  +,C,+"0,"DC\+2d,2xP+,C+V ,VC ( @+D,PC`+!d,!hCp +,C+W,WC +,C+","0CH+2P,2dP+,C+Z,ZC +,C +!$,!(C0 L+P,\C`+Rd,RtC| +,C+[,[3": +2,2PH+L,XCh+^l,^tC +,C+_,_C+,(C4+`<,`DCd+h,tC+","C+,C+a,aC +2,2B+,C+d,dC+2,20P+#++,#,++g,g:+,C+a,aC$+%(,%+%,%+d,dBH3h +#++,#,++@,@: +,C,+h0,h<CD +,C+","C+,C+!,!C + ,,C@+iD,iTC` h+#l++p,#t,++@,@:+,C+j,jC +#+$,#,$+%,%:+,$C(+k,,k<CH `+d,pCt+l,l+,C+m,m+#++,#,++@,@:+#++,#,++@,@:,+%0,%h+2p,2P+,C+p,pC +,$C0+`8,`@CTfl+p,|C+q,qC',+0,<CL+rP,rXC` t+x,C+!,!C +,C+","C + ,$ C4 +a8 ,aP Ch +l ,x C +s ,s C + , C +t ,t C !+2!,2`!+d!,p!C|!+w!,w!C!+%!,% "3$"H,"+%0",%P"+%T",%"+","C"+!",!"C"+","C"+"",""C#+#,$#C4#+W8#,W3#:@#CL#t#+2|#,2##+#,#C#+!#,!#C#+$, $C$+" $,"4$CP$+T$,`$Cp$+Wt$,Wx$C$$+2$,2$%+%,%C %+!$%,!(%CD%+H%,T%Cd%+"h%,"|%C%+%,%C%+W%,W%C%%+2%,28&-@&@T&]l&)&3&H&+&,&C&+!&,!&C '+','C,'+"0',"D'C\'+`',l'C|'+W',W'C'+#'++',#',+'+@',@':''A(Ap(c(+(,(C(+(,(C(+(,)C)+), )C<)+@),L)Cd)+l),)C)+),)C)+),)C)+),*C*+*, *C0*+#4*++8*,#<*,+H*+9L*,9T*:X*+#\*++`*,#d*,+p*+t*,|*:***I*6*+*,+C+++,+C4++8+,D+CT++X+,`+C|+++,+C+++,+C++#++++,#+,+++,+,,+:+,I<,A|,+,,,C,+,,,C,+,,,C,+,,-C -+$-,0-C@-+D-,H-Cd-+h-,t-C-+-,-C-+-,-C-+-,-C-+#-++-,#-,+-+-,.:.d.c.+.,.C.+.,.C/+ /,/C(/+,/,4/CP/+T/,`/Ct/+x/,/C/+/,/C/+/,/C/+/,/C 0+0,0C40+80,D0CT0+X0,\0Cl0+#p0++t0,#x0,+0+0,0:0+#0++0,#0,+0+90,90:0$141X11+#1++1,#1,+3$: 1+@1,@1:1+#1++1,#1,+1+@1,@1:1+#2+$2,#2,$2+%2,% 2:$2+#(2+$,2,#02,$<2+%@2,%H2:L2+#P2++T2,#X2,+d2+@h2,@p2:t2+#x2++|2,#2,+2+@2,@2:2223+3,3C 3+$3,,3Cd3Qx3T444X4K4+4,4C4+4,4C4+4,5C5+5,5C<5+@5,L5CX5+\5,d5C556\6+#`6++d6,#h6,+t6+@x6,@6:6+#6++6,#6,+6+6,6:6+#6++6,#6,+6+96,96:6+#6++6,#6,+6+36,36:6+#7++7,#7,+7+7, 7:$7+#(7++,7,#07,+<7+@@7,@H7:L7+#P7++T7,#X7,+d7+@h7,@p7:t7+#x7++|7,#7,+7+7,7:7+#7++7,#7,+7+7,7:77+27,2D8+H8,T8Cd8+(h8,(p8C8 86888B89+9,$9C,9+49,89CL9+P9,\9Cl9+!p9,!x9C99+9,9C9+9,9C9+9,:C:+":,"(:C@:+D:,P:C`:+Wd:,Wl:C:+:,:C:+`:,`:C::+2:,2(;eh;;;+;,;C;+;,;C;<+$<,0<C@<+D<,H<C\<Bp<+t<,<C<+!<,!<C<+<,<C<+"<,"<C=+=,=C =+`(=,`0=CH=+L=,X=Ch=+Wl=,Wt=C=/==+2=,2 >$X>+`>,l>C|>+(>,(>C>+>,>C?+?,,?C?+?,?C?+?,?C?3%:l@+t@,@C@+@,@C@+@,@C@+"@,"@CA  A+$A,0ACLF#\F xF0FaF(FF LG=\GXtGG^GG+#G++G,#G,+G+@G,@G:GgGPH+%TH,%H+%H,%@I+DI+HI+LI,PI,TI,\I+`I,hI:J+J+J,J,J+J,J:JHK+LK,XKChK+lK,tKCK+K,KCK+K,KCK+K,KCK+L,LCL$L+(L,LJL+L,L+L,L+L,LCL+L+L,L,M+M, M:M+M+M,M,(M+,M,4M:8Mpp@p@@"v1@2 @y0 @ @@J?L2 @r0 @@@J,@@!0@4 3: @@!0PP@Pp@ @uCTT0X @ B@0SO   R  @  R BP B  R$ $ R @ Rt BP B $ Z CP0H H8080@@ 0``@`DlX -L MQ@pk GP) @ P`PO- 0SG0`S: #S& S$ h1 @0 @J1 @0 @J(K @A @ -LMGPI0@0 R70s# L L^ P0`S S" S  @0`03/ KS @@ 9@0`S@0!03/@01@@@@@\1 @n`0 @``J1 @"n` 0 @``J  @ 0 @0 @0 @``J`0 @ @``J@@ 0@ -LMGP0@ 0 `PP@0Scp `KP R P !K!`1 @T%- @ 0 @0@A   a`cP   0Q QA0 S 0S0C 000S @ 0@@8 >@@@ :@@@@ 4 -LMGP@|3 @0 @@@J4%:$Kp``@PPNOO0S 2 @0 @@@J0`S? 'S*@ P `P @p7/pPL D2 @0 @HS #S @@J @03/@TFHH00@@4/@``@ P> `P> @1p7/pP $1 @)@ @(   00 @@@] @@(   $0 0 @@  ``zT0 @rΠ @ @@JV  0 @$ -L M`Q@< GP @ PpPO 0S(K0 @0 @Jh0 @0 @J@@ 7@4 -LMGPp PQH 0S p`@@@t PO9 R\(\ P! 000 T TQ ppP( 0S4 `?`0000`3V0@ 0t(9 @ @ (K0@0 03\0 P`P  R 0TS` V \ P $0$ R A@@ @㌀ Cp 唠 x@ p| p=d0P `R\ QX0P lK3$0W x  |A0S  CQC  00 Q R $00W @T lK0 P pF !40: t6 @F @ c\^6t6 @  @P 46 @ @tJ>\`QY @@%(9@@@@5 @ @J p= !tP5 @V\ `0X 0 @0 0d0 Jp 0!t4 @8 @J!!X4 @p0 @tJp唠0S T \ $$`V  !0t@-b A/,3cS @@@lPK4`Klpl h0 $4p `0 d0  03/8p 800BSp  \lp,hp l G0 3/lN l 03/l.hp  l 03/l. h 03/l. h 03/l .h 03/lhp l 00 K3/D2 @p0 @J30!z0!@2 0@ @A@0Sd  %CC^CHDH808T,1 @  @ 0 @0 @  @t J@@ /9@@@` <9@@@< 0pp@p@@ *9PP@PD -LLMGPP T TPH T0S P `PP@@ Pr^ }PP@㬀?pXP L0P⌀L`K 0\0 \0SpU LZk ,P U L Z PJ R \9 4: @ΠP0 @ J(K\ \0XH D @0 <0  0 U L Z\Hp8 @@ 0 @O48 @ @J0 \ R (\ ``X X` !TX R:X 2\0 P`   XTd \0Sx VQ2 0@l C@P p`hP 5P0U4  N PU( 0 \0S  EPQ(E$(   0p0chl h $0Sl00Cl0V \ R@@0&h8@hPl0`S >S #S;\T0 \0S Q d  ! T? 0\  003S \\`|0T 0|X @=b0A !3bR S @@$>@@@@\0LPKl4`K\ pH0 0 L `D 4p   0@T@0T   N P0@S@0T P BP$0$@S@$0T @ @P@@ 0@ 6 -LIMGP0`P00 xQ @@@ P P0 0`SH ?SBP `SF Sj S7IK4 :   Z ? @^ 0 @@@JD? @B0 @@@J(KS, #S @@JQ/ 3S IK 0Z U> @Π 0 @@@J\ #R IKZ 0A= @ 0 @@@JSIKZ6l= @kA@ 0 @@@JY  = @WA@ 0 @@@JuY < @A@ 0 @@@Jb꼐@, ( PNOOT( R 0`S  0y 0L 00D80THdP X4DL T<0@0 `RI R  ; @OD@0 @@@J, Y; @A@ 0 @@@J <; @F 0 @@@J\ : @^D @D @@J0\ : @D @D @@J0X: @:0 @@@J : @FA@ 0 @@@J9 @FA@ 0 @@@J9 @F 0 @@@JH9 @;C@ @@@J~9 @ 0 @@@JmR 3R40 LR8 @C@00 @@@J/\8 @Q0 @@@J(, PFHH7 @O@0 @4: @@JD1  00K0  4  8! <  @! 0! 1 41 ! < 1 8D1@!  1 $1  PU  7 @CD @ @D!H00C SP'S% 6 @w00 @@@J0 LQSP6 @00 @@@J0KpPI 5 @ @&8H0@@@X03/P] 5 @CD @  @0KPw H5 @ @8HX0KpP 4 @BΠ0pp@ 2/Ph 4 @CD @  @f0pp@HDQ 9D Q~[%D Q -DQ !D QnK(HQ 8H Q HQ^;"H Q &HQ = H QN+'#  h^ @XLQ L QxtTDQ AXD Qhd -L00@h0 SJ@@@?01 ?0C/2 -LM@0S pp@ӝaR `@ P@P 0w L0L 4 S `P<@D<@Ty 00 P@00S `P  A P@@%1@0 0 R@00 S @`PLP@@$1@$0$0 Q:@$00S4 4: `PNP@@$1@D T04 S08<@开 Ws00(K@@#0PP@PD L04 SeD0D4 Si  `P8@N8@@TI 00 \@00 S  `P N P_00 S@00S  `PAPh$0$0 S@$00S  `PLPq@@!0``@`D D04 ST0T4 Pl  `P@@N@@@TI 00 \@00 S  `P N P00 S@00S  `PAP$0$0 S@$00S  `PLP@@ 0pp@p -L@@@0S@l0SJPp5/p@ @`PἐP0PPP P^oP0 P圠PP堠0圠HX @PP6 -L`P 3P P  -L0 -L -L -L@@@ 6 0-LM Q@@@  0 @0@0,P$0 P  0 @0@ @!@@h@P  0 @0@ @@@@K0GNUp;|.N _[=uGOVencGetCapabilityVencReleaseRcnFrameVencGetRcnFrameVencDoPollVencPutOneChnStreamVencGetCurrentUniqueIDVencStar4:tRecvPicExVencGetJpegSnapModeVencGetMpeg4ParamVencSetMpeg4ParamVencGetMjpegParamVencSetMjpegParamVencGetJpegParamVencSetJpegParamVencH264eEnableInterPskipVencH264eEnableIDRVencGetH264eRefParamVencSetH264eRefParamVencGetH264eRefModeVencSetH264eRefModeVencGetH264VuiVencSetH264VuiVencGetH264RDOVencSetH264RDOVencGetH264DblkVencSetH264DblkVencGetH264PocVencSetH264PocVencGetH264EntropyVencSetH264EntropyVencGetH264TransVencSetH264TransVencGetH264IntraPredVencSetH264IntraPredVencGetH264InterPredVencSetH264InterPredVencGetH264SliceSplitVencSetH264SliceSplitVencSetRoiCfgVencGetRoiCfgVencGetMaxStreamNumVencSetMaxStreamNumVencCheckRegisterVencQueryVencStopRecvPicVencStartRecvPicVencRegisterChnVencRequestIDRInstVencRequestIDRVencSetRxBlockVencGetRcPriorityVencSetRcPriorityVencGetRcParamVencSetRcParamVencGetRcAttrVencSetRcAttrVencSetJpegSnapModeVencUnRegisterChnVENC_FRMBUF_CleanUpVENC_BUF_CleanUpVENC_BUF_PutFreeVencInsertUserDataVencGetStreamInfoVencGetStreamMethodVencPacktoVencBufVencGetOneChnStreamVENC_BUF_PutBusyVENC_FrameOverNotifyVencGetVeAttrVencGetBufAddrVencPutStreamVencGetStreamVENC_BUF_PutUserVencSetVeAttrVencCheckAttrVencCheckStaticAttrVencDestroyChnVENC_FRMBUF_ReleaseVENC_BUF_ReleaseVencCreateChnVENC_ModInitVENC_FRMBUF_ReleaseVENC_BUF_ReleaseVencBufferCache[Func]:%s [Line]:%d [Info]:null pointer! had not implemented yet venc poll: venc chn %d is out of [0,%d) venc poll: venc fd is 0x%x venn poll venc chn %d not create venc check create:venc %d chn not create! put one chn stream entype err! mod %d unexist venc %d err! venc check register:venc %d chn has not been registered! Type%d don't support jpeg snap mode. type:%d (not mpeg4)not surpport get mpeg4 param type:%d (not mpeg4)not surpport set mpeg4 param type:%d (not mjpeg)not surpport get mjpeg param type:%d (not mjpeg)not surpp4:ort set mjpeg param type:%d (not jpeg)not surpport get jpeg param type:%d (not jpeg)not surpport set jpeg param only H.264 support enable Pskip,chn %d is not h264 only H.264 support enable idr,chn %d is not h264 only H.264 support get ref mode,chn %d is not h264 only H.264 support set ref param,chn %d is not h264 only H.264 support set ref mode,chn %d is not h264 type:%d (not h264)not surpport get vui type:%d (not h264)not surpport set vui type:%d (not h264)not surpport get rdo type:%d (not h264)not surpport set RDO type:%d (not h264)not surpport get deblocking type:%d (not h264)not surpport set deblocking type:%d (not h264)not surpport get poc type:%d (not h264) not surpport set poc type:%d (not h264) not surpport get entropy encode mode type:%d (not h264) not surpport set entropy encode mode type:%d (not h264) not surpport get trans mode type:%d (not h264) not surpport set trans mode type:%d (not h264) not surpport get intra prediction type:%d (not h264)not surpport set intra prediction type:%d not surpport get inter prediction type:%d not surpport set inter prediction type:%d not surpport get slice split type:%d not surpport set slice split jpeg has no ROI cfg! mjpeg has no ROI cfg! mpeg4 has no ROI cfg! error payload type. not surpport get max stream not surpport set max stream venc check register:venc %d chn has been registered! request I coding entype not surpport,chn %d isn't h264 or mpeg4 bBlockFlag %d error!, should be HI_TRUEor HI_FALSE Jpeg snap mode %d isn't been supported. Update snap mode to grp err. ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/venc/venc_frmbuf.hpstFrame/home/pub/platform_h3/mpp/code/mkp/include/venc_buf.hpValuepNode->u32Magic == MAGIC/home/pub/platform_h3/mpp/code/mkp/venc/venc.cHI_NULL != pu8DataType:%d doesn't support userdata (VeChn >= 0) && (VeChn < VENC_MAX_CH4 : N_NUM)HI_TRUE == pstVencChn->bCreated0HI_NULL != pbByFramemalloc VEN_BUF node failed! chn:%d shortage of mem,can't alloc free frame pstFrame != NULLpstPack != NULLget one chn stream entype err! chn:%d encoder empty find frame end g_stVencChn[VeChn].bCreated == HI_TRUEwakeup get stream process Kmalloc err. Venc %d get chn attr err. HI_NULL != pstBufAddrif put by frame,the buf count could not less than 1 if put by pack,the buf count must be equal to 1 hadn't given any buf to user,or user had already released all buf alloc temp pack buf failed copy from user failed! 1 == pstData->u32PackCountNULL != pstFramepstData->pstPack != NULLhad no buf given to user,or user had release all buf NULL != pstPackmemcpy temp buf to stPack failed the buf(0x%p,len : %d ;0x%p ,len %d) put by user is not the buf given to user(0x%p,len : %d ;0x%p ,len %d) Get stream failed because bBlockFlag! chn:%d destroyed in get process NULL != pstTempFrminput buf is not enough to hold a frame,in count:%d,pack count:%d HI_NULL != pstPackget stream failed because copy_to_user err! wait_event_interruptible err,line:%d venc type:%d err! Entype %d isn't supported. h264 ByFrame(%d) attr is not valid,should be HI_TRUE or HI_FALSE h264 attr bMainStream(%d) err,should be HI_TRUE only h264 attr bField(%d) err,should be HI_FALSE only jpeg snap bByFrame attr (%d)is not valid,should be HI_TRUE or HI_FALSE mjpeg attr bMainStream(%d) err,should be HI_TRUE only mjpeg bByFrame attr (%d)is not valid,should be HI_TRUE or HI_FALSE mpeg4 ByFrame(%d) attr is not valid,should be HI_TRUE or HI_FALSE mpeg4 attr bMainStream(%d) err,should be HI_TRUE only mpeg4 attr bMainStream(%d) err,should be HI_FALSE only chn %d :coding entype(%d) can't be changed to %d! chn:%d :h264 not allow to change static attr bMainStream chn:%d :h264 not allow to change static attr bByFrame chn:%d :h264 not allow to change static attr bField chn:%d :jpeg snap not allow to chang4:e static attr bByFrame chn:%d :mjpeg not allow to change static attr bMainStream chn:%d :mjpeg not allow to change static attr bByFrame chn:%d,mpeg4 not allow to change static attr bByFrame chn:%d not surpport type(%d),line:%d Venc %d set chn attr err. venc %d chn not create! can't destroy chn %d , please unregiste it first chn:%d had been created! chn:%d init venc buf err! Create h264 chn but rc mode is %d which is not for h264! VencGetCurrentUniqueID error h264 SetUniqueID error rc create chn error venc user h264 function create chn error jpege SetUniqueID error venc user jpeg funtion create chn error Create mjpeg chn but rc mode is %d which is not for mjpeg! mjpege SetUniqueID error jpeg create chn error Create mpeg4 chn but rc mode is %d which is not for mpeg4! mpeg4e SetUniqueID error venc user mpeg4 function create chn error chn :%d,Not Support Type [VENC] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:48] -----VENC CHN ATTR------------------------------------------------------------- %8s%8s%8s%6s%6s%8s%11s%9s%12s%12s%12s%12s%12s %10s %10s NO.WidthHeightTypeFieldVIFieldStreamTypeByFrameBlockFlagSequenceRegisteredLeftBytesLeftFrmCurPacksBuffCache%8d%8d%8d%6d%6d%8d%11d%9d%12d%12d%12d%12d%12d%10d%10d -----VENC STREAM STATE------------------------------------------------------------ %8s%12s%12s%12s%12s%12s%12s%12s%12s FreeCntBusyCntUserCntUserGetUserRlsGetTimesIntervalFrameRate%8d%12d%12d%12d%12d%12d%12d%12d%12d vencunload venc.ko for %s...OK! Hi3521%s[Func]:%s [Line]:%d [Info]:Regist device err. Regist module err. load venc.ko for %s...OK! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/venc/venc_frmbuf.hpstFrame/home/pub/platform_h3/mpp/code/mkp/include/venc_buf.hpValueversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=V4: encBufferCache:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_basevermagic=3.0.8 mod_unload ARMv7 VencBufferCache,$hi3521_vencA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rodata.rodata.str1.4.modinfo__ksymtab_strings.rel__param.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4 (xZ)D% $X84(4 |8C\$Z$V d<l2{p Ą ܄x,$ TPP6P4: pP/,@%      ", ''04* /H 4t '9M R 'W ' \ a  'g\ '( , m '  s '@ D y '  '`dT ' 'x| ' 'PT 'P '(,' ' ' ' '  @ '0"4"l '## 'H%L% '&& '`(d($ '))` 'x+|+ '-- '.. '0 0< '11t '434:83  '44 'L6P6 '77d !4 'L - '::'<<3| '??9 '@@'AA'TEXE'FF'8H@ MX \p k z         , @ T .h = L [ j y    , @ T  ` p    - < K Z i x   4!: 0 D X l       , ;  J$ Y4 hD wT d x       ' '4 4 4 ( 66 ? I ij U ,6e v Dx  " '@ (/ 4  * R M '$ (  ش |pW g m \l a ''@'     ,    " 1 2 B 'O i  '  h l( 'x ' '6 6 6, P6D' ' '` `#   ! ! '  1 .F , X Ab Tlw  U 4  ,    # L% $ D - 6 0K l_ k 4": n 1 6  D 0R   4"     ( K7 A d(T d 83y (  ,>(+ , +,(+ ,((X+\,h(x+|,(+,6+;,;(+  , ,T+X,d(t+x,|(+,(+,(+ ,6T+CX,C\(dt+ x, +,(+,(0+4,@(P+T,X(p+x,6+,(+F,F(+ , $L+P,\(l+p,t(|+,(+,(+,6L4' : +P,\(l+Ip,It(|+ , +,(+,(H+L,X(h+l,p(+,6+,(+L,L (  +  , < d +h ,t ( + , (   + , ( + , (!+!,,!6d!+h!,t!(!+O!,O!(!!+ !, !!+!,"("+","( "0"`"+d",p"("+","("+","6"+",#(#+R#,R#( #0#+ 4#, T#|#+#,#(#+#,#(###+#,#( $+$,$(,$+4$,D$6|$+$,$($+U$,U$($$+ $, $%+ %,%((%+,%,0%(8%H%x%+|%,%(%+%,%(%+%,%6&+ &,&((&+X,&,X0&(8&H&+ L&, l&&+&,&(&+&,&(&&'+','($'+(',,'(D'+L',\'6'+','('+[',['(''+ ', ' (+$(,0((@(+D(,H((P(`((+(,(((+(,(((+(,(6 )+$),0)(@)+^D),^H)(P)`)+ d), ))+),)()+),)())*+ *,,*(<*+@*,D*(\*+d*,t*6*+*,*(*+a*,a*(**+ *, +8++<+,H+(X++\+,`+(h+x++++,+(+++,+(+++,,68,+<,,H,(X,+d\,,d`,(h,x,+ |,, ,,+,,,(,4( : +,,,(,-4-+8-,D-(T-+X-,\-(t-+|-,-6-+-,-(-+g-,g-(-.+ ., (.P.+T.,`.(p.+t.,x.(...+.,.(.+.,.(/+/,/6P/+T/,`/(p/+jt/,jx/(//+ /, //+/,/(/+0,0( 00L0+P0,\0(l0+p0,t0(0+0,060+0,0(0+m1,m1( 11+  1, @1h1+l1,x1(1+1,1(111+1,1(1+1,2(2+ 2,026h2+l2,x2(2+p2,p2(22+ 2, 22+2,3(3+3,3($343d3+h3,t3(3+3,3(3+3,363+3,4(4+s4,s4($444+ 84, X44+4,4(4+4,4(444+4,5(5+5,5(05+85,H565+5,5(5+v5,v5(55+ 5, 5 6+6,6(,6+06,46(<6L6|6+6,6(6+6,6(6+6,66 7+7,7(,7+y07,y47(<7L7+ P7, p77+7,7(7+7,7(778+8, 86d8+h8,t8(8+|8,|8(88+8,8(8+}8,}8(9+ 9,9($9+ (9, 09(H9+L9,X9(d9+~h9,~p9(9+9,9(9+9,9(9+ 9, 9:+:,:($:+(:,0:(8:P:+T:,`:(p:+t:,|:(::+:,:(:+:,:(:+;,;6X;+\;,h;4):(t;+|x;,||;(;;+;,;(;+};,};(;+;,<(<+~<,~<(4<+8<,D<(P<+T<,\<(h<+ l<, <<+<,<(<+<,<(<< =+(=,8=6|=+ =, ==+=,=(=+=,=(>>+ >,,>(8>+ <>, @>(P>+ T>, l>+ p>, >+>,>(>+>,>(>>+>,>(?+?,?(?H?+L?,X?(h?+l?,p?(?+?,?6?+ ?, @8@+<@,H@(T@+X@,\@(d@t@+ x@, @+ @, @+@,@(@+@,@(@@(A+,A,8A(HA+LA,PA(dA+hA,|A6AAA+A,B6PB+ TB, BB+.B,.B+B,C(C+C,C(,C+ 0C, D+D,D(D+D,D(E E+$E,0E(̻ܻA403: @3 ,!8HXChI LGļԼ 4$4Jd2t'+,+,н++,+;,;++,,+,0p+t+x,|,+,++,,+,4t+x+|,,+,$0+4+8,<,H+L,TlD++,,+,(+,,@+ D, `+;h,;l+Ep,E&))(+,,0&@ +,$F(+,+0,4,8"@+,$+(+,,0,4HQ\+`+d,h,t(+,(++,,++,,(+,(+,++ ,,"$H H $,08lt$x |841d&:hi3521_ao.ko9Y9Y9Y5?ELF( 4( -L -L -L00@ -L@0S0"00 -L 3@ -L00@ -Lhp`PW0p@GTPU0 $bP  bRD ! ! P0  7,``E$ 0Pg Yn80 80P.QQ-   %!0 0x1 @P 0 @@Z44(K4O8 48 0 @0 @J0 @0 @J@@8 1PP@P@@ 0@@@@ -L M00@h`0XV@'~P@@P@Pgo`7hQW &h$`DQf 0h`DQ] h`DQV DQA 1 @ @ O?0C/2 K (Q1 Q3 8Q-  QH Q3 5 HQ8 ($ HQ (Q :Qh 800DQ40 @+Π @J -L?P00@%Ò0 -L0@S00r -LM0@PS@GQ @H bAopPO 2 Q 0@$K 0 @0@0 @J 0 @0@0 @J 0 @0@bϠ0 @J p-LM0@PS0 @0 @@@JKpR@@J B BAo P5): NOO Q@@40 @Ϡ0 @@J0r -LM0@PSD1 @0 @@@JKb bA PNOO Q@T@@0 @0 @@J@40 @0 @@J0r p-L M0b@bA_PNOO P@P@KpD0 @Ϡ0 @ @@J0r -LMp b0 0@ƒQ !(K>C  4 0S 40 !4 !,P_ @ȅP8 &$0P P R+ R- PMU@H*%0RĔ ^% %  04Ĕ0PЄ 0嬅,,,̄Є5h0؄ ܄ @BϠ5 @P,0584 40 ! -L|MtR0bR 0@P!@  T  X \ P L 0 ȅ 0p @4 ⌠ 4@ H0 T0< `  <@8p pd HD XDhp l ppp T  \0吠P\ X t L0  00x  0|0 (0 0` ` 40L` Y> `8` 0 `4` <` P Y@`8 D`< H`@ `D  `p0YH` `p  p8@ D` `40 <p Y~YnY΀YYY.Hp`YH 吠YD 唠 Y@ 嘠Y< 圠Y8 0Y4 匠Y5*: 0 L55P0唅H0DH0 0@D0 0<@0 08<0 0480 0040 0L00 05B1 P嘅5`uu5dee5hňň5lp5p5T%%5X5嘕唕\5EH嘥唥tE5D`eexpE5@嘅唅|E5<嘥唥E58E54 %%`E50puu0(K0r -LM0@@S>Q+ bPP@ErAPNOOQ< @P `R^E 0 $K0 @c0 @@@J0 @_0 @@@J@0 @oA@ @ @@J -LM@R`p 2("P$R( Q;RP Q_` Pp00@%7#QQ $  !K$Q  !!`1 @F @$J1 @+(0 p" $ @J0 @30 @Jl0 @:0 @J@@ %1@0r -L80B8P 84P 4 0r -LtM0@PSB prPo APOw `V ``@5d Ő LRnj"NQ gi.AP `0 `. ARX4 `. ARQ8 `!%0BSI< <%00@l!@^>@ > APwD 0.A^/ H 0.APH( L < NQ! P >!@QZ T 0.5?:A^ X 0.APX  < NQp`Ssc P X   -*X P`@scCS P    *0 0@p`P8  P8scSCà      :U p3 @z @J(KpLa@  TD` V cT PcTS  \p`Ssc\ X   X P`@scCS\    0 0@p`P8 Y8scSCà      pL`@  TD` V ST PcTS \mp`Ssc\ X \X P`@scCS\ L0 0@p`P8 Y8scSCà ?40 @fϠ @J/0 -LM`PP@ 0(P<"l0 R0 $U5 &:  \*@  TPDPPP TPcTPP\?p`Ssc\ X -X P`@scCS\0 0@p`P8 Y8scSCà  U h3 @~ @J(K@! TD``P T`ST``\`Ps\cS X X P`@scCS\0 0@p`P8 Y8scSCà    P@@ 㰠T CPPP@S`CP``\pp`PscS\ @TA縐᷐ᶐᵐ^T @PcSC\㶠ᵠᰠᴠM0 0p`P@scSCàY㺐Ḑ᷐ᶐᰐᵐᴐἐA40 @; @J1D -L\MP@@@@ @ @00@@@@@ @@@@@ 82S` 2S"@2} S  Spp@! Spp@ Spp@ "&Spp@ Spp@ } Spp@ Dl Spp@ { S@p p2SJ@0" 2L S4H <@$b,”D V(@ 2K <`K @P PH0L@  D@p `000@^ 3S@ S@ S@ S@ S@ S@ 3} Spp@&  Spp@! .Spp@ Sp5 3:p@ "Spp@ mSpp@ } Spp@ D Spp@ { S@pp3S@ S@ S@3,S(ÔL @ S@$cH` Q#D 3@0 3 <`K  @P PD0@LH @p  `@ @ @00@@@@@ @@@@@ @$@(@,8@P;03@S(KS@ S@ S@ S@ S@pS3 @,PC(@d@cDS`C \sHL蒜 tÜ`P@p$x2@ ,r(pdHbLhrlTP |œ@@p $S@S@ S@<`K @P PFpp@<`K @P P x-Lb`@@@PaH3S x @x 0-LM` @A 0SK0PP@| Px PPx40 @ @ JX -LMßPK   褀p@`gLpKa@@ (萐 嘐@ @L@ 蘐 唐@ @嘐P,@@DT@萐 5X p@I≠ J ఐ \P P0PdP2 @0 @P@@JHQpmY Y}^ PP S LX7 @\㠐H0id000X(P \ \ n\0 \e0X\ \Z\00X Rh 50:$ R! R @@ !10@@@@@S ӯڀS Ӭ @`0 (@0 h <0l t0 (K\h0 @@0( @J 0 @d -L M``@P<3SG `( p Kp@A2/ 00(lFile name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/ao.cHI_TRUE == CKFN_SYS_ENTRY()HI_TRUE == CKFN_SYS_UnRegisterReceiver()initialize again! ao is busy now! HI_SUCCESS == s32Retaodev%d is not supported ao chnid %d is invalid NULL != pstAioChnMPP_DATA_AUDIO_FRAME == enDataTypeNULL != pDataNULL != pstAioDevAO(%d,%d) state is not enable or pause. AO(%d,%d) receive a frame which not match its enBitwidth. AO(%d,%d) receive a frame which not match its u32PtNumPerFrm(%d to %d). AO(%d,%d) 's chn buf is full. Ao Dev %d is not enable ! Ao Chn %d is disable or in original state, it's not permit to query chn state! no aochn %d for aodev %d, or can't handle right channels for stereo mode chn state is not pause or enable, can not resume it resume ao(%d,%d) ok when chn is disable, can not pause it HI_NULL != pRightChnBufpause ao chn(%d,%d) ok AO dev %d not enable AO chn(%d,%d) enable ok! AUDIO_FRAME_S pointer argument for AO(%d,%d) is NULL. size is too large, size is:0x%x AO(%d,%d) state is not enable or pause AO(%d,%d) state:%d Aochn %d of Aodev %d is not enable ! AO chn(%d,%d) disable ok! s_s32AiState is not STARTED Error ao cmd [Func]:%s [Line]:%d [Info]:aodev%d is not supported the AIO_ATTR_S pointer is NULL for aodev %d AudioDevId %d not configed AO dev %d not enable AO dev %d: Input BitWidth(%d), only 16 bit width data is supported to adjust the volume AO dev %d is busy, disable it first AO buf e5: mpty, put last data, serial times:%d, chn=%d the AIO_ATTR_S pointer is NULL for AudioDevId %d must disable dev when config dev attr ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/audio/ao_trans.cNULL != pstFrmAo(%d, %d) frame size(%d) is not equal to Ai frame size(%d)! Ao frame BitWidth: %d is not equal to Ai BitWidth: %d! Ao frame soundmode: %d is not equal to Ai soundmode: %d! ao dev or chn is not enable ao is not initializeed AO chn %d not disable,must disable all AO chn,then disable AO device AO dev %d disable abnormal! AO dev %d disable ok! calculate dma buffer size fail! get mmz name fail! alloc dma buf and all channel buf err ioremap dma buff failed ioremap all chn buff failed AODMAaodev %d not initializeed aodev %d not configed aodev %d enable ok! [AO] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time: [May 4 2014, 19:31:46] -----AO CHN STATUS------------------------------------------------------------------------------------------------------- %5s%8s%8s%8s%8s%12s%10s%10s%8s%8s%8s%10s AoDevAoChnStateReadWriteBufEmpu32Data0u32Data1bResmpPoiNumSampRResmpTypepauseenabledisable8kHZ11kHZ12kHZ16kHZ22kHZ24kHZ32kHZ44.1kHZ48kHZ1X22X11X44X11X66X1%5d%8d%8s%8d%8d%12u%10x%10x%8s%8d%8s%10s [Func]:%s [Line]:%d [Info]:Ao volume(%d) is invalid AoClrCfg fail, sio mode may not insmod aodev:%d, read & write buf conflict! Cur DMA addr:%x, pinpon buf index:%d ! AO not init(DMA Buffer is NULL) bitwidth error -----AO DEV ATTR--------------------------------------------------------------------------------------------------------- %5s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s AoDevWorkModSampRBitWidChnCntClkSelSondModPoiNumExFlagFrmNumVolumei2s_mas8kHZ8bitmono%5d%8s%8s%8s%8d%8d%8s%8d%8d%8d%8s -%ddBstereo16bit32bit11kHZ12kHZ16kHZ22kHZ24kHZ32kHZ44.15: kHZ48kHZi2s_slapcm0_slpcm1_slpcm0_mtpcm1_mt -----AO DEV STATUS------------------------------------------------------------------------------------------------------- %5s%12s%8s%12s%8s%8s%8s%8s%12s%10s%10s%10s%7s%10s IntCntFrmTimeMaxFrmTimeDMAChnDMAReqTranLenIsrTimeMaxIsrTimeDMAPhy0DMAPhy1CurDMAPhyPinPonErrCnt%5d%12u%8d%12d%8d%8d%8d%8d%12d%10x%10x%10x%7d%10d start dmalli failed AO not support this mode:chncnt:%d,bitwidth:%d aochn:%d, index:%d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/arch/include/ai_drv.h0AoDev=%d, AO_DRV_ISR fail, sio mode may not insmod /home/pub/platform_h3/mpp/code/mkp/../arch/hi3521/hal/audio/ao_drv.cAO Dev%d Int Status : 0x%x, cnt:%d DMA chn id:%d not fit ! AoDev=%d, AO_DRV_DisableDev fail, sio mode may not insmod AoDev=%d, disable ao tx fail! AudioDevId:%d Get DmaChn fail ! dmac_register_isr failed alloc dmalli_space failed build dmalli failed AoDev=%d, AO_DRV_EnableDev fail, sio mode may not insmod AoDev=%d, clear ao fifo fail! AoDev=%d, enable ao tx fail! AO3 only support AIO_MODE_I2S_MASTER P$\$Tzhi3521_aoGNU^f!5M?AAZ;A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gc5:c4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4{ /) |0% 08P|4 C<}hKT24g c 0 sԔo < }$y $ؖXzؖpؖ/,3̜y L   (  )H,7AtP0[ `,cn s x$ `"D `DH ( < `p T  `  L     `X \ 5:   `p t   $ p ` $ * `|00 6 `dh< B H NL ` T `Z  `""`H f( `H%`l { 0 @P \ h t    /AS1` d qh yl(   ` `,L%0`%%7[X xs  nt  `L(T( `))P `**x `,,`11  `83<3\     d  `55`55 |   `4=<=`@@  t 8 L * `D D6 $  `FF0 f NP 4 P H < B Z 5 :( H T ` @ X l d  t |          & , 2 8 > ``J`D S b q       ( `X `0pvhJpv[ 74n$ s@ `,L0Lh `(M,M `ZZ`__`dd h 6L 0T N\ Hd <l Bt T| Z   (  f `    $< D *4  0 d l t            , \lx &  `mm2X 8l  > ,$ `q$q$q|  4 `r5:r `0t4t4t|! ' `uu- 3x 9\ ?@ E K Q `zzW  `{`4]4lH{Xl0DX d@    '6 E(T<cP {\ B\`  ` `   Tz`pvPz``B`xx#&7!`  G\ Wbpvo$$rT@0#L%(0<LJ,]<=Pip,M 0L<3\,'(1.7DLt dXT(xdukd)0r@  J) ; (KL mb l 5: z 0r   % J,  F| $s   hJL _H# t%,0 ZlC KxR 0` 5Pj Dv zD   h 5T  Hd ,   t4 *4* @ d,P ua r y $aao_openao_closeAO_Notify.LANCHOR0AO_QueryState.LANCHOR1AO_GetVerMagicAO_ModExit.LC0$dAO_ModInit.LC1.LC2.LANCHOR2.LC3AoIoctlao_ioctlao_poll.LC4.LC5.LC6.LC7.LC8.LC9.LC10.LC12.LC11.LC13.LC17.LC18.LC19.LC20.LC16.LC14.LC15.LC21.LC22.LC25.LC23.LC24.LC28.LC27.LC26.LC30.LC29.LC33.LC34.LC32.LC31.LC35.LC36.LC38.LC37__func__.25224__func__.25186__func__.25164__func__.25014__func__.24427__func__.24825__func__.24703__func__.24643__func__.24515__func__.24888__func__.24762__func__.24575__func__.25076__mod_version1012__mod_license1011__mod_author1010s_s32AoStateao_fopss_stAoModules_stExportFuncss_stAoUserRefg_AOumapd.LC40.LC43.LC39.LC42.LC41.LC44.LC46.LC45.LC62.LC47.LC48.LC49.LC50.LC51.LC52.LC53.LC54.LC55.LC56.LC57.LC58.LC59.LC60.LC61.LC63__func__.23672__func__.23944__func__.23919__func__.23898__func__.23536__func__.23646__func__.23592__func__.23757__func__.23435__func__.23699__key.23811AODMAStartAO_DRV_ISR.LC66.LC64.LC65.LC67AODMARelease.LC68.LC69.LC70.LC73.LC72.LC71.LC76.LC74.LC75.LC77__func__.24319__func__.24307__func__.24106__func__.23786g_u16VolCoef__func__.23693__func__.23603__func__.23561C.345.23944C.346.23945__func__.23928__func__.22189__func__.24144__func__.24197__func__.24087__func__.23466__func__.24054__func__.24021__param_str_dma_cir_lli__param_str_use_tasklet__mod_dma_cir_llitype58__mod_use5: _tasklettype55dma_cir_lli__param_dma_cir_lli__param_use_taskletuse_tasklets_pfDmaCallback__mod_srcversion23__module_depends__mod_vermagic5AOQueryChnStateAOPauseChng_stAoDrvDevdmac_start_llim2pparam_ops_uintAOSetChnResmpInfoCMPI_RegisterMod__this_modulesnprintf__arm_ioremapfinish_wait__iounmapAODMATaskletupAOBufInitAoGetDMAChncleanup_moduleAO_GetChnCtxAOEnableChnprepare_to_waitAO_DRV_GetVolumeAO_DEV_ExitmemcpyCMPI_MmzMallocCMPI_UserCopyAO_DRV_PutChnDatado_gettimeofday__wake_upAODetectBufConflictCMPI_RemoveProcAoGetDataAoGetVolumeinit_moduleCMPI_CreateProcAoSetDevAttrdmac_channelstartscheduleg_astModulesAO_ExitAOResumeChnAoSetVolumedmac_buildllim2pfree_dmalli_spaceallocate_dmalli_spaceAO_DRV_DevInit__aeabi_idivdmac_channelcloseAoClrAttrtasklet_initg_stAoDev__tasklet_scheduleCMPI_UnRegisterModpanicAO_DRV_SetDmaISRdmac_register_isrAO_DRV_SetVolumeAO_DRV_DmaBufInfoInit__memzero__aeabi_uidivg_stAoChnHI_LOG__init_waitqueue_headAoGetDevAttrAO_DRV_DevDeInitCMPI_MmzFreeAOProcShowAODMAIsrAOReceiveFrmAOClearChnBufAO_DRV_SetDmaBufAddrAO_DRV_PutZeroDataAO_GetDevCtxAO_DRV_PutLastDataAO_DEV_ClrAttrg_stAoBufLockAOBufExitAoEnableDevAO_DRV_SetDevAttrseq_printfdown_interruptibleAOPutFrameAoDisableDevdmac_channel_freeAO_InitAO_DEV_InitAODisableChnautoremove_wake_functionAO_DRV_DisableDevAODmaCallbackCMPI_UnRegisterDeviceAO_DRV_ProcShowAO_DRV_EnableDev__copy_from_usermsleepCMPI_RegisterDevice4+8,T+ X, +,+,+,++,, +,+ +$,(,4+8,@DX+\, <HT`p|+,+,+, ,+ 0, 4L+P,\h+!l,!p++,5:,+","(+,,8H+%L,%Tl+p,|+&,&++,,+','@+D,P`+*d,*l+,++,+ +$,0L+,P,,X +,+-,-+,+&,& + ,$ 4 +%8 ,%< p +t ,  +* ,*  + + , , +' ,'  + + , , +. ,.  + + , , +/$ ,/, 0 +4 +8 ,< ,H +0L ,0T X   , H +L ,X h +&l ,&p  + ,  +% ,%  + ,  +3 ,3   + ,, 0 +4@ ,4H +L +P ,T ,` +'d ,'l p     4 D +H ,T d +7h ,7p  + ,  +8 ,8  + ,  +& ,& +,(8+%<,%@Xhx+|,+9,9++,,+',' <P+,+<,<+, +8$,8,H+L,Xh+&l,&p+,+%,%++,,+=,= +$,0<+>@,>DT+X+\,`,l+'p,'x|,Td+h,p|+A,A+,$4+A8,A@Tp5 :+,+A,A+, +%$,%(@h+l,x+&,&+,+B,B+, +8$,8,<+@+D,H,T+'X,'`d$+,,dx +,,+E0,E8@+,+&,& 4<T+X,dt++x,++,+,,,+, +E$,E,H+L,Xl+8p,8x+,+F,F+,+%,%4+8,DP+GT,G`|+,+H,H++,,+','++,,+.,.<d44+8,DT+3X,3\d+,+K,K+,+&,&$+(,4D+%H,%Lh+l,x+8,8++,,+','++,,+.,.( < d   !! !+$!,4!@!+NH!,NP!`!p!!!!!+!,!!+&!,&!"+", "0"+%4",%8"H"+L"+P",T",`"+'d",'l"p"+t"+x",|","+.",."""+","+ ", l#+p#,|##+Q#,Q##,$T$5: `$zx$$$$$$~$$$$%y%+%,$%0%+R4%,R8%H%\%+o`%,o%%+r%,r%<&T&+sX&+t\&,s`&,tl&|&+u&,u&&+s&+t&,s&,t&&+v&,v&&&+s&+t&,s&,t''+w',w'X'+s\',sh'x'+w|',w''''((+s(,s((8(+x<(,x@(L(P((+s(,s((+w(,w(()),)<)+s@),sL)`)+{d),{p)))+s),s))+x),x))))*(*D*+sH*,sT*d*+~h*,~p*x****+r*,r$++o(+,o+,, ,D,X,+s`,,sl,|,+,,,,,,+,,, -l-+op-,o11+r1,r12L2`2t2+sx2,s22+2,22+s2,s22+w2,w22+s3,s 33+3, 3,3833+o3,o3 444+s84,sD4P4+T4,X4|4+s4,s44+4,44+s4,s45+5, 5(5+s,5,s85L5+P5,X5h5+l5+p5,t5,5+5,555555,6L6+oP6,o7+o7,oL8;;;;+s;,s;;+;,;;+s;,s< <+<,<4<D<+sH<,sT<d<+h<,p<<<+s<,s<<+w<,w<<+s<,s= =+=, =4=8=|==+o=,o== >L>x>>>>(?T????@5:8@\@d@x@@@+@,@@+@,XAtAAAA+oA,oBHB+oLB,oB+sB,sBB+B,BB+sB,sCC+C,C(CHC+sLC,sXCdC+hC,lCC+sC,sCC+C,CC+sC,sCC+C,CCDD`DD+oD,oDpEEEE+sE,sEE+E,EE+sE,sFF+F,F4Fx,>xx+x,xx+=x,=xxyy+y,$y0y+?4y,?ty,>xyy+y,yy+@y,@y+*yy+(y+1y,(y,1y,*yy+y,y z+Az,Az+*zz+( z+1$z,((z,14z,*PPP RR\儠8K @ @8 4 00@00 (KJ 0-LMP$0@SK(@T 0@!@P",0Q @ 0 @0@k1 @J,0Q , @R @ 63:P8 R<0SSK0 0 @0@x<80 @J 0 @0@b$0 @J p-L MP@-a@bH P@*؀ 3\P   \PP00 Kp0 @?0  @0 @#0 @PPJ@@8 13PP@P@@ 3>@@@@ -L MP@`0SSPUF1pp@RH^4*—`1 1 R` ``Pr K1  @0  @`@@ 3@@@@@@ 3pp@p@@` 3``@`@@8 ?@@@@@@ 3@$ -L p-L MP@`FQ00@2P P( VHVI*R   RJ`  &!Kp<1 @S0 @!J0 @0 @!J!0 @E0 @J@@P W2@@@@ 0@`@@ :2``@`4H -LTMA00@pB`0S RPH RP dZkHhPC @P] PP[   tK 0 SL`D00`@0` `0 h d X l \p 4P `P QE` 0S1\ R0S ``JQ(K1 @060: @00P 1 @-0 @ ``J00@@ 2pp@p@@ 2PP@P@@x 2@\@`D0 @b`0 @ ``J  \ -LMP@QPPJ a@b0S $` @PpK|0 @ 0 @PPJ80 @QP0 @ PPJl -L@MP@UTpKa @@b@\ 4K0 4 00K@@ )>@| -LlMPP@p8SJX ` H@ @!  @` ጠK | t` `Sp0 H 0 x H0 l@ P00 SP1 `}?@pK`  00@0 @ < 80 4   R `P@J @8H @ !(K JV H -LM0 R   0 K@@ 1@ -L 0-L@P 0 -LPJ -LHMPPJR h@KD P 0ERpD*`V=*!  P* $ $ U)\ \* $ $ U ^*$ $ \*$  $ U R0:$K -L MP@P1 @0 @J(K耑@ ``pPO 2 S6%:  P0 @0 @P@0 @0 @J -LM@Tt1 @]0 @PPJ$K脁pp@``PP^_OpX&ZP  0R ]?P  QPP!0 @0  @L0 @e0 @  -LMP@p1 @NϠ0 @J$K耡pp@ PP`PO pZ)0S 0 @S0 @0 @G0 @@0 @?0 @J -L MP@QJ K80 @KϠ0 @J 0-LMP@Q@@JK00 @0 @@@JQ@ 2PPNOO@ -L MP@PQJ(K2 @0 @Jꄡpp@ ``PO 2pSP P: P#$  1 @0 @ 0 @0 @J0 @0 @ J@0 @0 @Jx -LMP@p1 @0 @J$K老pp@ PP6?:POb V `V&b0 @0 @0 @0 @@0 @0 @ J x-L`@`@!Q@T P2S !Q @Tx -L MP`2 @0 @@@J(K耑@ RppPNOO 2PSP PG@P?@00 2 @ @   d@h@l@p@$Q  0(0 P $S:$P P0 @0  @@@J@0 @@@0 @@@J  -L0h0 -L -L00@ -L@0S0"00 -L 2@ -LM00@p`Ph Q( J K@@@/ 1(P30DW6  W NDW U3WM(P8?0C/2SPHW @ H WZ @HW4pK(PP =? @  03Q P ]?  03^PK P(P?0C/2WU YSW5 ]_O@DWd #@ DW ?P@ 03PkPK@ P(PpKPP ? 03P P (P(P 0?P  0P3U*,K P,P(PpK(PP  ?0  03Q6*: t P m ?0@  003S PK@ P](PnK@ PiK PdSPLW$ LWl }?p  03^K P6PPH 03\, P< %  ?P  0P3UpK PPP& ? 0  003S  PDDW 30HW! 0?P 03\, ,K PP =?PD  0P3UiPKD PPD W'  DW ]?P 03PRpK P 0!003S\ RQ_P P =?   03Q=(K P(^hP 0 @0@g (0 @J<W #WP(PKD PK  PK P|,K Pw(KPr@ Pl UDPPP( P` PZ ;(J -L@@@0S 0-L@@@0S0PP @P0 @0 -L00@ p-L0  @P Q \@ P@t Q @ P`@(0tp 0-LDPP 0@P P 0S0pS -LMP,@KP@ 0p|p$xp`p Rpp(0p``@@PTp@w pqPX 4K4 00`pty 0 4K!PL 4  00`py 0 4KP. 4 6):   `pW@(KP @4K @4 0 @@@ @@@@@@ 0-L@1PQ @P 0@@ @@J@ x-L @@0 T PT %Q P`0(T0@ xx 0-L M%P700@@P T600@P P  !K0!0S S @P4K@0 @@ -LM@Pp@@` s8@揄\033!P # 0C@S !$KP0 0@ @A"@ -L  -L  -L@TD0S 3/ -L,M@@@PP@@ @P`Kx3S  r3D @ <  40 0P 8 Px3x3S(K 0-L00@PP @P H P @|#|C@ !0!0@@0 -L@ -L@@ P@@<@P @ P @4PcivCheckAttrPCIV_PicFreeFromVoPCIV_PicVoShowPCIV_FreeShareBufPcivCheckNotifyCntPCIV_SrcPicSendPCIV_GetAttrPcivSrcPicSendDonePcivUserDmaDonePCIV_HidePCIV_StopPCIV_StartPCIV_GetPreProcCfgPCIV_SetPreProcCfgPCIV_SetAttrPCIV_DestroyPCIV_CreatepcivIoctlPCIV_DrvAdp_CheckRemotetopbotfrmintl [PC6<:IV] Version: [Hi3521_MPP_V1.0.2.0 Debug], Build Time:[Aug 31 2012, 13:02:10] -----PCIV CHN ATTR-------------------------------------------------------------- %6s%8s%8s%8s%8s%8s%8s%8s%10s%8s PciChnWidthHeightStride0FieldPixFmtBufCntBufSizePhyAddr0Bindsp420sp422p420p422uyvy422yuyv422vyuy422%6d%8d%8d%8d%8s%8s%8d%8d%10x -----PCIV CHN STATUS------------------------------------------------------------ %6s%8s%8s%8s%8s%8s%8s%8s%12s RemtChpRemtChnGetCntSendCntRespCntLostCntNtfyCntBufBusy%2d%6d%8d%8d%8d%8d%8d%8d%8d%12s [Func]:%s [Line]:%d [Info]:Buffer count(%d) not invalid,should in [2,4] pAttr->u32PhyAddr[i]:0x%x invalid Invalid remote object(%d,%d) invalid chn id:%d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/hi3521sdk.svn/mpp/component/pci/pciv/kernel/pciv.cpVoPic->u32Index < pChn->stPcivAttr.u32CountpVoPic->u64Pts == 0PCIV_DrvAdp_BufFreeNotify err,chn%d pcivChn < PCIV_MAX_CHN_NUMpVoPic->enFiled < VIDEO_FIELD_BUTTpVoPic->enSrcType < PCIV_BIND_BUTTpVoPic->u32Index < g_stPcivChn[pcivChn].stPcivAttr.u32CountHI_TRUE == g_stPcivChn[pcivChn].bBufFree[pVoPic->u32Index]FirmWareVoShow Err,chn:%d, return value: 0x%x Pciv channel %d not start! Buffer index %d is too larger! u32Index < pstPcivChn->stPcivAttr.u32CountWarnning: PcivChn:%d, ReadDone MsgSeq -> (%d,%d),bufindex:%d 0Warning: pciv is not enable, when func: %s pSrcPic->enSrcType < PCIV_BIND_BUTTpSrcPic->enFiled < VIDEO_FIELD_BUTTNo Free Buf, chn%d kmalloc PCIV_VOPIC_S err! chn%d DMA task err! chn%d HI_TRUE == pChn->bBufFree[u32CurIndex]Channel %d has not been created (pcivChn >= 0) && (pcivChn < PCIV_MAX_CHN_NUM)(pstTask->u32PrvData[0] + 1) == pstTask->u32PrvData[1]Channel %d not created pciv chn %d hide%d ok Channel %d has stoped pciv chn %d stop ok Channel %d not config Channel %d is running pciv chn %d start ok Channel %d atttibute error pciv chn %d set attr6<: ok pciv chn%d should stop first then destroy pciv chn %d destroy ok Channel %d has been created pciv chn %d create ok pciv[Func]:%s [Line]:%d [Info]:invalid chn id:%d PCIV create proc error pciv register failed error PcivInit failed PcivInit success hios_mcc_open err, id:%d Can't open mcc device 0! %s g_pstMsgHandle is NULL Err : pci target id:%d not checked !!! No this target %d Who are you? Target=%d Unkown how to process Send Msg Error tar:%d, handle:%p, type:%d, len:%d, ret:%d -------------------Msg Error--------------------------- alloc memory SEND_TASK_S failed! version=Hi3521_MPP_V1.0.2.0 Debuglicense=GPLauthor=Hi3531 MPP GRPsrcversion=0AD0E54DA86652651FE9960depends=vermagic=3.0.8 mod_unload ARMv7 \,,Phi3521_pcivGNUcʶRr^FNbqو A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.rodata.str1.4.modinfo.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment6 ): 45 jH)50% 08 64 C6<K27 Z|BgCdc p qtD$m  E$EUEpE/E,GTKP _  $).3 8=dChHMRW\bhntz ,<DLT\l4 (08@D?d !'-39`?E  KQWp]Lc(i   o4u{T 6 *:  tP<,0DH<@X@hlp,0HLL    d#&5$D4SHb\ql |       H"H4HDJ#P#Y#c#  o$,J4$0$,L$P) .,38,M C  " "  .   $ \h (  '4( J6JFJ8- P(.,.$4 )P 00.l  $3 M 8 C 6 ?:R W4 Hp $U$ d 4 PqPpST T D D# h  q!    ,0l 'H:M^o0|$ 2L0T 4 DT`p|T-|  \30p,x!@8(M5d 1~h10 48)0F]lg@qx     T% 0 C S p P} T,   0 -\ 8-   $H$ 3 ,l@ N X4e z  ,.     4$aPCIV_GetShareBufState.LANCHOR0.LC0.LC1.LC2.LC3.LC4.LC23.LC5.LC9.LC6.LC7.LC86 %: .LC10.LC11.LC12.LC13.LC14.LC15.LC16.LC18.LC19.LC20.LC21.LC22.LC24.LC17.LC25.LC26.LC27.LC28.LC29.LC30.LC31.LC32.LC33.LC34.LC35.LC36.LANCHOR1$d.LC37.LANCHOR2.LC39.LC40.LC38.LC46.LC41.LC42.LC43.LC45.LC44.LC52.LC51.LC50.LC49.LC48.LC47.LC54.LC53.LC55.LC56.LC57.LC63.LC62.LC64.LC60.LC59.LC58.LC61.LC65.LC66.LC67.LC69.LC68.LC71.LC70.LC74.LC73.LC72.LC76.LC75.LC78.LC77.LC80.LC79__func__.18293__func__.18868__func__.18835__func__.18689__func__.18668__func__.18773__func__.18412__func__.18751__func__.18584__func__.18514__func__.18483__func__.18459__func__.18446__func__.18429__func__.18384__func__.18362__func__.18321g_stPcivChng_listHeadUserDmag_stUserDmaPool__key.18897pcivOpenpcivClosePCIV_NotifyPCIV_QueryStatePCIV_GetVerMagicPCIV_ModExitpcivIoctlPCIV_ModInit__func__.19888__mod_version465__mod_license464__mod_author463s_enPcivStatepciv_devpciv_fopsg_PcivIoctlMutexs_stPcivModules_stPcivUserRefstDmaBlk.19908__func__.17982g_s32LocalIdg_stBaseWindowg_pstMsgHandleg_listDmaTaskstMsg.17853__mod_srcversion23__module_depends__mod_vermagic5PCIV_ExtExitmisc_deregisterPCIV_PicFreeFromVoPCIV_FirmWareRegisterFuncPcivSrcPicSendDonePCIV_FirmWareStartCMPI_RegisterModPCIV_UserDmaTaskPCIV_GetAttr__this_modulePcivDrvAdpSendMsgfinish_waitPCIV_FirmWareDestroyupPCIV_Destroycleanup_moduleprepare_to_waitmemcpykfreePCIV_InitPCIV_GetPreProcCfg__wake_uphios_mcc_getlocalidPCIV_SrcPicFreeCMPI_RemoveProcinit_moduleCMPI_CreateProcschedule_timeoutPCIV_WindowVbCreatekmem_cache_allocget_pf_window_basePCIV_DrvAdp_EunmChipPCIV_ExitPCIV_SrcPicSendPCIV_DrvAdp_BufFreeNotifyPCIV_DrvAdp_CheckRemotePCIV_FirmWareFreePCIV_CreatePCIV_WindowVbDestroyPCIV_DrvAdp_AddDmaTaskPCIV_DrvAdp_GetBaseWindowCMPI_UnRegisterModpanicPCIV_ProcShowprintkPcivDrvAdpMsgISRPCIV_FirmWareSetPreProcCfgPCIV_FirmWareCreate__memzeromisc_registerpcit_create_taskPcivDrvAdpDmaFinishHI_LOG__init_waitqueue_headPCIV_FirmWarePicVoShow6 0:PCIV_StopPCIV_FreePcivUserDmaDonehios_mcc_openPCIV_FreeShareBufhios_mcc_closesprintfPCIV_PicVoShowhios_mcc_getremoteidsPCIV_FirmWareStopg_stMsgHandleAttrPCIV_FirmWareSrcPicFreePRINT_FIELDseq_printfdown_interruptiblehios_mcc_sendtoPCIV_FirmWareWindowVbDestroyPCIV_SetAttrPCIV_MallocPCIV_FirmWareWindowVbCreatePCIV_StartPCIV_SetPreProcCfgPCIV_DrvAdp_ExitPCIV_DrvAdp_GetLocalIdhios_mcc_check_remoteautoremove_wake_functionPCIV_Hide__copy_to_userPCIV_ExtInitPcivCheckAttrPcivDrvAdpStartDmaTaskPCIV_FirmWareSetAttrPCIV_FirmWareMallocPCIV_DrvAdp_Init__copy_from_userhios_mcc_setoptPCIV_FirmWareGetPreProcCfgkmalloc_cachesPCIV_DrvAdp_DmaEndNotify+,+,+ , + , + , + , + ,(+ 0+8+<,@+D+L+P+T,X,\+`,d,h+p,t+|,+,+,+,+,+,+ , +, + , + , +,$+(,4+8,D+H,T+X,x+,++,+ , + , + , (+,,8+<,H+L,X+\,h+l,+,++,+ , +!,!+ +"$+(,",,0+#4,#8+$<,$D+%H,%P+&T,&\+'`,'h+(l,(t+)x,)+*,*+++,+$+,,,4+d+-h,-+ ,4++,,+,?d+0h+1l,0p,1|+2,2+0 +1,0,1 4+38,3@X+0\+1`,0d,1p+4,4+,  < +0@ ,0L X +5` ,5d x +0| ,0  +6 ,663:  +7 +8 ,7 ,8 +9 ,9  +7 +8 ,7 ,8 +: ,:  < +@ ,  +0 ,0  += ,=  +7 +8 ,7 ,8 +> ,>( , +70 +84 ,78 ,8D +?H ,?P T +7X +8\ ,7` ,8l +@p ,@x | +7 +8 ,7 ,8 +A ,A  +7 +8 ,7 ,8 +B ,B   ) + , +0 ,0  +E ,E  +0 ,0  +F ,F , +00 ,0< L +6P ,6T d +7h +8l ,7p ,8| +G ,G  +H ,H  +7 +8 ,7 ,8 +I ,I    + ,d+Ch,C|+,+0,0+L,L+0 ,0(+M,,M0L+7P+8T,7X,8d+Nh,Npt+7x+8|,7,8+O,O+7+8,7,8+P,P+Q,Q+0,0+R ,R,d+h,+0,0+6,6 +0,0,+U0,U8Dx+,D+7+8,7,8+X,X +-,-h+ p, +7,7@Th+7+8,7 ,8,+]0,]8<L h5x>5.51P+0T,0`p+6t,6x+,,+0,0+`,`(+0,,08H+aL,aPXh5+0,0+6,6+,,Ph'x+0,0+d,d+0,06&: +e,e<+0@,0L\+6`,6d|+,,+0,0+h,h $+0(,04D+iH,iLTl+0p,0|+j,jB+0,0+6,6,t+0x,0+6,6+,,@+0D,0P`+6d,6h|+,,;= 0+04,0@P+qT,qXp+0t,0+r,r+0,0+i,i+0 ,0(+U,,U08Ht+0x,0+6,6+,,   +0 ,0, < +u@ ,uD \ +0` ,0l | +U ,U   +0 ,0  +v ,v    + ,8!@!\!d!p!4!+0!,0!!+6!,6!!+!,",(";<"##+0#,0(#0#+y8#,y@#L#\#t#+0x#,0##+z#,z####+#,$+$,\$+`$,$+$,$, %8t%%@%3&&@& &'9','8h'@x''2''9 (@4(/H(\((@((9@)@T)0))5)94*@D**@**0+@X++\++`+,d+,p+|+++,++ ++++,$,<,9T,@l,,9,,,+,,,,+,,,-+-, -$-+(-,,-D-+H-,d-+l-,-#.#.#(.<.+D.,.+.,.+.6:.,.+.&.,.!/A/@/!h/Ax//!/A/0!,0+00,<0AT0`0+d0,h0p0+t0,x00+0,00+0,000+0,060+0+0,0,11+1,1,1+01,|1+1,11+1,1+1,2-P2+T2,X22%2"2+2,22+2,22+2,3+$3,p3-3+3,3+3,33+3,334P4h4+l4,p4+|4,4 5+C$5,C<5T5`5+d5,5<5+5,5+,$, ++,, ,+0,4DP+T,Xdx ,04<:@DHL\|6 3:hi3521_h264e.ko9Y9Y9Y|7)ELF(4( -L@` 0a @ @ @Ш -L0| l\@ 0d0  @ @` h p t x - 000 -L\0͠ `0  0-LV&FP0@PPT  QX @L $(  ,0  48  <  DH  \`  dh  0 -L0S0 00S 00 R -L0S 00 P -L6-0S0 00 R 0S 000 R6 "#S0\ -L`&@\ QR00 1   a  0nb!  0  1 -L B@t A40 0 00r rQ B 1$#4,4<4 10 !b 0 8  b|00r 0r |00sQS | 1$#4,4<4 10 a  C 1$#4,4<4 1 0l0S 0-L@"0  r _A5̄ 0@P0 00r r@T@ 0B0Q$%4,T<TQ0P!bHA 02@ P s0? A35 1P0@ P00| r@TP @B@1$#D,4L41 PAdȠ0BP 0t@_ A53 10P@ 000| rPU PB@P1$#T,4\410 QeȠ0B$P 0t@_ A53 10@P 07&:00| r@T PB@P1$#T,4\410 QeȠ0B(P 0t@_ A53 10@P 000| r@T PB@P1$#T,4\410 QeȠ0(@Tr R, 0u@PQ231@P0@4 !0 @ 00tPPu R@P$,4,<ă @1cȠ0R0 0u@PQ231@0P@ $@ A0 00rPPu@T@P$,4,<ă @1cȠ0B4P 0t@_ A53 10P@ 0P00u r@TB8P 0t@_ A53 10@P 000| r@T PB@P1$#T,4\410 QeȠ0B s  Br . n Q ^$@^pp.Ο@ tQ ?i|qp Wq pg B 0C 0pz ¯ r ryX p0 0s Bt |r `LQ^"ӂ 0 r rpϠWp0<ȇ  Br . n0QR "!Ġ$ĎlSS38 CÄS c.$,n(  0C S $P SS 0C! a0  S !  0Cn1S ",0S \ 82/ \0 .$ ,n @SYS>΄8 C S c" $$b( 2  0C S Q SS 0C. n1 S ! 0Ca>S 1\a 000  " $$b @SS7<: 39 8CS c.$,n( 0CPS $\  SS 0C!$n( 2  PS  "Ġ, 0CĂl>SP (K>>80 8001\ 0 /  0S0  0@40 4P <@ ,|tPU  ?j~Pu@ TuP @d B 0C P0@x  ¯Pr yPr Z>Jp A0q BTr .D\LnH A\\4 ,tpW ?pjwpw@ TwpP @d B 0CP p0@u P D¯r pr Z4Jᎀ A0 BTr .D\LnX Q\R4P<@- ! 0J L 0 x pp 2, v2  ,$4p@ tQ& ?a|qp Wq pgӒ r r| Xp 00s( Br . nӂ  r rpϠWp0<ȇ\ Br . nQQp@ tQy ?a|qp Wq pgҶӒ r r| Xp 00s+ Br . n0\@tPPU0P\DptPU0P|ptPP0P\ tppW\@tpW|@tppWtQgWtQwt^Q t0S$Q4t0Sq0t00 4@00 8P <@ 5ꅠ?j~Pu@ TuP @d B 0C P0@x  Pr yPrZ>JpA0q BTr .D\LnHAHP=Pz Pp HP LtPU0PtpPU0Pt@tPP7):U0Pp@tPP B 0C 0pz ? B 0C 0pz P tQPtpQpt |tPUn P?@etPu@ TuP @d B 0C P0@x  Tr yrZ5JpA0qI BTr .D\LnHAHPR8P<@< ¯ 0P tPUA P?@etPu@ TuP @d B 0C P0@z  Tr yrX5HpA 0q BTr .D\LnHAHN0PPHtPU0P tpPU0PptPP~0PPHtpPU0PttPU0PptPPP tQPtpQptvPxtQPtQpt@@ 6``@`@@` 7``@`@@8 6@@@@@@ 6``@` -LdM@@@QF  0R3# `R L RJ:c??ppp??``??R b0%%5 ` 0  `0 b <P a0@l h dKa0KKc0Kb0K` \ n a  n b?\0@t QT:0n@cp #1t l0Kr pCt MS`3`# \R3#  VT'0@ @0`0V3# V S`3`# P R3# Qz Vv@@L+Y7@@@@ p @lK0x0 @ 0q  xP Aq0  x A0q xp!!  BR  ^ P  P  0t 0X S0l 7):0a 00l0bW=0 YO* p 'q 0GS 0 R  Q0   Q0p,1 0C S0  ^ \0  \0 Õ@0 ll0 h dKaKKcKbK` 0\ n a  n b?\0@t Q: n@bp "1t l0K pCt lpK@q0  P Aq0  A0q p!!  BR  ^ P  P  0t 0S0n 0a 00n0bV0Yv:n`ap` p`&a 0FpS 0p R  Q0  p Qp0ppp 1 0C S0  ^ P0  P0 P{  00 Q 3 # Q P.*\3# Q'P030#  R  \'0X@ @0 S  S030#$ \":(KP-  @ 0   @lpapp ppp0p0 @   @ 0<   @P0c@ fl h dKa0K` Kc0Kb0K ``\ f a  f b?\0@Y:0f@c#1p l0K`Cp  lpKAp0  Q @p0  @0p p`&!  BR`  V `P ` P `` 0 `0#mS0f0l00f0`Xk0\ P0f 05pc %!`07 <: !` p30( H ^0  Z Q0  Q0'q pG W0p  W  Q0  PQP0PP  p   @  @ppp `@X  @  @ R*6  @ P3# R\3# S P@@ 7@ -LlM@@@'K`QF 00 Q 3 # Q P:n0S &6RX0SBE0@ 0 60 ??ppp\ i `i D `Y5'Kah` p @`&K iKt` l KkKjK `0`S0f 0a 00f0b?Sl0@| Y*`@tK@q0  P Aq0  A0q  |"!  BR`  V `P ` `P` `` 0` 00`S0f 0a 00f0bW Z f  5b %p!`0 !` 30'q 0GS 0 R  Q0   Q0) I Y0  Y  P0  ` P`0`` 6  00 Q 3 # Q P*\3# Q P030#  Rp \n m00S 6&SS R0 @6&J\3# QP030# @ \E"0@ @ 0 S 3 #S00z P3# S\3# R P@@"J2@@@@X7 ?: ^(KR0f@c#1| t0K` Cs"0@ @0 S  S030# \s* P3# Rl\3# Se Pa@@ ?PP@P  @(  @  @\@*0 &S06@@< 0PP@P@@ I?pp@p0 -LP`@ pW(0 S <0P0(R Q 9 R0 S:R0 Q  R0 S*Q r30Q  0r3S :0P0:0r3S : -LFM>Kp̠rK,0 lh @0@ p@a00,Kq`qR[00000 qKq\[ A,K1t#Td|41,r[Qeha00b,bKpvaQ600[p,0Pp qR[0`000 ~Kq\b[ A,PK1t#<tq,0[nȠ00r,`rK0wq Q7 00b[,0Ppq[0`0 v02K sPUr[ C,PK1#Ġd41,[lha0 p00@`&\tQV p?PgupwP Uw Pe L⸢[ JPp0 rK,peK~P 6̎0P[P,e`aR[0 0 ~K~`Vb[ N,PK. ,b[lXQ0`PP@`&t^ ?Pnu~P U~p Pe pA⸢[ p JP 0 K,eK|P60[P ,` aR[00 |K|`Vr[ L,`7 *:KT,\ ,pb[nXQ0R`,puRKo Q6 b[,p R[0`0 vK|pW,p LR[K!d da,r[nȠ0R `,puRKoQ6r[,P[0`p0 wK|PU, pLR[rK!dt da,[ qg 0,Ka~pQ6[P,pQ[0`0 ~K qPUr[ PA,RK!dT da,p[ Qe 0 `PP@`&|tQ  p?PgupwP Uw Pe L⸢[ JPp0 rK,peK~P 6̎0P[P,e`aR[0 0 ~K~`Vb[ N,PK. ,b[lXQ0`PP@`&t^ ?Pnu~P U~p Pe pA⸢[ p JP 0 K,eK|P60[P ,` aR[00 |K|`VR[ L,Ka&d da,`R[a0R`,uRKoQ6b[,P[0`0 ~K|PU, `LR[bK!dl ,[ af 0b,vPbK Ϡa<0b[P,`PQ[00 ~K~PU,P Nb[K! ,P[l0 PP@o.oF^ӆ`&t^  ?Pnu~P U~p Pe A⸂[ p HP 0 K,eK|P60[P ,` aR[00 |K|`VR[ L,Ka&d da,`R[a0,Ka~Q6[,Pb[00 ~K~PUb[ N,PK. ,[ afX Q00P7 0: P@o.oF^ӆ`&t^ ?Pnu~P U~p Pe pA⸂[ p HP 0 K,eK|P60[P ,` aR[00 |K|`VR[ L,Ka&d da,`R[a0R(`,uRKoQ6b[,P[0`0 ~K|PU, `LR[bK!dl ,[ af 0R,`,uRKoQ6[, [00 |K|^, LR[K! ,[ n 0K|,[00 qKq^, AR[K! ,[ n P9 0K0  R <5 @c  00 @0  R6!,0$K 4 @[  00 @0  @@$\6@@@@08P,K p_5̎[,P[00 pKpPU[ P@,RK!T \,[`XQ0 <,P qK 1 [,P[00 |K|^@P@/%BUPPӌ,,t0S ?b~~ R~0P b҇,K p!<0[ , [0 0 |02KsPK, C[K1$#,<,0[aȠ9Vt^wVt^vPtnVt^Vt^vPtVt^3Vt^vPt*VptQVttpQvPtVt^Vt^vPtVxPtQVtPtQvt Ab[ 0 `FP K0 kR[ L,K!Ġ ,P7 %:[nȠ0A\8 t00SH\$0t 0S|t00?@@ d6@D -L4M#㬂4 `axP氣K@nt8  ppa`羂K#p28[ P4@P$C[8  8 qKqP[ A4K A$T$L 4 B[Qe8 R4@uRK\ 5$ !8@[4 @AS[8  8 |KqP[ A4KT,D$TQ4 [ Ad 8 4KPpQC[8  8 pKq^B[ A4KQ%Ġ$\4 R[lHA8 B4PBKt[8 @ 8 tKq^[ A4K QD%$\D A4 R[`Ƞ8 "P4r"K,A2΄8P[@4P@#[88 | #Kr^[ B4K!T"D,TQ4[Ad8@@@.̄t R  ?Pbu r \r l AⰣ[ PJ 8 #K4PKp !> 8 [P4 P [8  8 pKp^[ @4P#K,$ $!4R[a8 PcU PP@. tPm ?`|p \pP l4Kq  >" !8 [4 ![8 8 r #KrPU[ B4PK!$$!4[`XQ8PP@.,t R; ?Plu r \r lҦ4PKp !> 8 [P4 P [8 8 qKp^[ @4P#K,$ $!4R[a8 PP@. tPv ?`|p \pP lY4Kq  >" !8 [4 !7&:[8  8 qKqPU[ A4PK!$$!4[`XQ8 4P|K>%![4P[8  8 ~KqPU[ PA4SK !"T, 4 [Qe8 P4 |K>RQ[P4 Q[8 8 |Kq^[ A4PK !", 4 [n8 PU 8PK@@,1[4 3[8 8 |03Ks^[ C4K 1$#,< 40"[n8 l@, t0SQ 0?c~0s Ps ` BⰣ[ J 08 3K4Kq 1<80"[40[8 080 qK q\[ 0A43K $.44 14[!bȠ73: 80 p@, tQ ?`qq Pq ` CⰣ[ J08 K"4"Kr0!<3180"[401[80 080 r #Kr^[ B4K!"4, 414[ a 80t4 pKϠ<>1[4 [80080 |K q^[ A4K 1$#,< 40"[n80 tPx4 pKϠ<11[43[8  8 qK0q\"h40r"KϠ!<[40#[8080 | #KrP4 B[K1$#Ġ,<ă40[ a 80|4 pKϠ<>1[40#[8080 ~ #KrP[ B4K 1$#,< 40"[n80|\ @, t R ?`~ r Pr `ҟ4Kq!<0182[ 4 3[8 8 q03Ks\[ C4K 1$#,< 40[`Ƞ8 @,1[4 3[8 8 q03Ks\[ C4K 17:$#,< 40"[n\8  R ? @  80 @8  RO!40(KR&  `@,tQ\tQ\tQ|t BⰣ[  P J K8 AⰣ[ PJ #K8 L BⰣ[  P J K8 [ B4K !"4,4 14"[`Ƞ80b @BⰃ[ @ H0 3K8 : CⰣ[ J 0#K8 BⰣ[ J0 3K8 CⰣ[ J 0#K8 S[ A4K 1$#,< 40"[a80 [ 0A43K $  44 14[ !b 80 h CⰣ[ J 0#K8 ? `< @_  80 @8  @@,5``@` \tQ\tQ|t\8t00S\0t0S|t00^ tP R^ tP R~ t  \0t0S\4t00S|t00\0t0S:\4t00S|t001\ t R\$t  R|t  ^ tP^tP~PtySBҢ 4 z澢K቟9"![4  [8  8 xKqZ[ A4K !"$$,$ !4 [j8 ҂4徂K x5"!8 [ (₀4  [8  8 zKqX[ A4K !"$$,$ !4 [h8 Ң4徢K z>"!8[ (₀4 [8  8 xKqX4 A[K !"$$,$ !4 [h8 Pv84 |K7: >"![4#[88 p #Kr\4 B[K !"$$ !4 [n8P8PKI 8<4 Kq>[4 [8 8 r #Kr\[ B4#K .$, 4 [ a <P 8 L4 0pKϠ<[40#[8 8 |03Ks^[ C4K1$#,<40"[l8 P@^00.L,t0S 0?cp0s Ps ` BⰣ[ J 08 3K4Kq 1<80[40 #[8080 q #Kr\[ 0B43K $.4 4 14[!bȠ80T @R"L,,t Rk ?np r Pr ` CⰣ[ J0 8 #K4Kq0!<8[ 40 3[8 8 q03Ks\[ 0C43K !",4 4[1cȠ8 X@,t0S 0?cp0s Ps ` BⰣ[ J 08 3K4Kq1< !80"[40[8 080 qK q\[ A4K !"4,4 14"[`Ƞ80 X^PP @@ \PU%şL,\t^ ?Piu~ Y~ i ڰS[ C ED DP08 K"4"KYr 053180"[40 P[80 080 |氃Kx R[ H4尃KQ$%4,T<TQ4R[1cȠ80X\\ ^ tP^tP~Pt^ t R^$t  R~Pt  \ t R\$t  R|t  T\87: t00S\0t0S|t00\0t0S&\4t00S|t00\ t RX\$t  R|t  OPP @P\ t^O\t^|tF\8t00S\0t0S|t00\ t R\$t  R|t  \8t00S-\0t0S|t00$ 8PKLH0 H0@@!5pp@p -L MP@$p0E(nS`8WWPF@F QWX  ?X Rew0P%QS:? P K 3 @Q0  @ J 2 @0  @͠ J 2 @ 0  @P J 42 @E0  @@ˠ J 1 @0  @@` J 1 @%0  @ J L1 @-0  @ Jx 1 @50  @ Jg 0 @=0  @ JV 0 @G0  @P JD 80 @Y 0  @ J3d -L 0-L00@ A Q 0 -L -L 3@ -L MGP@ @1L2S *00K 0 @?0  @H J 80 @1͠0  @ J 0-LMGP@00@!L"R&  Z0!K0! 0 @%07:  @H J 80 @&0  @ J -L MGP@Q @10K 0 @0  @H J <0 @B@  0 @@ J -L MGP@00@K H0 @0  @H J 0-LMGP@P*00@!L"R9 Q  P0!K0! 0 @0  @ J 0 @0  @H J 80 @0  @ J -L MGPP@9pp@0LbVG Q  Q  p&@ 0 10! K! 0S@4 2/ 0 @0  @ J 0 @0  @H J 80 @0  @ J  -L MGP@ @1L2S. Q &00K 0 @"0  @H J 0 @$A@  X0 @@ J 80 @#0  @ J -L MGP@ @1L2S. Q \ 00K 0 @0  @H J 0 @@@  X0 @@ J 80 @0  @ J0 -L MGP@@1L2S 6 R0bK 0 @R0  @H7:  J 80 @S0  @ J@ -L -L MGP@@1L2S/ Q @0K 0 @0  @@H@ @J 0 @B@  X0 @@@ @J 80 @0  @@ @JT -L MGP@@1L2S/ Q  K 0 @/0  @H J 0 @1B@  X0 @@ J 80 @00  @ Jd -LMGP@PP@!LbV; Q'  v  010!K! 0 @0  @H J 0 @B@  X0 @@ J 80 @0  @ Jt -L MGP@0@!L"R0 Q 4  K 0 @0  @H J 0 @B@  X0 @@ J 80 @0  @ J -L MGP@0@!L"R0 Q 8  K 0 @z0  @H J 0 @|A@  X0 @@ J 80 @{0  @ J -L MGP@@1L2S/ Q @$0K 0 @W0  @@H@ @J 0 @Y@@  X0 @@@ @J 80 @X07:  @@ @J -L MGP@@1LQ/ P - K 0 @0  @H J 0 @O@  X0 @@ J 80 @Π0  @ J -L MGP@@1L2S/ Q @0K 0 @(0  @@H@ @J 0 @*O@  X0 @@@ @J 80 @)0  @@ @J 0-LMGPP@1LBT1 Q MP(@K0 0 @0  @PH P PJ 0 @N@  X0 @@P PJ 80 @0  @P PJ -L MGP@0@!L"R0 Q   K 0 @0  @H J 0 @M@  X0 @@ J 80 @Π0  @ J -L MP  @K <0 @F@  0 @@ J p-L MGP@@1LbV4 Q fn @`PKp 0 @0  @PH P PJ 0 @F@  X0 @@P PJ 80 @0  @P PJ -L M@PS 0S KP8Q$ R ,1 @a 0  @ J 0 @D0  @ J 0 @X7:0  @ J `0 @O0  @ J@@ >2@0 -L MGP`)PP@QLBTI Q5 `P v-  0! K 1 @{   @ 0 @p0  @`H@` `J 0 @rB@  X0 @`@ `J 80 @q0  @` `JD -LMP= 0S   Q0 S! K 0 @  @ J 0 @  @ J \0 @  @ J@@ 1@T -L MGP@)``@1LrWI Q5 PP  40! ! K 1 @   @ 0 @0  @PH P PJ 0 @A@  X0 @P@ PJ 80 @0  @P PJh -LMP; 0S Q% R K 0 @D  @ J 0 @3  @ J \0 @<  @ J@@ .1@x -LMQ Q Q K 0000@@@ 0@ -LMP 0S K \0 @i  @ J@@ d0@ -LMGP@`(pp@qLRUH Q4 @P0 \07 :  !0!K 1 @   @ 0 @v0  @@H@ @J 0 @xPP  X0 @@P @J 80 @w0  @@ @J -LMPg 0S$ R1\> PKQcQSR K 1 @*  0 @ J D1 @  @ J 1 @   @ J 0 @  @ J 0 @  @ J@@8 ?@@@ 0@ -L MGP`*PP@QLBTJ Q6 D`P v-$  0! K 1 @C   @ 0 @80  @`H@` `J 0 @:@@  X0 @`@ `J 80 @90  @` `J 0-LMPP@ RaQn 0SzT0SET-S K00@ Q 0@LP R @0@T L R@ ,2 @ L0  @ JSSQR 1 @|  @ J 1 @g  @ J H1 @M  @ J 1 @U  @ J 0 @]  @ J~ 0 @t0  @ Jm@@8 b?@@@@@@ H?@ -7 : L MGP@.``@aLRUN Q: D@P0 v0   0! K 1 @   @ 0 @0  @@H@ @J 0 @_P  X0 @@P @J 80 @Π0  @@ @J 0-LMPP@u Qi 0SF K00S$`\&@PP_3:%QUg0SS 1 @|0  @P JS(0S ` S 41 @`6  @#2 J 0 @h  @ J 0 @  @ J@@` c=@@@@@@8 b=@@@ v=@ -LMGPP*pp@1LBTJ Q6  f P @1  @  @0!$K̈́00 0 @0  @H J 0 @N@  X0 @@ J 80 @0  @ J0 p-L MGP@@1L2S7 Q# `VC" @ P8``Kp 0 @<0  @PH P PJ 0 @>M@  0 @@P PJ `0 @=0  @P PJ@@ D=@@@@D p-LM@Q @ L2R`V\fw0SR KpSS 30fS0 SV:PF P 27: @0  @`P  JRU:QE Q0V: U* L2 @Π0  @ J 3P 1 @ @0 3 J 1 @l0  @ Jz T1 @v0  @ Jg 1 @0  @ JR 0 @0  @ J= `0 @ 0  @2@@ ^<@T -LMGP@/``@qL2SO Q; PPLr  80 2 4 1!$K 1 @   @ 0 @0  @PH P PJ 0 @N@  X0 @P@ PJ 80 @0  @P PJh -LM0S S Q  0RS K@@8 :@@@ :@x p-L MGP@@1LRU% Q4 %l@8P ` Kp 0 @q0  @@H@ @J `0 @r0  @@ @J@@ t8PP@P -LMGP@`@1LRU8 Q$  F娆 0 P3# pPp W:   ??  P^ 4 @   @ !  J$KS3# PW 3 # ; Z7:(0@ @ 0 pR3#R  pS3# RW3#  Q Z@@8#8@@@@QQ0:Q * 2 @( S0b *00S :  L  00 Q 3 # Q P*\3# Q 0E!tP030#  R \8(0@ @0 S  S030# \* P3# R\3# S P@@$!=8PP@P!-  @0{W*Q 0 @0  @H J 0 @H@  X0 @@ J 80 @0  @ J -L,MGP@1LRU Q  Ff0`p0W 3 # W P : gRV&0! J(KV`3`# \P3#:  V'0@ @pp0p0 W 3 # `W`d\3# PV`3`#  R \@@0'"7PP@PR S* gR `  PlP WPqP:pg g R `p  ` P[*p`  php , !! 0S L00s03$0 P L \  Q $0SS(085 @ La 00 Q 3 # Q P*\3# Q P030#  R \ 0R7: !/hP 4 @   @6 ! J'0@ @0 S  S030# \* P3# R\3# S P@@#7@ u!P30 0 0Y0i ^0@ 4 Xo:0@ih8 0Y0i00h,   P Lp3$ X8 L^4 X$8(08 Y4  4@B ` *8<0 a@  @00 h<0@S`pg40 0papVc*8 <0 0 @ @<04`S 0g0 pg 3 5450h p%0`00%050^@00h@h8 P1 @ 0  @H J0 0 @qΠ 0  @ J 0 @G@  0 @@ J t0  @-  @  @  Q @@ s>@@@@ -LMP  <0  K@@ Y2@ -LMP ,@0! 00 ,0@( -L MGP`)PP@QLBTI Q5 `P v-  0! K 1 @   @ 0 @0  @`H@` `J 0 @N@  X0 @`@ `J 80 @0  @` `J@ -LM@P`P PQ0S+ R8\E^RpW_SR  0P K\^ 2 @9  @ J H2 @  @ J 2 @  @ J 1 @$  @ J 1 @,  @ J H1 @4  @ J 1 @  0 @ J 0 @   0 @ Js p0 @K0  @`P J^@@ =@T -LMGPpP=``@1LBT] QI `&\P!   (0 p00 | ~02 0! ! (K 1 @u   @ 0 @i0  @H J 0 @kN@  X0 @@ J 80 @j0  @ Jl 0-LMGP@PR% @L@#03/K0 0 @ 0  @H7: J <0 @ L@  0 @@ J -LMGP@` R3 PP@LR  P6v S:LC @3h0Sa T* @&P =   0R0cn*ac:p pt:0",l R d m (80t  S T6pt0 !403/(KS3 @@#;pp@p Qh #  6=  0RCa c*:   0  6 * 0P @!t* Q h  Phpx" $ dl4~0clx㬖 & t j0x0 Y 0jp0 | *@0S x  3/0 S |3/ xt  b p 00@0S  |3/ t n $1 @80  @H J: 0 @:K@  0 @@ J( 0 @90  @ J@@8 E;PP@P@@ ?;@@@@ -L,M,K@ P,P!00HSX`@ 0 0PPS0 @P8 Pd I`< @QP d @ ,< @Z  @ P PJ@fv p fv p p xhP7#: F00 @ P@@ C d-⫍< @d0㘖6Ƅ崖ƄƄƄƄ尖PP < ?0@c< Ƅ<娖<< m0Sn q a n0\666؆` r QR s.o솄 666&7 ƄQ7662 SDŽ QԆ@<  0ƄSK͂ DŽ'Q@l4K p7/4k>"80 pP|4 p0 $0 ( 0p0(  t  p 00 (L8d 0(d|0 \ 0t    $(000 d p )d0\ X9 T8)pppp 00 P|E @1 pP p00 x 0 |  0 0?Zt  ͠ p $t ( 0 00 琙 砉㦍  縙)0 9  pppph尖x崆`p  ଆ0  @c&000疍p 噍f}0p  d t d| 嚍`  0`@PP`:P`&\pp(t tPD [|0D$|4,8̈́-$8 PPP PJl LB <?0@c < 圖0< 1< 堆0 < < 0 l37$ :  @ˠ0  @P PJ0 p0 @ p瀐@ p p@ppU 2 @TP  @ P PJ 2 @TP0  @P PJNhx 02 @gϠx  @*da1 @`  @e 1 @_P0  @H@P PJVuQ `   @ P PJM(1 @ C@  0 @P@ PJ 0 @C@@ 0@@@@@@ 0pp@p@@d 4``@`@@D 0@@@ 4``@` -LLMP@@PO (K@p@@@ 0 @0@``@@```@p@`@``@@@ @@Ȧ먚04P 4@\@ `V: \6PDQH0P PQP ,_Q P@HV PP4@\ `: \6DV^0 PPPV P @HV PP0S4P@@@@ @ @00@pp@p@ @@@pp@p@㐊㔪㠚p@\P :J 0 @@J J J@@@@@\ :J 0 @@J J J@@@@@T@@@P @ @ 0@@p@p@ p@@@눪7%:Pb p QTPpePb@p 0@p ppppP @T@ 0S% ƓpP RpP pPb @pQbnb 0`p@ pppppP p@0S Ɠ  RP pb QPbP`@p@p@ @ @00@P@@@@鬆봖0㰦 \@@  0 1 @\  0 1 0HS@@ @ @00@@@@@@@@ @@p<|㜔\0S: 0SQ 0Si 0S 0S 0S 0S pHW AT PD$0P@00  T H L \0S`d$p@ th l 0S$0@      0S$0@  0S}$0@  0Se$0@  0SM%%0@   0S5 $%00@ p4( ,HW@@@ @ @00@p@p@p@@u@@ \ ^1 @HT+  7&:^@ Y 1%䓟0 @H0 H3匑  @3क@ HT@@@@@@ @ @00@@pp@ p@@@pp@ p@p$娅㬥㰕@@0P  @\0p( PD6`P P10P QPPU @ QPP]QPPUQ P Q$PHW0P@@@@ @ @00@p@p@p@@@@ @@@p@p@@@p @DpP4 @dh0P 8` 80 @0@^% PDƞ` Q00 `0U`` a`e Q P 4P ` PtP PxP P|P P PHT0P@@  4  -LP ! #*P ! #*P   P @ 1 bc@ -LM@@@pQF `00 Q 3 # Q# P!: @!d  0` 0 #4 0 #c &\ L#. #!`(?#8"P #`! \#".31"#(8##ᣇ"(\#)#a  &(h&ᦀ7)#& &. )?#8Dl`K0`7 0Є \ n a  n b?\T0@pW* @0Bq  X Aq0  A0q * JZ   Z P  P `` p 0`\ f a f `?\ 0@pW: f@b"1K` p0C0 p KCp0 7':  X @p0  @0p * JZ   Z \  `\` `` pÕ 3 00 Q 3 # Q P*\3# Q P030#  RY \W (K\3# QP030# F \u 0<@ @ `X 3 # X00u P3# S\3# R P@@!z0PP@P0n@pc#1 C0R 0$@ @0 S  S030# \* P3# R\3# S| Px@@h 0pp@p0`@  @ @K/\9* -LM@P`Tp P Q QZ000$KQ000 @@ @1@ -LMupp@(p  0@PQq `qff(K0_7Wpp1W !qS0b10(0d RTh R$ R@ 0!W  0SQ!qSRX ؁ qR h! ( dpW3hpW W !0SppRp Rq ؁ qR h! ( dpWhpWlpWpfpp(  hpWXpxP刀tq́qD hpWtP0qŚqD Q!pQ B\p 0 DH`tt`Z( HD(H0 `gQp WpG\Ep0 `xx`Z( (0 `gQp WRD`\0B 7(: 0DaQ D\D0DpD`\Dq0DaUp0aSEDq \ `0SHa p0p aSDDq@ 0R00SqQ?cS LR! R S  0S$KlpWpfpp(  hpW[Xpp tpxPq́qD hpWtPq́qD tPqЁq tPqЁq ppl pR p (0 hpW,Rp  t xP!pqqD0h RtP!pq!D0tP!pqq0 fp  P+@@ '1@@@@@@d U0@@@@ 1@@@ S?@ -LMup0 !RQ BE@!! K@@ 0@ -LM1SL upr a܁ P Vpp @-\@@TN@@!0``@`hPUxPU5 @T(*TXTPPU Q\ eQ \ dPU @TPDUZ P UPl\ dPU @T:x $KhPUxPU?t0l0hdp0x0AXdA \ d@T @Ph@Tx@T@@< s?@@@ 1@@@@< -LM1 pS"upk @CPaQ@@Q@@!s0``@`hPU6tPU3?t0l0hdp0x0K \ l\ d R5  RU RPPU  RRPPU Q U eQ \ dPU  RPPU Q U eQ \ dPUhPUtPU7):h Rt R@@ s?@` p-L Mup0, P4 P@ `1QaQQP P @@ P RDD@ @ PD!D!`!!!Kp@@8 ?@@@ 0@@@@ -LMup S aVI PK ?5 ^A@TNqE@@qqAp \d h l0 p0 x0 t0( A^@TJqNqAp d @h l0 @p0 x0 @t0ATJApFAq@q@K @@ 1@ -LMuq@p 11\ !Rm P`R R RU @@l#0PP@P!R7S5 p o1SQ01Q QSQ0CP1dQh0WSd hpl`p`x`t`1Q! S0!1Q1$K"!` V00PR0S V\RZ\1) 1S Q a0CRPP!Q1R1 dPh0S1 1QS P0!U1PQ\1Q<1!Sh0S)dP&"@@ 0pp@p@@ 1@@@` 0``@`@@8 0@@@@@@ 0@ p-L MR@ \PT RRH ; R N  QCJQ@Pt` V a7  R7JPt` V0@ SP`bP `  V @P A7*: @P BUt 1DQKpPAt` V P BAt` V  RZP$P\P \MJ QPx`Q 0 aA  RAJPx`Q:@ SPbP ` `` \ @PA @P BU!@@@ 1@@@@PLx`Q P BLx`Q  RZP `PPaH U\-@@@8 1@@@@@@ 1@ -LM,K@Pf㬦㰖㴆pq  0 p,L00`0&pS`$pX V V3 Vn V ` 0 0(K&`  R= R PVV@@8 V^ V @ 0@w"@@@"?@Xc`܁ b0aDp0 p00 0 RVK RVV 0LU"@@@$!V2@ 0@D@p0 pD` 0 00p 0pv@@ 72@@@@@@\ 2@ -08@0 R@@ A2PP@P -L0 -L -LP -L !P -L !P -L RQ\  "P0#Q RQq3 -L$M QH p0 @0P4@ 8P @0 0 L B< 0p@ P`0P `Dp p`00p pP`P04 08P00L07+ : <00@ 0DP0 P 0  0 00@-@ @JPP0B0@5  2P0P  %RHP0Ç0s0S !\2Ƈ0(K Q[ 0@4 8@ < P `0 0@  0pD @0 BPP4Lp p`Pp0`0p`08P0<000@00P0PD0L00@P-@ @0@P@P0:@2@5P P2@0 0 4 8 P @`00 < 0p@ PPP0PDp `p0`0pp`0408P00@0-<00@ 0DP0 P 0@@ 0  PP @J05B@ P P2@6 -L00 -L -L -L0  0  00$*R0 0 *R00(*R00,*R000*R004*R0 08*R0$0<*R0,0@*R0(0t#8 d3<0P#R800#?040 -L -L -LM00@1S l % K @@ @5@ -LM a`dR @@0\011 00 R `P @,( 004瀀4$p5`6P6@7 899:;=$08 <咈@(H0P@SL v``D`aa,`h d@`P\唐XpT嚑瘟0@P`p PXPPX0x0 `t@ |0 P0 `@@x0 0 0 0 d0 |0 0 0 0 0 h0 倠0 0 0 0 0 l儠p删t匠x吠|(p甠t瘠x眠{pР吠pp娠pq尠pq帠 p$qĠp0pȠ4؀7,:@pDqH䠑Lxplpp€P00 8q0K0 00 T`.`K?-K0 %0P 0K/K.Kp-pK0`e0P 0K / K.K-K00P p0pK `/`K .K - K00P 0K /Kp.pK`-`K0Ƅ0P  0 K/K.K-K0pv0P `0`K/K . K-K00P 0Kp/pK`.`K-K0  &0P 0K/K.Kp-pK0`f0P 0K! / K".K#-K00P $p0pK%`/`K&.K' - K00P (0K)/K*p.pK+`-`K0Ƅ0P , 0 K-/K..K/-K0p v0P 0`0`K1/K2 . K3-K0$0P 40K5p/pK6`.`K7-K0 (&0P 80K9/K:.K;p-pK0`,f0P <0K= / K>.K?-K0006ZX`  : @  84 @8k @@)6pp@p 9 @ VP  44 @4M @@\) 6@@@@ @9 @  ,4 @,$/ @@(6@ 8 @up  (4 @( @@(<@ h8 @UP  04 @0? @@(5``@` 7 @$4  @$4?04 @@'5@@@@4U (Ul,U  T7 @-  0 @ @@'.7``@`0U0Up U a 6 @-  0 @P sT0TpT & 06 @-  0 @ AT0TpT  5 @-  0 @ T0700: TpsT  05 @-  0 @ uT0eTpOT u 4 @-  0 @d U%tT0hTplT : 04 @-  0 @) 5TT0HTpLT  3 @-  0 @  h3 @   4 @tW@@# 7@@@@ 2 @4  @4S4@@"7@ 2 @vp4  @4$ @@8"6@ 2 @f`  4 @$g @@!6@ 1 @VP 4  @ 4SI@@`!6@ D1 @4  @4S 4+@@ 6@@@@ 0 @vp 4  @ 4$ @@ 6@ d0 @f`  4 @$ @@ n>@ 0 @  4 @T @@` 6@ |0 @  3 @# @@ 6@@@@ 0 @vp3  @3 @@8!6@ T1 @  3 @Su @@!6@ R `dPTT 1 @0  @0 @@4"7@ P2 @'0  @0 @@"(771%:@ 2 @!  0 @b @@ #"7@ (3 @0  @0 p3 @0  @0z 3 @'g`  0 @P 4 @!wp  0 @: H4 @0  @0 e 4 @'g`  0 @z n 4 @!wp  0 @d w  5 @'g`  0 @ J h5 @!wp  0 @ S 5 @0  @0J 5 @0  @0 @6 @'g`  0 @  6 @!wp  0 @ 6 @'g`  0 @J 7 @!wp  0 @4 `7 @'g`  0 @ 7 @!wp  0 @ 7 @0  @0 { 88 @0  @0 i 8 @'g`  0 @ r 8 @!wp  0 @ {A 00 S #@@L)6@@@t)5@@@)6@@@)6@@@@ -L @@@ 0-LM @@@@P  0 @0@8  @PP@ 72&:@@? H2@"D2K0H264eReorderRefListH264eDoublePpsScaling_List8x8     !(0)" #*1892+$%,3:;4-&'.5<=6/7>?H264eInitPPSPH264eInitPPSIH264eInitSPSH264eWriteSEIVALG_QueueGetRealLenH264eInitSlcHdrH264eEncodeSlcHdrH264eWrStrBufSPSPPSVALG_QueueGetFromHeadVALG_QueuePutToTailH264eWrStrBufSEIH264eEncodePPSH264eEncodeSPSH264eCheckChnAttr !#%')+-/0123  !"#$%&'()*+,-./0123mY$fIf #3E"-+f6D[Vl)kY3Q$ֲffHeEY d)` N H264E_ModInitH264E_GetMaxStreamCntH264E_SetMaxStreamCntH264E_GetUniqueIDH264E_SetUniqueIDH264E_EnableInterPskipH264E_EnableIDRH264E_GetRefModeH264E_GetPocH264E_GetStreamLenH264E_GetVuiH264E_GetRDOH264E_SetRDOH264E_GetDblkH264E_GetRefParamH264E_GetEntropyH264E_GetTransH264E_GetIntraPredH264E_GetInterPredH264E_GetSliceSplitH264E_InqAbilityH264E_GetChnAttrH264eCheckVuiCfgH264E_SetVuiH264eCheckDblkCfgH264E_SetDblkH264eCheckRefParamH264eRefModToRefParamH264eCheckPocCfgH264E_SetPocH264eChe733: ckEntropyCfgH264E_SetEntropyH264eCheckTransCfgH264E_SetTransH264eCheckSliceSplitCfgH264E_SetSliceSplitH264E_GetRoiCfgH264eCheckRoiCfgH264E_SetRoiCfgH264eIsVeduOKH264E_GetStreamInfoH264E_PutBitStreamVALG_CB_UpdateRpH264E_GetBitStreamH264eInitVuiCfgH264eInitRDOH264eInitDblkH264eInitRefParamH264eInitEntropyH264eInitTrans   !!$!$&!$&(!$&(*    ! !#H264eInitInterPredH264eInitSliceSplitH264E_AllocateRefRcnH264E_SetRefParamH264E_SetRefModeH264eCheckIntraPredCfgH264E_SetIntraPredH264eCheckInterPredCfgH264E_SetInterPredH264E_ReadRegsH264E_ConfigRegsH264E_IntProcessH264eReInitRcnRefQueueVALG_QueueInitH264E_StartOneFrameH264eStartPicAsFrameH264eInitParamSetH264E_SetChnAttrH264eInitRoiCfgH264E_InsertUserDataVALG_QueueGetRealLenVALG_QueuePutToTailH264E_ResetChnH264E_DestroyChnH264eInitIntraPredH264E_CreateChnVALG_BallocVALG_BallocCachedContiguousBufferNo YesbasemphpINV1X2XINVINV4XByteNumMbLineN/Acavlccabacall4x48x8H264eWrEncryptSEIH264eGetSliceTypeVALG_QueueGetRealLenH264eDpbInitRefListH264eDpbInser2ListVALG_QueueGetFromHeadVALG_QueueSearchFromTailmm_mark_current_picture_long_termmm_unmark_short_term_for_referenceVALG_QueueInitH264eDpbInserFrameH264eSetReorderH264eSetSlcHdrH264E_DRV_UpdateOsdConfigParamH264E_DRV_WriteRegsH264E_DRV_UpdateRegConfigParam    ! !#   !!$!$&!$&(!$&(* ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/h264e/h264e.cbField == HI_FALSEHI_NULL != pstCtxHI_NULL != scalingListinputHI_NULL != pstStreampstCtx!= HI_NULL0HI_NULL != pDestBufHI_NULL != pSrcBuf/home/pu74):b/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLrcn pic buf cnt is %d! err! All rcn pic buf is used! rcn pic is used by others!0 == pstCtx->stPoc.pic_order_cnt_lsb1 == pstSlcHdr->pstSPS->delta_pic_order_always_zero_flagstStream.udwNumBits <= 128stStream.udwNumBits <= 64 Warning! Buffer left is small than the data writing in! Lenght writing in must be multiples of work (32-bit)!stream buffer abnomal, %s %d write head: %d,write tail:%d,read head:%d,read tail:%d VALG_CB_IsVaild(pstStrBuf) == HI_SUCCESS[Func]:%s [Line]:%d [Info]:stStream.udwNumBits %d err! MULTI_OF_2_POWER(stStream.udwNumBits,8)stStream.udwNumBits <= (PPSBUF_ALIGN_BYTE << 3)stStream.udwNumBits <= (SPSBUF_ALIGN_BYTE << 3)max picture width (%d) err! should in (%d,%d)! picture width (%d) err! should in (%d,%d)! max picture height(%d) err! should in (%d,%d)! picture height(%d) err! should in (%d,%d)! Max picture width(%d) err! should 2 aligned!Max picture height(%d) err! should 2 aligned!Pic width(%d) err! should 2 aligned!Pic height(%d) err! should 2 aligned!buffer size(%d) err! should >= %d (which is 1/2 YUV420 size)! buffer size(%d) err! should be multi of 64! h264e profile %d err! h264eunload h264e.ko for %s...OK! Hi3521[Func]:%s [Line]:%d [Info]:Rgs module fail. load h264e.ko for %s...OK! h264e chn id (%d) error! Should be in [%d,%d]! h264e chn(%d) not exit! function : %s ,line : %d :NULL pointer occur! User EnablePskip(%d) error User EnableIDR(%d) error ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/h264e/h264e_ext.cHI_NULL != pstH264Vuitiming_info_present_flag(%d) err! should be [0,1] num_units_in_tick(%d) err! should > 0. time_scale(%d) err! should > 0. fixed_frame_rate_flag(%d) err! should be {0,1}. User Vui cfg is invalid HI_NULL != pstH264Dblkdisable_deblocking_filter_idc err, should in [0,2] slice_alpha_c0_offset_div2 err, 75<: should in [-6,6] slice_beta_offset_div2 err, should in [-6,6] User deblocking cfg is invalid HI_NULL != pstRefParamu32Base err, should larger than 0 u32Enhance err, should in [0,255] bEnablePred err, should be HI_TRUE or HI_FALSE pstCtx->enRefMode %d err 0HI_NULL != pstH264Pocpic_order_cnt_type err, should in [0,2] User poc cfg is invalid HI_NULL != pstH264EntropyEncu32EntropyEncModeI err, should in [0,1] u32EntropyEncModeP err, should in [0,1] cabac_stuff_en err, should in [0,1] Cabac_init_idc err, should in [0,2] HI_TRUE == VALUE_BETWEEN(u32Profile, 0, 2)u32EntropyEncMode err, profile:%d don't surpprot cabac User entropy cfg is invalid HI_NULL != pstH264TransIntraTransMode err, should in [0,2] InterTransMode err, should in [0,2] InterTransMode err, should in [-12,12] bScalingListValid err, should be HI_TRUE or HI_FALSE bScalingListValid err, profile:%d don't surpprot user scaling matrix Baseline and main profile don't surpport 8x8 transform scaling matrix value err, intra: %d, inter: %d should in [1,0xff] User trans cfg is invalid HI_NULL != pstCtxHI_NULL != pstSliceSplitSplitEnable is err, should be HI_TRUE or HI_FALSE u32MaxSliceSize >= u32MinSliceSizeSet slice split mode err,out of [0,1] Set slice split size:%d out [MinSliceSize:%d,MaxSliceSize:%d] byte Set slice split size out [1,picheightinMbs:%d] User slice split cfg is invalid pstRoiCfg->u32Index >= 0 && pstRoiCfg->u32Index < VENC_MAX_ROI_NUMHI_NULL != pstSrcRoiCfgroi %d bEnable(%d) error! Should be HI_TRUE or HI_FALSE! roi %d bAbsQp(%d) error! Should be HI_TRUE or HI_FALSE! roi %d QP(%d) error! Should be [%d,%d]! roi %d (width(%d),height(%d)) error! Should be multi of 16! roi %d (StartX(%d),StartY(%d)) error! Should be multi of 16! roi %d (width(%d),height(%d)) (StartX(%d),StartY(%d)) error!Should be in (0,picwidth(%d)),(0,picheight(%d))! roi %d out of the pic! User roi cfg is invalid HI_NULL != pstStreamInfo76?: bs ptr error! %s err! Len must be multiples of word(32-bit)!stream buffer abnomal, %s %d write head: %d,write tail:%d,read head:%d,read tail:%d VALG_CB_IsVaild(pstStrBuf) == HI_SUCCESSBitatream channel error! Bitatream channel error! s32ChnID : %d ,pstNaluHead->s32ChnID : %d pstNaluHead->s32ChnID == s32ChnIDstream buffer error! HI_NULL != pstVuiHI_NULL != pstRDOHI_NULL != pstDblkHI_NULL != pstEntropyHI_NULL != pstTransHI_NULL != pstH264InterPredHI_SUCCESS == s32Ret%s malloc vb for RCN and REF failed! User SetRefParam error H264E_AllocateRefRcn fail,maybe mmz is not enough. enRefMode(%d) err! should be H264E_REF_MODE_1X(1),H264E_REF_MODE_2X(2),H264E_REF_MODE_4X(5). HI_NULL != pstH264IntraPredAt least one of the two (16x16,NxN) prediction mode should be enabled Intra16x16PredEn is err, should be HI_TRUE or HI_FALSE IntraNxNPredEn is err, should be HI_TRUE or HI_FALSE constrained_intra_pred_flag is err, should be in[0,1] bIpcm %d is err. User intra prediction cfg is invalid Horizontal search window index err, shoule be in [minhwindex:%d, maxhwindex:%d] Vertical search window index err, shoule be in [minvwindex:%d, maxvwindex:%d] bInter16x16PredEn is err, should be HI_TRUE or HI_FALSE bInter16x8PredEn is err, should be HI_TRUE or HI_FALSE bInter8x16PredEn is err, should be HI_TRUE or HI_FALSE bInter8x8PredEn is err, should be HI_TRUE or HI_FALSE bExtedgeEn is err, should be HI_TRUE or HI_FALSE At least one of the four (16x16,16x8,8x16,8x8) prediction mode should be enabled Me Size (%d, %d) don't match chn size (%d, %d). User inter prediction cfg is invalid pstCtx->stAttr.bMainStream == bBigStreambBigStream == pstCtx->stAttr.bMainStreamu32NumRefFrames <=2 && u32NumRefFrames > 0/home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLpBase != NULL%s: Pic with wdith(%d),height(%d) come into chn % d,which with width(%d),height(%d)! pstCtx->u32SPSValidLen <= SPSBUF_ALIGN_BYTEpstC77*:tx->u32PPSIValidLen <= PPSBUF_ALIGN_BYTE(pstCtx->u32PPSIValidLen + pstCtx->u32PPSPValidLen) <= PPSBUF_ALIGN_BYTESet channel attr fail! Vertical search window index is %d, chn height should larger then %d Horizontal search window index is %d, chn width should larger then %d Set Chn attr(width : %d,height : %d ) conflicting with stSliceSplit , bSplitEnable: %d,SplitMode: %d ,SliceSize : %d Can't set static channel attr! HI_NULL != pstRoiCfgtoo large sei! Malloc memeoy Err! HI_SUCCESS == s32RetValNo sei memory! The chn %d has been created! create channel %d fail! h264e%d_Strvalg alloc mmz buffer failed! valg alloc mmp buffer failed! Chn%d w%d h%d alloc encoder stream buf len %d failed. h264e%d_CtxAlloc encoder context failed! malloc vb for RCN and REF failed! VB_INVALID_HANDLE != pstCtx->hBlock[index]get vb failed! Error! Length of buffer must be multiples of word (32-bit)! [H264E] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:46] -----CHN ATTR------------------------------------------------------------------ %7s%10s%10s%10s%10s%10s%10s%10s%12s%12s IDWidthHeightprofileMainStrRefModeBufSizeByFrameMaxStrCntContiBuffer%7d%10d%10d%10s%10s%10s%10d%10s%12d%12d -----PICTURE INFO-------------------------------------------------------------- %7s%14s%14s%12s%12s%12s%12s%12s%12s%12s EncdStartEncdSucceedLostDiscSkipBufLeakRecodeRlsStrUnrdStr%7d%14d%14d%12d%12d%12d%12d%12d%12d%12d -----STREAM BUFFER------------------------------------------------------------- %-7s%-12s%-12s%-12s%-12s%-12s%-12s%-12s BaseRdTailRdHeadWrTailWrHeadDataLenBufFree %-7d0x%-10x0x%-10x0x%-10x0x%-10x0x%-10x%-12d%-12d -----RefParam INFO-------------------------------------------------------------- %7s%10s%10s%10s%10s EnPredEnhanceEnIDR%7d%10s%10d%10d%10s -----ROI INFO------------------------------------------------------------------ %7s%10s%10s%78*:6s%10s%10s%10s%10s indexbAbsQpQpwidthheightstartxstarty%7d%10d%10d%6d%10d%10d%10d%10d -----Syntax INFO--------------------------------------------------------------- %7s%10s%10s%10s slcspltslcmodeslcsize%7d%10s%10s%10d %7d%10s%10s%10s -----Inter & Intra prediction INFO--------------------------------------------- %7s%10s%8s%8s%8s%8s%8s%8s%8s%8s%8s%8s HWsizeVWsizeP16x16P16x8P8x16P8x8MvExtI16x16InxnIpcm%7d%10s%8d%8d%8s%8s%8s%8s%8s%8s%8s%8s -----Syntax INFO-------------------------------------------------------------- %7s%10s%10s%10s%8s%8s%8s%6s%10s%8s%8s EntrpyIEntrpyPItransptransQMatrixPOCDblkIdcalphabeta%7d%10s%10s%10s%8s%8s%8s%6d%10d%8d%8d Warning! Buffer left is small than the data writing in!stream buffer abnomal, %s %d write head: %d,write tail:%d,read head:%d,read tail:%d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/h264e/h264e_encrypt.cVALG_CB_IsVaild(pstStrBuf) == HI_SUCCESS ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/h264e/h264e_dpb.cpenRefType != HI_NULL/home/pub/platform_h3/mpp/code/mkp/include/valg_ext.hpstQue != NULLUSE_FRAME == pFrame->UsedpPic->u32Ref == enRefType(pstDpb->s32ShortRefNum + pstDpb->s32LongRefNum) < H264E_DPB_LIST_MAX_SIZEs32Index >= 0pTmpFrame != HI_NULLpBase != NULLREF_LONG == pFrame->u32Ref && USE_FRAME == pFrame->Used0i < 10 && MARKING_OPERATION_END == pstSlcHdr->stMark.memory_management_control_operation[i]pstDpb->s32UsedSize <= pstDpb->s32MaxDpbSizepic_nums_idc < H264E_REORDER_MODE_BUTT%s %d H264e Reorder err ! pstCtx->bField == HI_FALSE%s %d :enRefType :%d BASE_IDRSLICE == enRefType || BASE_PSLICE_REFBYBASE == enRefTypeHI_TRUE == pstCtx->stRefParam.bEnablePred ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pu79?: b/platform_h3/mpp/code/mkp/../arch/hi3521/hal/vedu/h264e/h264e_drv.cHI_NULL != pstCtx1 == pstVeduStatus->u32TransMode0 == pstVeduStatus->u32Intra8x8PredEn[Func]:%s [Line]:%d [Info]:pstConfig->u32StreamAddr %d err! MULTI_OF_2_POWER(pstConfig->u32StreamAddr, 64)pstConfig->u32BufferLength %d err! MULTI_OF_2_POWER(pstConfig->u32BufferLength, 64)pstConfig->u32StreamRdPtrAddr %d err! MULTI_OF_2_POWER(pstConfig->u32StreamRdPtrAddr, 16)pstConfig->u32StreamWrPtrAddr %d err! MULTI_OF_2_POWER(pstConfig->u32StreamWrPtrAddr, 16)pstConfig->u32TopNBufAddr %d err! MULTI_OF_2_POWER(pstConfig->u32TopNBufAddr, 16)pstConfig->u32IpixBufAddr %d err! MULTI_OF_2_POWER(pstConfig->u32IpixBufAddr, 16)pstCtx->pstRcnPic != HI_NULL0pstCtx->pReorderRef!= HI_NULLpstConfig->u32VeSrcYAddr %d err! MULTI_OF_2_POWER(pstConfig->u32VeSrcYAddr, 16)pstConfig->u32VeSrcCAddr %d err! MULTI_OF_2_POWER(pstConfig->u32VeSrcCAddr, 16)pstConfig->u32RcnYAddr %d err! MULTI_OF_2_POWER(pstConfig->u32RcnYAddr, 16)pstConfig->u32RcnCAddr %d err! MULTI_OF_2_POWER(pstConfig->u32RcnCAddr, 16)pstConfig->u32SrcYStride %d err! MULTI_OF_2_POWER(pstConfig->u32SrcYStride, 16)pstConfig->u32SrcCStride %d err! MULTI_OF_2_POWER(pstConfig->u32SrcCStride, 16)0 != pstConfig->u32SrcYStride0 != pstConfig->u32SrcCStridepstConfig->u32RYStride %d err! MULTI_OF_2_POWER(pstConfig->u32RYStride, 16)pstConfig->u32RCStride %d err! MULTI_OF_2_POWER(pstConfig->u32RCStride, 16)0 != pstConfig->u32RYStridepstCtx->astH264RoiCfg[i].stRect.s32Y %d err! pstCtx->astH264RoiCfg[i].stRect.s32X %d err! pstCtx->astH264RoiCfg[i].stRect.u32Height %d err! pstCtx->astH264RoiCfg[i].stRect.u32Width %d err! 0 != pstConfig->u32RCStrideMULTI_OF_2_POWER(pstCtx->astH264RoiCfg[i].stRect.u32Width, 16)MULTI_OF_2_POWER(pstCtx->astH264RoiCfg[i].stRect.u32Height, 16)MULTI_OF_2_POWER(pstCtx->astH264RoiCfg[i].stRect.s32X, 16)MULTI_OF_2_POWER(pstCtx->astH264RoiCfg[i].stRect.s32Y, 16)version=Hi3521_M7:<: PP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=ContiguousBuffer:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_base,hi3521_vencvermagic=3.0.8 mod_unload ARMv7 $ (hi3521_h264eGNU,MFfJ OuA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.rodata.str1.4.modinfo.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4 )o)08% H8h4 C0K2̞$1Zgc Ě s7;):o ܚ }$y l$pp/# 0@8   X"%*"/""4" 9>"CItOU,[d"""a"t&x&g,mHs";;y0d"II"QQ\x"LhPh"ďȏ P|8`"ȕ"$4@'t6E Tcr0DTd"̕( 8 87<3: ' @1%\*p;@/4"$(Q("<@9" "> "U,"""$(" $"x|"" $"dh"""(,"hl"""tx"Ȯ̮gtCsPa([HIO"\`m"y H "@Dx "    " 0 L "Ķh P "\` "g   ( P  x " m "sP y   @ h   "Ŀ "|` 8  "7=&:"pt"xT8 <"""04"pt8!x'-H"39?E`"K"8<Q"W"<@"]"<@c"X`i""8<o8u "{`|""HL,t "$(4" <x\t""" ""`d( T"X`")`007"HT>ELS\Z"T X a"$ ( h<oTv}$7>%:"\h""""dh(4hTx"8#"#2 AP0 _@nT }d t "01D @TOh^xm| 0DTh!x0?N]l{   0 @ @ @    ' 6 E( T@ cT rl           4  D c\ t & 5 D S b q     1 B " ( ( ""  "H#  D*%/U[47?0: 9>I OCDmaHsgyD 8  g m   P! (!H!yX!s\!d!l!t!|!!!" "" 0""D""""""""-#!#""'#E#98#?#3#K#Q#W#]#c#i#u#o#"3" %  3 D  U 4 h D t H  T "3`  X$$%%H%$";"`  ` @ "$;t% % &*h&/& &%X&4&"4C@C"CC>&9&"FF"HHU'"t*/)4*mH/s0.0.g,/..-d.-D..-"$,H-l-,-,,yL,p,/,0x/y0/l0,,m,(," 1 @ O @\@"(" "d ^ d# q  ! "   h   X  h L ̕ xT& 2 A |<N Nl^ q   ܕ< $   `    3h 0 [, 7A: : ,I W @Ie CH `    $]   V 8 t8*(=$DKRa@pv |\Ŀ@l"hS<<T -CScIt`$[[\\dX !3 IVjU~<@lH  l$,@ Lx&p @l-U D8RSV(gh4vQ<( @H4\4@H.@ =LT<f@ sF  $<`|dJ*"7H[a8n4`Xl;  hDD$6=TN`XboD} x(xh;tH# <'@`9UddoXV7B : @U,T*:L[_Бql~tH$L @C0V(`Ķ̮!th4E`YPh)hrlHt$a.LC0.LC1.LANCHOR0.LC2.LC3$d.LC4.LC5.LC6.LC7.LC8.LC9.LC14.LC12.LC13.LC10.LC11.LC15.LC17.LC18.LC16.LC21.LC22.LC19.LC20.LC23.LC24.LC25.LC26.LC27.LC37.LC28.LC29.LC30.LC31.LC32.LC33.LC34.LC35.LC36.LC38__func__.31194__func__.31042__func__.29627ZZ_SCAN8__func__.29521__func__.29488__func__.29365__func__.29238__func__.27913__func__.31052__func__.30534__func__.30954__func__.27761__func__.27784__func__.29186__func__.30278__func__.29737__func__.29085H264E_GetVerMagicH264E_ModExitH264E_ModInit.LANCHOR1.LANCHOR2H264E_GetMaxStreamCntH264E_SetMaxStreamCnt.LC39.LC40.LC48.LC47.LC45.LC42.LC43.LC44.LC46.LC41.LC49.LC55.LC56.LC52.LC54.LC51.LC50.LC53.LC57.LC58.LC65.LC66.LC62.LC60.LC61.LC63.LC64.LC59.LC67.LC68.LC69.LC71.LC72.LC70.LC76.LC73.LC74.LC75.LC77.LC78.LC79.LC80.LC81.LC82.LC84.LC83.LC85.LC86.LC87.LC89.LC92.LC90.LC91.LC93.LC88.LC94.LC102.LC97.LC98.LC99.LC100.LC101.LC95.LC96.LC103.LC104.LC105.LC106.LC107.LC108.LC109.LC110.LC111.LC114.LC113.LC112.LC119.LC116.LC117.LC118.LC115.LC120.LC123.LC124.LC121.LC122.LC127.LC128.LC130.LC131.LC132.LC136.LC125.LC133.LC126.LC129.LC135.LC134__func__.32820__func__.31777__func__.31759__func__.32782__func__.32772__func__.32588__func__.32560__func__.32478__func__.32370__func__.31285__func__.32756__func__.32691__func__.32670__func__.32653__func__.32543__func__.32318__func__.32248__func__.32159__func__.32093__f7C:unc__.32002__func__.31035__func__.31019__func__.32706__func__.32732__func__.32606__func__.32629__func__.32493__func__.32426__func__.32333__func__.32346__func__.32264__func__.32293__func__.32176__func__.32223__func__.31926__func__.31978__func__.31903__func__.31795__func__.31875__func__.31559__func__.31301__func__.31232__func__.28247__func__.31048__func__.30553__func__.30547__func__.30541__func__.30535__func__.30524__func__.30503au8DefaultIntra8x8Scalingau8DefaultInter8x8Scaling__func__.30484__func__.30477__func__.32393__func__.32513__func__.32447__func__.32108__func__.32135__func__.32019__func__.32061__func__.31741__func__.31716__func__.31645__func__.31372__func__.27727__func__.31322__func__.31473__func__.30422__func__.30924__func__.30456__func__.30874__func__.30833__func__.30791__func__.30494__func__.30587__func__.27448__func__.27486__param_str_ContiguousBuffer__mod_version4948__mod_license4947__mod_author4946__mod_ContiguousBuffertype4944s_stModules_stExportFuncs__param_ContiguousBufferg_strBoolNameg_strProfileNameg_strRefModeNameg_strSliceModeNameg_strNANameg_strEntropyNameg_strTransNameau32UE__func__.29220__func__.29479__func__.29297__func__.29124__func__.27888__func__.29180__func__.29152__func__.29214__func__.29397__func__.29509__func__.29927__func__.29073__func__.29939__mod_srcversion23__module_depends__mod_vermagic5H264E_EnableInterPskipH264eReserveSrcH264eEnableVencH264eInitRoiCfgH264eInitIntraPredH264eCheckIntraPredCfgH264eUpdateBakCfgH264E_GetChnAttrouter_cacheparam_ops_uintH264E_GetRDOH264eSetReorderH264eUpdateRefInfoCMPI_RegisterModhi_dma_map_areaH264eUpdateIntraID__this_moduleH264eSendBkSrcH264E_SetEntropyH264E_SetVuisnprintfu32IntraUpdateIndexh264eUEH264eUpdateFrameNumH264E_DRV_InitIpcm__arm_ioremapH264eUpdatePocH264eWriteSEIH264eDpbFlushmm_mark_current_picture_long_termH264eInitVuiCfg__iounmapH264E_IntProcessScaling_List8x8H264E_DRV_WriteRegsupH264eIsVeduOKH264E_DRV_InitMeA7D: ttrcleanup_moduleH264eInitPPSPH264E_GetRefModeH264E_SetIntraPredH264E_GetDblkmemcpyCMPI_MmzMallocH264E_GetTranskfreeH264eCalcPocH264E_DRV_NodeAddrNeedH264E_SetInterPredH264E_SetTransdo_gettimeofdayH264E_DRV_UpdateRegConfigParamH264eEncodePPSH264eInitPocH264E_AllocateRefRcnH264E_DestroyChnH264eUpdateStreamInfoH264E_EnableIDRCMPI_RemoveProcH264eWrStrBufSEIH264eInitSlcHdrinit_moduleVB_UserSubH264E_DRV_InitCMPI_CreateProcH264E_DRV_ExitH264eInitDblkg_astModulesH264E_DRV_UpdateOsdConfigParamH264E_ExitH264E_GetBitStreamVB_GetBlkByPoolIdH264eRefModToRefParamH264eInitVuiH264E_StartOneFrameH264E_DRV_CheckIpcmH264E_GetVuiH264eEncodeVuiH264E_ReadRegsH264E_ConfigRegsH264E_InitH264E_GetIntraPredH264eGetMaxFrameNumH264eWrHWSlcHdrVB_CreatePoolH264E_GetUniqueIDContiguousBufferH264E_DRV_CheckProfileH264eSetSlcHdrH264E_DRV_CheckMeHwH264E_ResetChnH264eSwapRcnRefH264eScanAndAdd03H264eCheckDblkCfgH264E_SetSliceSplitH264E_InsertUserDataH264eWrEncryptSEIH264E_DRV_InitRegConfigParamH264E_GetStreamInfoH264eCheckSliceSplitCfgH264eInitTransH264eCheckInterPredCfgH264eInitNaluHeadg_stH264eSemmm_unmark_short_term_for_referenceH264E_SetUniqueIDH264eSpsCropH264eCheckTransCfgH264E_InqAbilityH264eDpbInitRefListH264eInitInterPredH264eReInitRcnRefQueueH264eDpbInserFrameH264eInitCtxH264eCheckRoiCfgCMPI_UnRegisterModpanicH264E_GetPocH264eCheckRefParamprintkH264eUpdatePocAndRefParamH264eGetRefNumInfoH264eWrStrBufSPSPPSu32H264eChnUniqeIndexH264E_GetRefParammemset__memzeroH264E_GetSliceSplit__aeabi_uidivH264E_SetRefParamHI_LOGH264E_SetChnAttrH264eReorderRefListCMPI_MmzFreeH264E_SetDblkH264eCheckEntropyCfgg_stH264VencCapH264E_GetStreamLenVEDU_SQPH264E_CreateChnH264eGetSliceTypeH264eInitSPSH264E_GetRoiCfgH264eProcShowVB_Handle2KernH264eInitRDOH264eInitRefParamhil_mmb_flush_dcache_byaddrH264eDoublePpsseq_printfH264E_DRV_CheckMeSizedown_interruptible__aeabi_uidivmodH264eInitEntropyVB_Handle2PoolIdH264eDisableVencH264E_GetEntropyH264E_DRV_T7E:opIpixBufNeedH264eGetRcnPicH264eGetNumRefFramesH264E_SetRoiCfgVB_InquireUserCntH264E_DRV_ReadRegsH264eCheckChnAttrH264E_SetRDOH264eInitPPSIH264eDpbInitH264E_SetRefModeg_pstH264EContextH264eDpbBackFrameH264E_DRV_CheckMeVwH264E_SetPocH264eCheckPocCfgVencBufferCacheH264eCheckVuiCfgH264E_PutBitStream__copy_from_userH264eInitSliceSplitH264eEncodeSPS__kmallocVB_DestroyPoolH264E_GetInterPredVB_Handle2PhysH264ePutRbspTrailingBitsg_msZerosTableKX+++,,,+,?++,,+ , ?@+H,+,T+X+\,`,l+ p, x?|++,,+ , ?++,,+ ,?d+h+l,p,|+,?++,,+,?D\++,,+,? D+H+L,P,\+`,h?l+p+t,x,+,?!l "+","Mh"+l",p"M"+","M"+"+",","+ ", "?""|%$&+(&+,&,0&,<&+#@&,#H&?l&t&&&+&8&,&#&I'+',++ +,1+$1,p3+x3,4+4,6+6,D;+H;+L;,P;,\;+&`;,&h;?l;+p;+t;,x;,;+';,';?;+;+;,;,;+(;,(;?;+;+;,;,;+';,';?;;+s;,s=++=,+=Bt>+x>+|>,>,>+,>,,>?C_tD++|D,+DBD+-E,-EM$E+.,E,.0EMxE+-E,-EME+.E,.EME_H+-H,-HMH+-H,-HMI7F:+- I,-$IM0I+.8I,.h,>xM+3,3M+?,?̓M+3,3M+@ ,@M8+3<,3HMX+A\,A`M|+3,3M+B,BM+3Ĕ,3ДM+C,CM+3,3M$+D(,D,MH+3L,3XMh+El,EtM+3,3M+F,FMȕ+],]\+]`,]+g,gM+l,lЖ7G: M+g,gM +m,mM$D+]H,]+g,gMЗ+lԗ,lM+g,gM$+m(,m,M<d+]h,]+g,gM+l,lĘM+g,gM+s,s M<+]@,]`+gd,gpM+l,lM̙+]Й,]@+gD,gPM`+xd,xhM+g,gM+l,lMؚ+gܚ,gM+m,mM4+]<,]+ě,+g,gM+{,{ M(+g,,g8MH+lL,l`M|+g,gM+m,mMԜ+]؜,]+g,g(M8+l<,lPMl+gp,g|M+s,sM+g,gĝMԝ+m؝,mܝM +],]P+gT,g`Mp+lt,lM+g,gM+sȞ,sОM+g,gM +m,mM$D+]H,]+g,gM+l,l̟M+g,gM+m ,mM 4 \+]`,]+g,gMȠ+l̠,lM+g,gM+s,s(M@+gD,gPM`+md,mlMx+],]ġ+g,gM+l,lM4+g8,gDMP+sX,s`M|+g,gM+m,mMԢ+]آ,] L+gP,g\Ml+lp,lM+g,gM+sģ,ṣM+g,gM+m ,mM D+]H,]+g,gM+l,lȤM+g,gM+s,sM,+g0,g<ML+mP,mTMd+],]ԥ+gإ,gM+l,l M(+g,,g8MD+sL,sTMp+gt,gM+m,mM̦7H: +]Ц,]+g,g(M8+l<,lPMh+gl,gxM+s,sM+g,gMЧ+mԧ,mܧM +],]8T+gX,gdMt+lx,lM+g,gMĨ+s̨,sԨM+g,gM+m,mM(L+]P,]+g,gM+l,lЩM+g,gM+s ,sM0+g4,g@MP+mT,m\Mh+],]+g,gM+l,lM0+g4,g@ML+sT,s`Mx+g|,gM+m,mMԫ+]ث,] +g$,g0M@+lD,lXMt+gx,gM+s,sM+g,g̬Mܬ+m,mM+S,S8+g<,gHMT+s\,sdMt+],]+g,gM+l,l0MH+gL,gXMd+sl,sxM+g,gM+m,mMȮ0+g4,g@MP+T,XMt+gx,gM+,M+g,gȯMد+ܯ,M+g,g M+ ,$M4+8+<,@,L+P,X?\+],]y+g,g M+, M4+g8,gDMT+lX,llM+g,gM+s,sM̱+gб,gܱM+m,mMd+gh,gtM+,M+g,gM+IJ,ȲM+g,gM+,M++ ,$,0+4,<?@d+]h,](+g,gM+,M+g,g(M8+l<,lPMh+gl,gxM+s,sM+g,gMд+mԴ,mܴM@+gD,gPM\+`,d7I:M+g,gM+,M+gĵ,gеMܵ+,M++,, +,?+,B++,,+,?+g,gM+ ,$M4+8+<,@,L+P,X?\+],]w+g,gM+,M0+g4,g@MP+lT,lhM+g,gM+s,sMȸ+g̸,gظM+m,mM+g,gM+,Mȹ+g̹,gعM+,M+g ,gM$+(,,MH+gL,gXMd+h,lM+g,gM+,M++ĺ,Ⱥ,Ժ+غ,?++,,+,? 0+]4,]XR+g,gMȻ+л,ԻM+g,gM+l ,l M8+g<,gHMT+s\,slM+g,gM+m,mM+g,gM+,ĽM+g,gM+,M8+g<,gHMT+X,\Mx+g|,gM+,M+g,gȾMԾ+ؾ,ܾM+g,gM+,M8+g<,gHMX+\,`Mp+t+x,|,+,?++,,+,?+],] 68t+gx,gM+,M+g,gM+l,lM+g,g M+s ,s0MD+gH,gTMd+mh,mpM|+g ,g,M<+@,PM+g,gM+,M+g,gM+,M+g,g(M4+8,<7J:ML+P+T,X,d+h,p?t+x+|,,+,?++,,+,?+],].4+g8,gDMP+T,XM+g,gM+l,lM+g,gM +s,s$M8+g<,gHMX+m\,mdMp+],]+g,gM +l$,l8MP+gT,g`Ml+st,sM+g,gM+m,mM++,,+,?+],]+g,gM+, Mx+g|,gM+,M+g,gM+,M$+g(,g4MH+L,TMp+gt,gM+,M+g,gM+,M+g,g M4+8,HMd+gh,gtM|+,++,,+,?+],]=@|+g,gM+,M+g,gM+l,lM+g,gM +s(,s8ML+gP,g\Ml+mp,mxM++,,+,?+ +,, +$,,?0T+]X,]+g,gM+l,lM+g,g M0+m4,m<MH+L+P,T,`+d,l?p+],]@+gD,gXMd+h,lM+,B++,,+,?+g,g+,B++,,+,?+,M+g,gM +l$,l8MT+gX,gdMp+sx,sM+g,gM+m,mM+]7K: ,]+,B++,,+,?+g,gM+ ,M8+@,XB++,,+, ?+g,gM+l,lM+g,gM+m,mM +g$,g0M<+sD,sLMh+gl,gxM+,M+,B++,,+,?++,,(+,,4?8++,,+ , ?++, ,,+0,8?<t+x+|,,+,?++,,+,?++, ,,+0,8?<+ +,, +$,,?0+4+8,<,H+L,T?X\++,,+,?++,,(+,,4?8P+]T,]+,,+g0,g<MH+P,TMd+h+l,p,|+,?+],]Ajd+gh,gtM|+","M+#,#M+g,gM+l,lM +g,gM(+s0,s@MT+gX,gdMt+mx,mM+],]j 8+&,&M+g,gM+l,lM+#,#M+g,g M0+m4,m8MH+g,gM+),)M+g,gM +*$,*(MD+gH,gTM`++d,+hM+g,gM+,,,M+g,gM+-,-M++,,7L:+.,. ?$H+]L,]l+g,gM+1,1M+g,g M+l ,l4ML+gP,g\Mh+sp,sM+g,gM+m,mM\a+g,gM+4,4M+g,gM+5,5M+g,g M,+60,64MP+gT,g`Ml+7p,7tM+g,gM+8,8M+g,gM+9,9M+g,g M,+:4,:@M\+g`,glMx+;,;M+g,gM+<,<M++,,+ ,?<+]@,]h0+g ,gM +?(,?,M@+gD,gPM`+ld,lxM+g,gM+s,sM+g,gM+m,mM<+]@,]TmX+\,+g,gM+l,lM+g,gM+s,s MH+]L,]+,+g,gM+l,lM$+g(,g4M@+sH,sPM`+d+h,l,x+D|,D?+],]+,,+x0,x++,,+,?;l+p,+,(<+g@,gLM\+l`,ltM+g,gM+s,sM+g,gM+m,mM++,,(+,,4?8+<+@,D,P+GT,G\?`jq@[P|e[e[,e++,,+J,J?+ +K,,K +L$,L,?0+4+K8,<,KH+ML,MT?X7M : \+],]PH+L,C:i,X4p<D5\}|_E++x,xfi++,,+,? O(P+gT,g`Ml+Pt,PM+,(tx+|,+g,gM+l,lM,D+H+L,P,\+Q`,Qh?x+g|,gM+s,sM+g,gM+m,mM++,,+R,R? +$+(,,,8+S<,SD?HLPt+]x,]+g,gM+V,VMlnd+gh,gtM+W,WM+g,gM+X,XM8+g<,gHM\+Y`,YM+g,gM+,M+g,gM+Y,Y$M@+gD,gPM`+ld,lxM+g,gM+Z,ZM+g,gM+m,mM +g ,g( M4 +s< ,sD MT x I + + , , +] ,] ?$ T +]\ ,] ~ I + + , , +` ,` ? {   + + , , +`$ ,`, ?< +g@ ,gL MX +a\ ,a` Mh  + + , , +` ,` ? +g ,g M +l ,l M +g ,g M( +b, ,b0 ML +gP ,g\ Mh +sp ,sx M +g ,g M +c ,c M +g ,g M +m ,m M ++K,,K$+L(,L0?4+8+K<,@,KL+LP,LX?\`d+],]++,,+`7N: ,`?D+H+L,P,\+``,`h?< +g,gM,+l0,lDM`+gd,gpM+m,mM+],]be  0e<L `el| P^P+g,g$M4+m8,m<MX+g\,ghMx+l|,lM 0<+@+D,H,T+.X,.`?d+],]n+,\+n`,nd+g,gM+o,oM+g,gM +p,p M<h+q,q+g,gM+o,oM+g,g M,+r0,r4MTe`p e PP4Ithh[0ehx[e+s,sM<4+]D,]|9/d \]]  q(0bT,\+g,gM+t,tM It +gx ,g M +u ,u M +g ,g M +v ,v M P +g!,g!M!+w !,w$!M4!PD!+gH!,gP!MX!+w`!,wd!Mx!+g|!,g!M!+l!,l!M!e!! !+x!,x"M"+g",g("M4"+s<",sL"MT"+gd",gp"+t"+Kx",|",K"+M",M"?"+"+K",",K"+L",L"?"+"+",","+","?"+"+K",",K#+L#,L #?#+#+#,#,(#+y,#,y4#?8#<#@#D#\#+2`#,2d#b#+#,#+#7O:`#+#,#`#+#,#+#,#+#+#,#,#+#+#,#,#+#+!#,#,#,!#+s$,s$+$+ $,$,$+ $+$$,($,8$`L$+T$,$`$+$,X%`l%+p%,t%+x%+|%,%,%`%+%,%`%+%+%,%,%+%,%+%,%+%,%+%,%+%,%+%,%+&,&`$&+,&,&`&+&, '`4'+8'+<',@',D'`L'+P',X'``'+d'+h',l',t'+x'+|',','+'+',','+'+',','`(+(,8(`(+(,(`P)+T),X)+\)`d)+h),l)`p),x)+|)+),),)+),)+)+),),)`)+),*`*+*,P*`d*+h*,l*+p*`x*+|*,*`*+*+*,*,*+*,*,*+ *, *+ *, *+ *, *+ *, *+ *, *`+++,+`,+,,P,`t,+x,,,`,+,,(-`P-+T-,-`-+-,.`0.+4.,x.`.+.,.`.+/,/+/`/+/,/`/,$/+(/+,/,0/,4/+8/,P:,>X:?:+;:,;:BP;+<T;+=X;,<\;,=h;+>l;,>t;?;+?;,?;M;+?;,?;M;<c(<K0<cX<cp<+Ft<+Gx<+H|<,F<,G<,H<+I<,I<?B+FB+GB,FB,GB+JB,JB?B+FB+GB,FB,GB+KB,KB?B+FB+LB,FB,LB+MC,MC? C+FC+GC,FC,G$C+N(C,N0C?4C8C+a,a +b$+c(,b,,c0B+a+Z,a ,Z$ (+f,,f0D+gH+hL,gP,h\Mh+il,ipM|+],]H+j+c,j,cB ! ^(V,0%4N8<@zDTH*LPTX`7dphklYpkt)xJ|gv@rLGQo4 -7T| : hi3521_ive.ko9Y9Y9Y8)ELF(u4( -L -L -L -L -LP00@   -L@0S0"00 -L 3@ 0-LM@P'R:K0 a0T* 0 @0@o 0 @0@c0 @PJ 0 @0@Z0 @J -L00@ -L4M@@@ @ @00@@@@@ @@@@@ @$@(@,@0S#@0 @`b40,AHPaP4p4P pX0`0@LpPdT$\`P@p ((K -L@@@X| -L@@@0S -LMPP@l0S K0 R pp@@@`@1/L0tl0 p0h l00@4l(K4` 4K,@ 0@ 003/()@PP3 ()@PP8   ||X @ 0@@P 0 @M @H0 @9 @ 0 @%͠ 0-L@@@PU0UPPJ PPP -LMP 00@HH H /rX H X K@@ _6@$ 0-LM@P 0Sp@A P}@ LR/ PP 9 PP QBK082 @ 0  @1 @0  @18&: @0 @PPJ|1 @UP0 @PPJ81 @UP  0 @0@PPJ0 @UP0 @PPJ0 @0 @PPJ`0 @UP0 @PPJu@@ 5@4 0-LM@P 0Sp@A P}@ LR/ PP 9 PP QBK082 @^ 0  @1 @r0  @1 @S0 @PPJ|1 @gUP0 @PPJ81 @wUP  0 @0@PPJ0 @9UP0 @PPJ0 @B0 @PPJ`0 @KUP0 @PPJu@@ 35@D 0-LM@P 0S@A P@ LR` PP*Q(0Qe$ P= PP ,0 PP#4QK02 @ 0  @2 @ 0  @P2 @$00  @2 @ $0 @PPJ1 @TP0 @PPJ1 @UP(0 @PPJ81 @TP0 @PPJ0 @0 @PPJv0 @)4P 0 @0@PPPJb`0 @08%: @PPJQ@@ 4@T 0-LM@P 0S@A P@ LRt PP-Q(0Qy$ P@ PP4QK,0 PP#80SK0 3 @ 0  @2 @ 0  @2 @00  @X2 @$0 @PPJ 2 @TP40 @PPJ1 @{TP0 @PPJ1 @TP(0 @PPJ81 @iTP0 @PPJv0 @r0 @PPJe0 @TP8 0 @0@PPJQ`0 @0 @PPJ@@@ b4@` 0-LM@P 0S@A P@ LR` PP*Q(0Qe$ P= PP ,0 PP#4QK02 @F 0  @2 @" 0  @P2 @R00  @2 @;$0 @PPJ1 @TP0 @PPJ1 @3TP(0 @PPJ81 @TP0 @PPJ0 @0 @PPJv0 @W4P 0 @0@PPPJb`0 @+0 @PPJQ@@ 3@l 0-LM@P 0Sx80: @A P@ LR: PP$QC PP(0S,P0 R QBK02 @ 0  @2 @0  @H2 @SP0 @PPJ2 @$0 @PPJ1 @Ϡ P 0 @0@PPPJp1 @SP0 @PPJ,1 @0 @PPJ0 @SP(0 @PPJu0 @Ϡ,0 @PPJd`0 @00 @PPJS@@ 3@x 0-LM@P 0S@A P@ L Rx PPV PP]$0@sQ5%N| RP/&0@sQP)'N| RP#(0@sQP)N| RP*0@sQP+N| RP ,0@sQ RWK0P@2 @$0  @PPJ82 @u 0  @1 @0  @1 @j0 @PPJ|1 @~SP0 @PPJ81 @ P 0 @0@PPPJ0 @5^P0 @PPJ0 @Y0 @PPJq`0 @bSP0 @PPJ`@@ J3@ 0-LM@P 0S@A P@ L Rv PPT PP[$0@sQ5%N8*:| RP/&0@sQP)'N| RP#(0@sQP)N| RP*0@sQP+N| RP ,0@sQ RUK0PP|2 @;$0 @PPJ82 @Ϡ 0  @1 @30  @1 @0 @PPJ|1 @%SP0 @PPJ81 @ P 0 @0@PPPJ0 @RP0 @PPJ0 @0 @PPJs`0 @ SP0 @PPJb@@ 2@ 0-LM@P 0S@A P@ L RM PP+,QWe PP/,0S (PPjK0 $ PP 2 @$0  @2 @ 0  @2 @0  @H2 @0 @PPJ2 @RP,0 @PPJ1 @0 @PPJ|1 @RP( 0 @0@PPJ,1 @_P0 @PPJo0 @0 @PPJ^0 @RP0 @PPJM`0 @_P 0 @PPJ<@@ 2@ 0-LM@P 0S@A P@ L RF PP$P PP+ Y$ PP(QbK028?:  @r$0  @|2 @K 0  @@2 @_0  @2 @ 0 @PPJ1 @_P0 @PPJ|1 @g 0 @PPJ81 @w(P 0 @0@PPPJ0 @&RP0 @PPJw0 @/0 @PPJf`0 @_P0 @PPJU@@ ">@ 0-LM@P  0@Sm@ A R@0@ Sq PP-$0S SC PP/(Q5 R 0SPgK0 PP 3 @0  @H3 @ 0  @ 3 @0  @2 @QP$0 @PPJ2 @QP0 @PPJH2 @0 @PPJ2 @ P 0 @0@PPPJ1 @0 @PPJrp1 @0 @PPJa,1 @QP0 @PPJP0 @QP0 @PPJ?0 @ (0 @PPJ.`0 @3 @PPJ@@ 1@ 0-LM@P 0@Sj@ A R@0@Sn PP*$0S S@ PP,(Q RPgK8<: 0 PP @3 @n0  @3 @W 0  @2 @{0  @2 @QP$0 @PPJH2 @*QP0 @PPJ2 @S0 @PPJ1 @QP  0 @0@PPJp1 @20 @PPJr,1 @;0 @PPJa0 @Q_P0 @PPJP0 @^P0 @PPJ?`0 @(0 @PPJ.@@ #1@ 0-LM@P 0S0CS@A PP@ E RF PP$P PP+- Q 0SVK0 2 @0 @PPJ|2 @ 0  @@2 @ 0  @2 @0 @PPJ1 @\P0 @PPJ|1 @ P 0 @0@PPPJ,1 @PP0 @PPJ0 @0 @PPJr0 @0 @PPJa`0 @E2 @PPJP@@ 0@ 0-LM@P 0S\ AvPi07 C R. PP  PP Q1K01 @ 0  @t1 @0  @818): @PP0 @PPJ0 @ P 0 @0@PPPJ0 @PP0 @PPJ`0 @0 @PPJ@@ |0@ -L$M@PI 0S 2 @ 0 @0@J KPP@hP(0L S :b@P 0c//@S``@hP L 0S:b@ ^(P O1 @ @Jc@P `?8`K ( pp@0p @4 8 , | L0Rcb:PHQ 0 Oht -L MPpJ Q>@0P1<` V'*Q|V @ @  @|` 004  4 Tp(KT0S`F|0 0 @# @J@@8 6@@@@@@ 6@ p-L MP@+ R= T1 `P`Q`PPPPPPPPS 20  02\ $  Kp@@` 5@@@8 5PP@P@@ 5@@@@  -L@4 80 0-LM@ PP@` `LP  0b41qLd\ L\84 @Q040Q2,:0P000440040 Q-:@0 l4$K$ Y00 K0 0 03/ 0!K00`400d0P8):@@< 8@@@@@@ 8PP@Pt, -LM00@4 r K@0l  ` Y 0  4K  K03/ p-L MP`0 QB R6@ PPPP!Kp0 @} @!0 @ @!@@` r6@@@8 t6PP@P@@ s6@@@@@ p-LLM\`KP@ U PNOO Kp@P 0 @ @`W@K @D80 @i @@@JhP p-LLM\`KP@ U PNOO Kp@P 0 @ @`W@K @D80 @F @@@Jh` p-LLM\`KP@ U PNOO Kp@P 0, @ @`W@K4 @D80 @# @@@Jhp p-LLM\`KP@ U! PNOO Kp@P40X[, @XK @`W@K8 @D80 @ @@@Jh p-LLM\`KP@ U PNOO Kp@P 0, @ @`W@K4 @D80 @ @@@Jh -LHMd`KP@ U' PNOO $K@P(,p00 $`[@@K`K_K?pK>K` @D80 @ @@@J8 <: h p-LLM\PK@@ T PnoO Kp`P0 $`WK`P `D80 @ @``Jh p-LLM\PK@@ T PnoO Kp`P0 $`WK`P `D80 @wΠ @``Jh p-LLM\PK@@ T" PnoO Kp`PX[,` 0XK0`WK`P( `D80 @M @``Jh p-LLM\PK@@ T PnoO Kp`P 0,`WK`P( `D80 @* @``Jh p-LLM\PK@@ T( PnoO Kp`P(X[05 XK$`|/K,`XKW`KP `D80 @ @``Jh p-LLM\PK@@ T PnoO Kp`P-0 /K$`WK`P `D80 @ @``Jh  p-LLM\`KP@ U# PNOO Kp@P(X[0$ PpXKWK @D80 @ @@@Jh  p-LLM\`KP@ U PNOO Kp@P 0 W@KP @D80 @ @@@Jh0 -L8 ?: @0SJ0LQF  6$0LQG 1$L QQ $LQJ 6 0LQ" 8L Q0 8LQI 680LQ- 4L Q<LQ1 6<0LQ! 8L Q, O0L Q( 0LQ 6,0LQ -L@00  0 -L -L@ 0 -L@0 -L00@ -L ^B00@ -LM@@@Xl K @ $@  $K03/(@@K -LM@` ` l@Xq K(` P$` ,K,P @@@unload ive.ko ....OK! [Func]:%s [Line]:%d [Info]:Stride(%d) align is not 8! Stride(%d) is too small! width(%d) ive register device failed. ive 8 *:register module failed. [IVE] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:47] -----IVE CONTEXT ATTR----------------------------------------------------------- %2s%3s%4s%4s%4s%4s%10s%10s%6s%6s%5s%6s%6s%10s WBWCIWEIBCIBEIHndUTskFLstIdTskIdbIntHWrapFWrapIntCnt%2d%3d%4d%4d%4d%4d%10d%10d%6d%6d%5d%6d%6d%10d IVE_QUEUEIVE failed malloc mem IVEIVE failed request irq ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/ive/ive.cpIveHandle != HI_NULLpstHistArg != HI_NULLHIST src Format(%d) is not single! HIST src Width[%d] is not in [64,1920]! HIST src Height[%d] is not in [64,1080]! HIST src u32PhyAddr(%#x) align is not 8)! HIST src Stride(%d) is not Legal! HIST dst u32PhyAddr(%#x) align is not 8)! HIST dst Stride(%d) is not Legal! %s(%d) is not set HIST bInstantpstIntegArg != HI_NULLINTEG src Format(%d) is not single! INTEG src Width[%d] is not in [64,1920]! INTEG src Height[%d] is not in [64,1080]! INTEG src u32PhyAddr(%#x) align is not 8)! INTEG src Stride(%d) is not Legal! INTEG dst u32PhyAddr(%#x) align is not 8)! INTEG dst Stride(%d) is not Legal! INTEG bInstantpstOrArg != HI_NULLOR src1 Format(%d) is not single! OR src1 Width[%d] is not in [64,1920]! OR src1 Height[%d] is not in [64,1080]! OR src1 Stride(%d) is not Legal! OR src2 Format(%d) is not single! OR the width of src1(%d) and src2(%d) is not same OR the u32Height of src1(%d) and src2(%d) is not same OR src2 Stride(%d) is not Legal! OR dst Stride(%d) is not Legal! OR bInstantpstSubArg != HI_NULLSUB src1 Format(%d) is not single! SUB src1 Width[%d] is not in [64,1920]! SUB src1 Height[%d] is not in [64,1080]! SUB src1 Stride(%d) is not Legal! SUB src2 Format(%d) is not single! SUB the width of src1(%d) and src2(%d) is not same SUB the u32Height of src1(%d) and src2(%d) is not same SUB src2 Stride(%d) is not Legal! SUB enOutFmt8 0: (%d) is not set! SUB dst Stride(%d) is not Legal! SUB bInstantpstAndArg != HI_NULLAND src1 Format(%d) is not single! AND src1 Width[%d] is not in [64,1920]! AND src1 Height[%d] is not in [64,1080]! AND src1 Stride(%d) is not Legal! AND src2 Format(%d) is not single! AND the width of src1(%d) and src2(%d) is not same AND the u32Height of src1(%d) and src2(%d) is not same AND src2 Stride(%d) is not Legal! AND dst Stride(%d) is not Legal! AND bInstantpstThreshArg != HI_NULLTHRESH src Format(%d) is not single! THRESH src Width[%d] is not in [64,1920]! THRESH src Height[%d] is not in [64,1080]! THRESH src Stride(%d) is not Legal! THRESH enOutFmt(%d) is not set! THRESH dst Stride(%d) is not Legal! THRESH u32Thresh(%d) is more than 255! THRESH u32MinVal(%d) is more than 255! THRESH u32MaxVal(%d) is more than 255! THRESH bInstantpstErodeArg != HI_NULLERODE Src Format(%d) is not single! ERODE src Width[%d] is not in [64,1920]! ERODE src Height[%d] is not in [64,1024]! ERODE src u32PhyAddr(%#x) align is not 8)! ERODE src Stride(%d) is not Legal! ERODE dst u32PhyAddr(%#x) align is not 8)! ERODE dst Stride(%d) is not Legal! ERODE Mask%d(%d) must be 0 or 255! ERODE bInstantpstDilateArg != HI_NULLDILATE SrcFormat(%d) is not single! DILATE src Width[%d] is not in [64,1920]! DILATE src Height[%d] is not in [64,1024]! DILATE src u32PhyAddr(%#x) align is not 8)! DILATE src Stride(%d) is not Legal! DILATE dst u32PhyAddr(%#x) align is not 8)! DILATE dst Stride(%d) is not Legal! DILATE Mask(%d) must be 0 or 255! DILATE bInstantpstCannyArg != HI_NULLCANNY SrcFormat(%d) is not single! CANNY src Width[%d] is not in [64,1920]! CANNY src Height[%d] is not in [64,1024]! CANNY src u32PhyAddr(%#x) align is not 8)! CANNY src Stride(%d) is not Legal! CANNY enOutFmt(%d) is not set! CANNY dstMag u32PhyAddr(%#x) align is not 8)! CANNY dstMag Stride(%d) is not Legal! CANNY dstAng u32PhyAddr(%#x) align is not 8)! CANNY dstAng Str8 %:ide(%d) is not Legal! CANNY bInstantpstSobelArg != HI_NULLSOBEL Src Format(%d) is not single! SOBEL src Width[%d] is not in [64,1920]! SOBEL src Height[%d] is not in [64,1024]! SOBEL src u32PhyAddr(%#x) align is not 8)! SOBEL src Stride(%d) is not Legal! SOBEL dstH u32PhyAddr(%#x) align is not 8)! SOBEL dstH Stride(%d) is not Legal! SOBEL dstV u32PhyAddr(%#x) align is not 8)! SOBEL dstV Stride(%d) is not Legal! SOBEL bInstantpstFltCscArg != HI_NULLFILTER+CSC src Format(%d) is not sp420 or sp422! FILTER+CSC src Width[%d] should be even! FILTER+CSC src Width[%d] is not in [64,1920]! FILTER+CSC src Height[%d] is not in [64,1024]! FILTER+CSC src u32PhyAddr(%#x) align is not 8)! FILTER+CSC src Stride(%d) is not Legal! FILTER+CSC dst u32PhyAddr(%#x) align is not 8)! FILTER+CSC RGB package dst Stride(%d) is not Legal! FILTER+CSC RGB planar dst Stride(%d) is not Legal! FILTER+CSC enOutFmt(%d) is not set! FILTER+CSC FltCscMode(%d) is not set! FILTER+CSC NormArg(%d) is not in [0,11]! FILTER+CSC bInstantpstCscArg != HI_NULLCSC src Format(%d) is not SP420 or SP422! CSC src Width[%d] should be even! CSC src Width[%d] is not in [64,1920]! CSC src Height[%d] is not in [64,1080]! CSC src u32PhyAddr(%#x) align is not 8)! CSC src Stride(%d) is not Legal! CSC dst u32PhyAddr(%#x) align is not 8)! CSC RGB package dst Stride(%d) is not Legal! CSC RGB planar dst Stride(%d) is not Legal! CSC enOutFmt(%d) is not set! CSC enCscMode(%d) is not set! CSC bInstantpstFilterArg != HI_NULLFILTER Format(%d) is not single,sp420 or sp422! FILTER src Width[%d] should be even! FILTER src Width[%d] is not in [64,1920]! FILTER Src Height[%d] is not in [64,1024]! FILTER src u32PhyAddr(%#x) align is not 8)! FILTER src Stride(%d) is not Legal! FILTER dst u32PhyAddr(%#x) align is not 8)! FILTER dst Stride(%d) is not Legal! FILTER NormArg(%d) is not in [0,11]! FILTER bInstantpstDmaArg != HI_NULLDMA src Format(%d) i8&:s not single! DMA src Width[%d] is not in [32,1920]! DMA src Height[%d] is not in [1,1080]! DMA src Stride(%d) is not Legal! DMA dst Stride(%d) is not Legal! DMA bInstantNULL PTR! bBlockpstTask != HI_NULL(bInstant == HI_FALSE) || (bInstant == HI_TRUE)too many Tasks pstSrc1 != HI_NULLpstDst1 != HI_NULLu32BusyArrCurIdx <= u32BusyArrEndIdxu32WaitArrCurIdx <= u32WaitArrEndIdx(bInstant == HI_TRUE)||(bInstant == HI_FALSE)Fail to creat task! Fail to schedule task! hi3521_iveGNULtf<*&t|A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4R .)R% X8@S@4 DCT@KVT2`Wgqc ,X qr$m  s$83: ssps/tt yf    <P$( 2t,AK[g l q|t yX < @| q8O  \                ! '\>98 ?< E  qKT Q W q] c i o u( {<   0 \  q   `  4  d   L qp t       h    D  qp   #8 ) / 5 ;@ Ad G M S( qY0 8:_| eT k qP w } $ x   q l  H        q(,T  0   x 4 \   q,0 &P - 4  ;x B I P W ^ q(#,#e l s8 z     @ l `  q' '8   `   `   4  q** |  H " )H 0 7 > E L Sp Z ap q//h o v@ }p     @ h    q0343      d  4 ` <  q66 $  %H , 3 :t q98:  9Ad HX q\;h;O V ]l q<<d k q$>(>r y q@@h  8 qAAqBBqCCqDDqEEqFFqGGqHHqIIqJJqKKqLLqMMqNNqOOq $4 DT `  l x+:IXgv    ,@P` p *9HWfu  01q  h l( q q),7Q(qqqDCD#Vhg|!q   wM<L$ 8: lD 9\ I 0L" , / > N |Z m t    ,#  h;t @ 8R  XR4  43  % A4 Q@F (O X e Cr @\ ' J  0 G N  K 6L  Q. A G (>4T [ c Lt { 4     D F H 4 t  Q$ # / /,; BK V i *|x  , R  E  P  @ $aIveOpenIveCloseIvePollIVE_Notify.LANCHOR0IVE_QueryState.LANCHOR1IVE_GetVerMagicIVE_ModExit.LC0.LC1$d.LC2.LANCHOR2.LC4.LC3IVE_ModInit.LC5.LC6IveIoctlIveDevIoctl.LC7.LC8.LC9.LC10.LC11.LC12.LC13.LC14.LC15.LC16.LC17.LC18.LC19.LC20.LC21.LC22.LC23.LC24.LC25IveInterruptRoute.LC27.LC28.LC26.LC29.LC30.LC31.LC37.LC39.LC36.LC38.LC40.LC41.LC33.LC34.LC35.LC32.LC47.LC49.LC46.LC48.LC50.LC43.LC44.LC45.LC42.LC59.LC55.LC60.LC58.LC54.LC57.LC52.LC53.LC61.LC56.LC51.LC70.LC66.LC72.LC69.LC71.LC65.LC68.LC63.LC64.LC73.LC67.LC62.LC82.LC78.LC83.LC81.LC77.LC80.LC75.LC76.LC84.LC79.LC74.LC89.LC91.LC88.LC90.LC95.LC86.LC87.LC92.LC93.LC94.LC85.LC104.LC101.LC103.LC100.LC102.LC105.LC97.LC98.LC99.LC96.8:LC114.LC111.LC113.LC110.LC112.LC115.LC107.LC108.LC109.LC106.LC126.LC121.LC124.LC120.LC122.LC123.LC127.LC117.LC118.LC119.LC125.LC116.LC137.LC133.LC135.LC132.LC134.LC136.LC138.LC129.LC130.LC131.LC128.LC147.LC145.LC148.LC149.LC140.LC144.LC152.LC141.LC142.LC143.LC146.LC150.LC151.LC139.LC161.LC159.LC162.LC163.LC154.LC158.LC165.LC155.LC156.LC157.LC160.LC164.LC153.LC168.LC172.LC174.LC171.LC173.LC176.LC167.LC169.LC170.LC175.LC166.LC181.LC182.LC180.LC183.LC178.LC179.LC177.LC185.LC184.LC188.LC187.LC186.LC189.LC190.LC191.LC192.LC194.LC195.LC193__func__.28904__func__.30358__func__.30152__func__.29680__func__.29542__func__.29504__func__.29458__func__.29409__func__.29363__func__.29319__func__.29272__func__.29224__func__.29172__func__.29126__func__.29064__func__.29007__func__.28956__func__.28924__func__.30103__func__.29636__func__.29594__func__.30061__func__.29697__func__.30031__func__.30011__func__.29990__func__.29966__func__.29945__func__.29916__func__.29894__func__.29872__func__.29846__func__.29823__func__.29793__func__.29769__func__.29743__func__.29723__mod_version2776__mod_license2775__mod_author2774s_u32IveStateive_fopss_stIveModules_stIveUserRefs_stIveDevice__key.30151__mod_srcversion23__module_depends__mod_vermagic5IveProcessCSCfree_irqIveProcIveCheckHistIveFillTaskCMPI_RegisterMod__this_modulesnprintfIveExit__arm_ioremapIveQueryStatefinish_waitIveProcessCannyg_stIveCtx__iounmapupcleanup_moduleprepare_to_waitg_apstArrayg_au32IveArrayAddrmemcpyCMPI_MmzMallocCMPI_UserCopy__wake_upIveCheckCannyCMPI_RemoveProcIveCreateTaskinit_moduleIVE_DRV_ExitIVE_DRV_Initg_pstIveRegsIveCheckFilterCMPI_CreateProcIveCheckAndIveProcessHistIVE_DRV_WriteRegsIVE_Pollscheduleg_astModulesIveProcessOrIvePostProcessIveCheckSobelIveProcessSobelgs_u32IveVersionIveCheckDilateIveProcessErodeIveProcessDmarequest_threaded_irqIveProcessFltCscIveCheckDmaIveCheckIntegIVE8: _DRV_ReadRegsCMPI_UnRegisterModpanicIveStartTaskprintkIveInitIveProcessFiltermemsetIVE_Exit__memzeroHI_LOG__init_waitqueue_headCMPI_MmzFreeIveProcessSubIveProcessThreshIveProcessDilateIveManageHandleIveCheckOrIVE_DRV_ClearIntIveCheckThreshIveCheckSubIveCheckCscIveProcessIntegseq_printfdown_interruptibleIveCheckFltCscIveCheckStrideIveCheckErodeIVE_DRV_GetTaskIdIveProcessAndautoremove_wake_functionIVE_InitCMPI_UnRegisterDeviceIveScheduleTaskCMPI_RegisterDevice`+ d, + , ++, ,,+0+4,8,L\+`,h++,,+,+,|+,+,++ ,, +!$,!(+",,"4+#8,#@+$D,$L+%P,%X+&\,&d+'h,'p+(t,(|+),)+*,*++,++,,,+-,-+ , + , +.,.\x+ |, gtt+ , n+, + $, Px+/,/{+/,/{oo (+00,0<+1@,1H`+d,p|+2,2+,+3,3+,+ , (L+ P, +6+7,6,7+8,8(X+\,ht+;|,;+,+<,<+,+=,=+,$4+>8,>@X+\,hx+?|+@,?,@+,+A,A+, +B ,B 0 +4 ,@ P +CT ,C\ h +6l +7p ,6t ,7 +D ,D    8:8 +< ,H T +G\ ,G` t +x ,  +H ,H  + ,  +I ,I  + ,  +J ,J 8 +< ,H X +?\ +K` ,?d ,Kp  + ,  +L ,L  + ,  +M ,M  + , 0 +N4 ,N< H +6L +7P ,6T ,7` +Od ,Ol p    H +L ,X d +Rl ,Rp  + ,  +S ,S  + ,  +T ,T  +,  +U$,U4H+L,Xh+Vl,Vt+,+W,W+,+X,X+ ,,<+Y@,YH`+d,p+?+Z,?,Z+,+[,[+6+7,6,7+\,\ `+,+_,_0+4,@L+`T,`Xl+p,|+a,a+,+b,b+,+c,c 8+<,HX+d\,dd|+,+e,e+,+f,f +,,+g0,g8P+T,`p+?t+hx,?|,h+,+i,i+6+7,6,7+j,jP+,+m,m+,$0+n8,n<P+T,`l+ot,ox+,+p,p+,+q,q+ ,,@+rD,rTh+l,x+s,s8:+,+t,t+,+?+u,?,u(@+D,P`+vd,vlx+6|+7,6,7+w,wh+l,x+z,z+,+{,{+,+|,| $+(,4D+}H,}Ph+l,x+?+~,?,~+,+,+, + ,(@+D,P`+d,l+,+,+,+,+6+7,6 ,7+,$(+,+,+,+,0+4,@L+T,Xl+p,|+,+,+,+,+?+,? ,,D+H,Td+h,p+,+,+,+,+6+7 ,6,7+ ,(, + ,  + ,  + ,! !+!,!,!+0!,+7>,6>,7>+>, >$>4>+ 8>, T>t>+ x>, |>>>+ >, 8?+> PP@0 <S80 0PvX^ 4Zh <80 D> @ ^ P0Rh0D> 4 YP1 PP@P 0 0U<P84 Y L^ H^`PYD H LH ZR(KL\ H0S0+ 8PPPU1D^1PP80LQ> HQU 0080PPaQD 1 ?`0L^. H^C <0 8PP|D I\``@!!rPpH !Q@T Q0  80uX^ h4\ T80 <>@ X 0Rh0<> 48 \T =  00兡<>180 0 @ ^T4  \L^ D^`PZ< DL0D SQLQ D0S 0+ TPZ1<1T0 L R6 D RL 0 08PP^<>B` 0L^' D^; T0 8PP<K840P8 0 8<0 8T0 ` 00`00 0`<0 `T0 d\ T ^00dX H0 d0S TP0d0S! H0 dP H dZ T dP T @@dX H -LM@AQ:Q@QQ@@@Q: APQQ@@@Q:APQ@(KR9PCRR8 0 PP0P 8P #QN@T000@` @`p Zp傑@%ZPp@p傢8  @0@ A@@A@P@0@@@ 0-LP$@P @P0G9%: @ 0R  00@0@0 -LP 00@r@ ’02@ -L@AQ:QPQaPP@Q: Q`Q aPP@Q:Q`Q@R*:Q@R&6 S9P7P;@@S`0 @`H?H㄁0Rq@pℒ @!@ Q)@0@0"Q@@@R: APRA@R: @R@@@ -LM@@@$`K @0Pttp &R\Z Z<\MZK\\ZZ\kZi\zZx\ @@\Z1# @@09?:((0S 0-LP0 @xP@P@àA@Pw 0@0@0 -L00@Aut rT wT xT vt tT@@ t@ Bx !@ @ Bx !@ 0-L@  00@@D xQ PxU !@01 @wD @!01 !@0 -LMPQ@`> PA4Kp4p P0P  , 0(0 00@ @D@@b@ ₁qR@@@p P4@BB4@@B0@ ,@ (@ @0 “  "$K@@ -LMPQ@7 P:4K`4` P0P  , 0(0 00@ @Dႀq@@aRp` P@@@4@@ 4@@B0@ ,@ (@ )@0 " K@ @ -L@uptP xP vp up rP @@@00@@ ‚x ! -LM0 PeP` %Y#*p0@tP%Y* ?]EM0PEp0@P (Kug00 0P P@x -LPePp %Y#*@`tP%Y* d d?]EMD0PE`0@DP ef 0@PtP -L@0 000 -L M0@ K0P   K@ -L B9*:   A00@@0 R0@4 @@@!@0!@P!@p!@!@!@!@!00@AAA$A 4 AD -LM = 0@@P 00@x       K=@ -L=00@@ -LPGNU l5ң7jA9(Owe dmac_waitdmac_start_m2mdmac_start_m2pdmac_buildllim2pallocate_dmalli_spacedmac_channel_allocatedmac_start_llim2mdmac_channelstartdmac_buildllim2mdmac_start_llim2pfree_dmalli_spacedmac_channel_freedmac_register_isrdmac_channelcloseversion=HI_VERSION=HIDMAC-MDC030003 @Hi3511v110_OSDrv_1_0_0_7 2009-03-18 20:52:37author=Hisiliconlicense=GPLsrcversion=D4636397599958408575FFDdepends=vermagic=3.0.8 mod_unload ARMv7 Invalidate peripheral id %x! Invalidate transfer size,size=%x Invalidate source address,address=%x Invalidate peripheral id in M2P function, id=%x! failure of DMAC channel allocation in M2P function Invalidate transfer size,size=%x! CLOSE :channel number is larger than or equal to DMAC_CHANNEL_NUM_TOTAL. channel close failure. channel number is larger than or equal to DMAC_MAX_CHANNELS %d Invalidate destination address,address=%x failure of DMAC channel allocation in M2M function! DMAC %d channel Int status is error. Error in DMAC %d channel as finish! channel which choosed %d is error ! dma chn %d is in used! The transfer of Channel %d has timeout! DMAC :no available channel can allocate! Invalidate LLI head! failure of DMAC channel allocation in LLIM2P function,channel=%x! failure of DMAC channel allocation in LLIM2M function,channel=%x! DMAC Transfer Error. can't get dma mem from system Hisilicon DmacDMA Irq %d request failed 9):  I I IHH?PhidmacA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab__ksymtab_strings.modinfo.rodata.str1.4.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4L) DG)),% G@eC&C#Of 'CW g#@(#h_@@)# i'@@#*g/@#@jo@7+ @ kw@,? #@ l@ -# @m#H@.C n@P #o#@X/ @ 0 @` p#@ 1(@hq # @r#0@p2 @ 38@Cx s#4#@@t @ 5I u# @6#@Qv @ @wY 7#@ @!8a x# @#@yC)i9:0: @1 :##q@z9; @ {y@<A #@ |@ =# @#J@}> @ ~R@?C ##@Z M͠"@bN O- @#*@jA @ B2@r #@ C:@z # @D#B@C E@ K #F#@S @ @[ G#@ @#H @c #I#@C+k  CJ3s  @  ;@KC{  C0C 0 -LMGP J K Pt= J0 -L MGP@ JK P J  00@#t0!! -LGP JP J2 P`0 ` -LGP@ JQ JP JO  -L@Q00 0JGS0 0J PR- 00 0J -LMGP J KQ J  0P J   -LP J   0-LM@PP? 0S@ '@Q 0S @P @Q 0S @T P 0 @  @K0 h0 @0  @P@@ 8@ -L MGP`p J KQ J @P J  S$,2("P 0  @&  @! JO 00@8!0!!4 p-L M@P`l 0@bS00_SU:3:S@ =D0S P @\ DQ 0S @T Q H1 @I  @ JKp 0 @+0  @c J 0 @= @ 0` J X0 @40   @P@@ %8@D -LMGP`p J$KQ J @P J  0S$ .2,"PT 3D Lㄠ匃 3 M #L猀3 NT  3Ġ \ O珣 3 $d 夠PQ3  瑃, Rl嬠 34 t 3 S㴠<| T 缠E 産3 U# M V3U# W3㕠] %Xe 3- Ym噃 Z#5 皣 u0嵀=0[3 #}\㽠3F]  3N ^ V _3 ^ ` 3&f ! a. "3n b 6 #v嶀 c3> ~$ d羀 G礃 % e#0O03&fW 3' g㗠#_(3 h㟠'g)i3 /  *#o7j+#w00@?k,#l-#Hm.#Pn X/#o  `0#p (h1#q 0p2#r 8xs#3 @:&: 4t# I 5u#㉀Q 6v#㑀Y 7w#㙀!a 8x#㡀)i 9縣y#1q 繣:9z# 纣;yA{# 绣< |# 缣=J}# 罣>R~# ?Z嚠"# b墠MN*O-j媠A灃#2r岠B炃#:z庠C烃#B D# K勀ES#F㓀[#G㛀#c#H㣀+k#I㫀3s#J犣;{ ʃ KC烀< 8 0 !H0  @x  @! J}!{T -LMP 4  0R E0@ K@@ u6@d p-LMGP JKpQ J  @P J  2S `  V 1 @ 0 @0! JP` R?P?P 0R: c\* 0 @d` p0 @@@@H J>@@@ $ 0Rx- Bx-!!| -LMGP J(KQ J  0P J P B  P `   `R! J@p,a < Vt ?J` P0T\X: Sb: 0p`p 0g0 P   p`g` p``` 00 @@T   @`P p% W" T@ $ @`@(`a@ a,?PS0 `:<:  0b0@Q!@pS:g\*@@$<4PP@P!j ` `V`K` ` P p PP UN@@#3@@@@ UD:Pi U P`P` PP pp l `P P P㠐 ` Q: P6$^2( P.S ,0\OPR  sc 0."#\& H1 @ 0 @!0 @   0 @  J `$ 0 `$4!! P0 @ 80 @   0 @ Jj -LGP@ JPP@`POpP JA6 0a 0-LM|P@1S P @P P@HTK0@@ ?@0 -LLMTPKGP0@`00p0 JT0 (KQ JR DK00  D0 00PP  0 ᨀZ: @@ l0 D 0K<@ 09/PX "0  @;40 P` \4 @e ` @ 04 @   4 @  J4X P\ \.\ X d *\E=0h0 bV]Y::?:\?Z`0异0_  @}d?2υ E͠@4 t …h…  4`P4m``@`0\ X bx0 t-40Xp|MpPE0Q,6 8K4 1 !X  @0 @ 【0  X @ |1 @  T1 @ J`\ $1 @gϠ\  @1 J 0 @  0 @ J 0 @  l0 @ J@@< "2PP@P@@ 2@@@@ -LMP K 40 @  0 @ -L00@ -L M 0@> LZh@C \vS :?R @0A SQ:?PK  0 @0@0 @ @  0 @0@Ϡ 0  @  0 @0@ 0  @  0 @0@0  @  0 @0@0  @  0 @0@0  @  0 @0@ 0 @ @ʠ  0 @0@ 0  @ p-L M00@ 1 8\$@^"@ $,b  P  P QɃ \`Am `P @@` ` @`̓?` ???L`F: *:   (,@M@@Pj]DP΃T*C]Pd.$n#.`m`(n`hn`m`,n`ln `m `0n `pn`m`4n`tn`m`8n`xn`m`KpZ@@!1@@@x!<@@@P!1``@`@@(!1@@@@@@!1PP@P@@ 1@@@@@@ 1PP@P@@ 1@@@` >@@@8 1PP@P@@ 1PP@PH -L$M`Pp@ R @ TP  B R0bS+ 0 P尃K e>Bq ,K0T P8P QP+^k*@@"{1``@`  @1"j->P ?? PeP 0  00$!(K P*@E8 @< <08  Pl0Q*0Y: c Q:l^: al@L8 0@ @ <0 @Y<0 P  P@ | PK J 1 @Ϡ : <: @@@ ?@ 0 @[b`0  @P@@@\ ]2P@P@@8 e2pp@p@@ U2@@@@ -L00@ -L@2 -L -L@ -L @ P00@$000@(0 -LOM`HPKЀ0H0 X00@0000(K @= R@ @?   03^\ ThpKa 0@@PX @@@@@@@@@@@@@@@@@@@@@@@@ ? hpK P @hK @4 @000GQ@PR @P' 40S S 0000@@@00 @@ 000 @@ 000pp@Q+@P400@P400@P 04 q @@P 4q}@@v@P 4rj@P 04 r ^@P 04x'S@P 0P40x'W_K0(0( 00! P> @:@P 04x'W_K0,\Q,0, P" @@@@ -L,MP@pPO (K@``@@@ @ @00@@@@@: &: @@@@@@@@@@@@@@ 0 \@p l 0 1$4 ,(8< @\  l 0 1$4 ,(8< 0HS@` @ @00@pp@@ppp@ppnax} @pt͜`HV) \  p 0Pbabax}@ pt`\ " 0P ab@p 0@ @0@p@p@pp@p@p p@p@pp@`@p \@p P<=Lm`@Hm `X\m`TDm`@\  P<=Lm`@Hm `X\m`TDm``HV@`b  QVpg bp@|-0@  p`VB 0S' “p p Rpbppb @Qbhb|-0`@ p `0S “ Rb  Qpbp`@@g -L00@ ,  -L0S S    ,S S S 0S S -L0 SS000 0 RR -L0S S S,S   S S,S S  0S S -L 0 R,R R R R R R R  R,R 00 0-LMP Q,Q$K00@0 : 3: Q Q$K@@@0 Q$K$K@00 Q Q Q @0 Q,Q K0 -Lp3 -L000 -LM @  Sl K  K03/ K -LM @  Rl K  K03/ K -L -L -L -L0  -L525 -LlM5%\ P@BE U  0 YY<Ypp<Y``=YPP=Y@@>Y>Y?Lp ?H` 8DP 8@@ 9< 9T :t :P ;p ;55,p(`0pp4l`8l <5uP0`ptPxh |u<1u8Qapt|1xd |` \ u uQa2p‘tx8 | u$u$@hP`p0txX |$u(54xQA0b48<(50ep`h0e4uTPX0p0` x4u@8e`0p h8e5PuU@ P`V0  D0\ 2!@DPL0,BH % PDL@ P@0T@ T DUP @:0:045@8<!0`Q0A11,"22335(KP` @ -LM0QD PM  Pp @ 8p <`PPP` P@H @@0@P4PP@< @@@(D,@H@$L0@p@4tx|@@ ˌA0R@ K @@ @2@ @@ @2@@@@ -LM00@P K@@ 0@ -L 0 -L0 -L00 -L0 0 -L0 0 -L -LMP 010 K@@ 0@ -LMP Q090 K@@8 0@@@ 0@  -LMP Q0 77880 K@@8 ^0@@@ _0@$ -L M@P @0 00K@@ 0@< -L@ -L0  0-LM@@@P @ 03/PP PP PK0@@8 W2@@@ ?@@@@L -L M <0 @}Ϡ@0  @K\ -LhM@@@0SJ PP@`V 1 @Ϡ @KfB PF |pK 0 @0@` p p, Hl` $ (p @\ @dp X 0` @T @P @L @H @D @@ @< @8 @^4 :%: h ,K1/0P 0 t0 @"  @ 00 @B  @t -L @@ 0-LM@@P  0 @0@  @PP@ @@I? (1 !$1K0JPEGE_ModInit p MjpegeCheckParamMJPEGE_SetParamJpegeCheckParamJPEGE_SetParamJpegeGetBitsOfLastFrmJPEGE_PutBitStreamJPEGE_GetBitStreamJpegeValidUserParamJpegeDefaultUserParam 1H #@\ %7N_8@Wb(3DQgp(:9Wmhyd3M\ec/ccccBcccc8ccccc/BccccccccccccccccccccccccccccccccccccccJPEGE_ReadRegsJPEGE_ConfigRegsJPEGE_IntProcessJpegeGetIntTypeJPEGE_StartOneFrameJPEGE_InsertUserDataJPEGE_SetChnAttrJPEGE_ExitJPEGE_CreateChnVALG_BallocJPEGE_InitContiguousBufferg_bJpgePowerSaveEnJpegeCheckChnAttrJpegeUpdateVpuConfigJpegeUpdatePicParamPackJFIFVALG_CB_UpdateRp   (1#%(:3=<9387@H\N@DWE78PmQW_bghg>Mqypdx\egc//cB8Bcccccccccccccccccccccccccccccccccccccccccccccccccc//cB8Bcccccccccccccccccccccccccccccccccccccccccccccccccc" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ? # "$ !%0  &/1'.29(-38:),47;>*+56<=?JpegePicStartCtrlSnapJpegeInitPicParJpegePicStartCtrlNo YesYUV420 YUV422JPEGE_DRV_WriteRegsJPEGU_GetRegAddrJPEGU_HAL_InitIntMaskJPEGU_HAL_SetTimerModeJPEGU_HAL_SetPowerModeJPEGU_HAL_Init::JPEGE_DRV_ExitJPEGU_OutputDebugInfoJPEGE_DRV_Initversion=Hi3521_MPP_V1.0.6.2 license=Proprietaryauthor=HiMPP GRPparmtype=ContiguousBuffer:uintparmtype=g_bJpgePowerSaveEn:uintsrcversion=533BB7E5866E52F63B9ACCBdepends=hi3521_venc,hi3521_basevermagic=3.0.8 mod_unload ARMv7 unload jpege.ko for %s...OK! Hi3521[Func]:%s [Line]:%d [Info]:Rgs module fail. load jpege.ko for %s...OK! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/jpege/jpege_ext.cHI_NULL != pstParamMCUPerECS(%d) err! should be [%d,%d]! qtable err! should be (0,255]! Mjpege set param err! Qfactor(%d) err! should be [%d,%d]! Jpege set param err! HI_NULL != pstCtx%s: Stream buffer Addr is incorrect! %s: Stream buffer released wrongly! 0HI_SUCCESS == s32Rets32PackCnt <= 2(((HI_U32)pstRh[0]) & (HW_BURST -1)) == 0HW_BURST < (stRdInfo[0].u32Len[0] + stRdInfo[0].u32Len[1])0 == (pstRh[0]->u8LastEcs & 0xFE)0 == (pstRh[0]->u8TopField & 0xFE)pstRh[0]->u32InvalidByte < HW_BURSTHW_BURST < (pstStrmPack->u32Len[0] + pstStrmPack->u32Len[1])HI_NULL != pstChnCtxHI_NULL != pWorkJpegus32Ret == HI_SUCCESSHI_TRUE == bMainStreamint stat: %d. %s: Strm in buffer larger than setting! %s: No Buf for encoding! %s: Pic with wdith(%d),height(%d) come into chn % d,which with width(%d),height(%d)! Warning! Buffer left is small than the data writing in!u32WrLen < VALG_CB_GetFreeLen(pstStrmBuf) Lenght writing in must be multiples of work (32-bit)!%s: Userdata len %d should be less than 1K! NULL != pstChnCtx->pVirtUdBufTemp%s: Too many userdata packets! %s: static param change refused! %s: Chn Attr Invalid! When change the channel width(%d) or height(%d) ,conflict with the MCUPerECS(%d)! %s: The channel is already exist! %s: Buffer [%d] not enough!At least %d Jpege%dvalg alloc mmz buffer failed! valg alloc mmp buffer failed! %s: BufSize %d too large, alloc failed! ((HI:: _U8*)pMemEnd - (HI_U8*)pVirtMem) <= u32MemSize Error! Length of buffer must be multiples of word (32-bit)!%s: Jpege sys init failed! [Func]:%s [Line]:%d [Info]:Pic maxwidth(%d) err! should 4 aligned!Pic width(%d) err! should 4 aligned!Pic maxheight(%d) err! should 4 aligned!Pic height(%d) err! should 4 aligned!MaxPicWidth(%d) err! should be [%d,%d]! PicWidth(%d) err! should be [%d,%d]! MaxPicHeight(%d) err! should be [%d,%d]! PicHeight(%d) err! should be [%d,%d]! ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/code/mkp/vedu/jpege/jpege_ctrl.cpstCtx->stChnAttr.u32PicWidth == pstVFrame->u32WidthpstCtx->stChnAttr.u32PicHeight == pstVFrame->u32Height0MULTI_OF_2_POWER(pstConfig->u32StreamAddr, 64)MULTI_OF_2_POWER(pstConfig->u32BufferLength, 64)MULTI_OF_2_POWER(pstConfig->u32StreamRdPtrAddr, 64)MULTI_OF_2_POWER(pstConfig->u32StreamWrPtrAddr, 64)MULTI_OF_2_POWER(pstConfig->u32YPhyAddr , 16)MULTI_OF_2_POWER(pstConfig->u32CPhyAddr , 16)MULTI_OF_2_POWER(pstConfig->u32YStride, 16)MULTI_OF_2_POWER(pstConfig->u32CStride, 16)NULL != pstPicCtxNULL != pstPicParamPackHI_SUCCESS == s32Ret%s err! Len must be multiples of word(32-bit)!pstQtHdr->u16DQT == 0xDBFFpstFrmHdr->u16SOF == 0xC0FFpstHtHdr->u16DHT == 0xC4FFpstRst->u16DRI == 0xDDFFpstScanHdr->u16SOS == 0xDAFFMjpeg rate control discard one frame pstChnCtx->stChnAttr.u32Qfactor >= JPEGE_MIN_QFACTOR && pstChnCtx->stChnAttr.u32Qfactor <= JPEGE_MAX_QFACTORRc start one frame return %d err jpege%s%d%dhelp-------------- Proc Write Help -------------- COMMAND echo "[param DIGIT] [chn]" >/proc/umap/jpege DESCRIPTION You can change encode parameters directly with commands. But only in DEBUG mode. OPTIONS [param DIGIT]: parameter will be set to DIGIT [chn] : channel number paramter(ALL) mode -- mode select. 1, DEBUG mode; 0, NORMAL mode -- Note: Remember to return normal mode w:: hen debug ok. parameters(VPP) DiTp -- sample format. 1, 422; 0, 420 bDie -- De-interlace. 1, yes; 0, no bEdge -- Edge detection. 1, yes; 0, no bMed -- Mean detection. 1, yes; 0, no bMS -- Move Still. 1, yes; 0, no bTf -- Time filter. 1, yes; 0, no bTR -- Texture remove. 1, yes; 0, no parameters(JPEGE) TFR -- Target Frame Rate. TBR -- Target Bit Rate. MCU -- MCU per ECS, i.e. Restart interval. ImgQ -- Image Quality (used for snap). cmd: %s %d [chn%d] Invalid chn ID! It should be [0,31]! Invalid! chn %u unexist! modeChn %u enter NORMAL mode! Chn %u enter DEBUG mode! Pls enter DEBUG mode firstly! Do as follow: echo "mode 1" >/proc/umap/jpege DiTpbDiebEdgebMedbMsbTfbTRMCUFail! MCU should be [0, Total MB of one pic]! ImgQFail! ImgQ should be [0, 5]! Fail! ImgQ only for JPEG snap! Invalid command! Need help? Pls enter: echo "help" >/proc/umap/jpege [JPEGE] Version: [Hi3521_MPP_V1.0.6.2 ], Build Time[May 4 2014, 19:31:47] -----ATTRIBUTE----------------------------------------------------------------- %s %s %s %s %s %s %s %s %s %s %12s IDbMjpegPicTypeWidthHeightViFldbMainByFrmQfactorContiBuffer%2d %s %s %d %d %s %s %s %d %d %12d -----STATUS1------------------------------------------------------------------- %s %s %s %s %s BufLenFreeLenStrmCntMaxStrm%2u %d %d %d %d -----STATUS2------------------------------------------------------------------- %-6s%-10s%-12s%-13s%-11s%-12s%-9s%-10s%-11s%-13s PicRecPicCodedPicDropedPicDiscNoStmCntNoBufRcFailFullIntPicRecode%-6d%-10u%-12u%-13u%-11u%-12u%-9u%-10u%-11u%-13u -----STREAM BUFFER------------------------------------------------------------- ID Base RdTail RdHead WrTail WrHead BufLen DataLen BufFree %2d 0x%x %4d %4d %4d %4d %4d %4d %4d ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pu::b/platform_h3/mpp/code/mkp/../arch/hi3521/hal/jpegu/jpege_drv.cNULL != pJpgeRegsNULL != pstConfigHI_NULL != pJpeguRegs32Mode >= 0 && s32Mode <= 1s32Mode >=0 && s32Mode <= 1HI_SUCCESS == s32RetHI_NULL != g_pstJpeguCHIP_Reg[0][Func]:%s [Line]:%d [Info]:jpeg timer: %#8x. JPEG unit has been init JPEGU memmap failed. %sJPEGU_0chnlctx handle is invalid! $ $ ,cPK72-hi3521_jpegeGNUS~gSgADnZs dA.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.rodata.modinfo.rodata.str1.4.rel__param.rel.data.rel.gnu.linkonce.this_module.note.gnu.build-id.bss.note.GNU-stack.ARM.attributes.comment4x ()x0% 88y4 CyK8T2$`g :: c 0 so  }<$y `$p/uk    0. 3 8F P( U_D dX i  lD q vt {  i\`d i| i i i04   i$ <   x L   iL$P$` i|%%i&&x i'' i`(d(  i,,   p   i55!d ' -@ i993 9 ? ip<t<i==Ed Kl Q W  ] c : :i8 o iXC`CuL iCi{ 4DTd|!@8@QP``ot~     2DV1gBa!i ( ,d i i   iC.h 4{T q 3 P _ d v( | Fl ( d 0  p <  iKK p \ iNNiQQiRR @ $  iVV`   iXi4 4H)`8x?|GVe8@sxi ih XT. ,_Y3$ P, _4 dd vp { q l @ ` p    ::, X     4 H h    8 \  @  ' -  ! x  9 ? 3 ] i E0 K8 Qx o cX W Fu  h            \ t |  # ) / 5< ; A4 GH MT S\ Yh _p ex k q w }P x ii iTT e|h.| 3 P _0 FdD irri8sT(,>\(`(((+(,t))+A),A**+*+ *,*,*+) *,)(*t*+x*,*t++px+,p+x+x++p+,p,x ,+$,+(,,,,,8,+)<,,)D,H,+L,+P,,T,,`,+Bd,,Bl,p,+t,+x,,|,,,+,,,,,,,,@--.//\/+`/,l/|/+E/,E//+/,//+F/,F/$01+1,2+2,P2+T2,`2p2+Gx2,G22P4+HX4,H\4:: 4+p4,p4x4x$5+H,5,H05<5+ID5,IH5\5x`5+pd5,p5+5+5,5,5+)5,)55+5+5,5,5+J5,J5566 77+7+7,7,(7+,,7,,47D78+I8,I88+8+8,9, 9+,9,,9 9,9+H49,H89L9+P9,\9h9+Mp9,Mt99+9,99+N9,N99+9+9,9,9+O9,O994::(;+,;,8;L;+RP;,R`;x;+|;,;;+S;,S;;;<+ <,8<+<<,H<T<+T\<,T`<p<<+<,<<<<<<(=H=`=rl=+p=+t=,x=,=+,=,,=== >0>l>+p>,>+Y>,Y>{>>+>,? ?+Z?,Z?,?+0?,HdJ_  H( d dHtHd d d   ! d   `$ #0:FR,du;3: 4L8$\(8 < &\$6O[ m($a.LANCHOR0VcmpExitVcmpInitVcmpIsr.LC0.LC1.LANCHOR1.LC2VcmpSetSrcInfoVcmpSetDstInfo.LC3$d.LC7.LC6.LC8.LC5.LC4__func__.15198__func__.15234__func__.15270__mod_license318__ksymtab_VcmpStart__kstrtab_VcmpStart__ksymtab_VcmpClose__kstrtab_VcmpClose__ksymtab_VcmpOpen__kstrtab_VcmpOpens_VcmpDev__key.15210__ksymtab_VcmpIsBusy__kstrtab_VcmpIsBusys_pstVcmpReg__module_depends__mod_vermagic5free_irqVcmpHalSetSrcStrideVcmpOpen__this_module__arm_ioremapfinish_wait__iounmapcleanup_moduleprepare_to_wait__wake_upVcmpHalSetDstBankWidthinit_moduleVcmpHalInitVcmpHalSetDstAddrschedule_timeoutg_astModulesVcmpCloseVcmpStartVcmpHalGetIntValuerequest_threaded_irqprintkVcmpHalSetSrcFmtHI_LOG__init_waitqueue_headVcmpHalStartVcmpHalSetSrcResoVcmpHalSetDstStrideVcmpHalClearIntautoremove_wake_functionVcmpHalExitVcmpHalSetSrcAddrVcmpIsBusy +,P]\fdIpax]fIa]UbR0U8b@RTU`bhRZc+,+,Q+,0`D+ H+L, P,\^h+l,p^+,0`h+dp,dPVM+ , ^+ ,^<+ @, L^X+\,`^x+ |, ^+,^+ , ^+,^+ , ^ +,^,0@+D,xe+,T_+1,1 +1,1,+10,1h+1l,1+1,1+1,1+1,1 +1,1D+1H,1h+1l,1+1,1+W,WN;):@+1HLL,1\+W`,W +2 ,2 \H+ $, ,+ 0, 8[L+ P+ T, X, d^t+x,|^+,YXJg SO;:hifb.ko9Y9Y9Y <0ELF(4( -L MPUpWG pp@0`0p 00P@p\ P8 00Pi @P\ @UTpPZ@pUZP@ Up PTZPp@UpPTZ0PpA@EW(KWUpP Wp4  U4PUPp UP4P P W4pWPp UP4P P W4pW0pQp@UW" -L|MPK@@p T 2/TxpP |03/`P !(KD@Z@ x @0' @b ' 0 @n  -LAM@p@@PK``DB00@FK T08 D @ @D < !H 3/0!R S-\\Xh D ^9 D @0 d , ( 4 T@  X  |Q\ !0 HKP)@P  K 1!@!\\Xh D ^@0Q04K'00 @ZP' @P  -LM @`K`qDBx0SG ,PKd Dl @ p h 0ଐH%VPK`K^ؠ 0 cQ 18  0 < p 1t !(KL\0H0崐 0!'D1 @j '0 @ b '0 @c 0' @00 ` @H0^ L \_DLX \W'<0 @%0' @P p-L|MDR< &: 0@1<0,   Q 0@1D“Q(t<0184"#,h0Q0!@01$Qk QP  $( P Kp( R P$( P<`\ DPh0` P`* PQ|0S `ha x@KPT `2/ @00@P8ptp4t0  P$0h( l ,`01dPQ*~( l0R(lPixQr:0l -L -L`@0@@PqWP0P PXPP -L -LM@Dbr3dTpQ }&TPP@ !0SV [D T (yHTt cZH T. \& HT ^H T8` H K?0oK0  003S@oK @l60DTh ls60DT |& DT+ gxDTP \'> @' @@|P ^ 'T> @SD@0'  @@eDT  ]& DT cDTZ _D TESOKp T@4/AP ^'= @' @@3hDT 1jD T \ '= @ G@' @@qDT oDT '< @K0 ' @@(K}T; e& DT dTPH@60HTQ HT  {HT =?$  03Q) @m60HTW < 3:6fHT -?0  003S@ @'p; @L' @@g$ P@'; @>' @@ 0  @T@T ` ]K?@SKP @000P3UL@\ DX qK @kP ^': @ID@' @@UnK@A @@@@@@P 0S'9 @'  @7P Q'@9 @L' @@! -?  03QK P:  0S R \"R P0S% <X2QL! D1 @S/ * BP 6!K2!K7K3Kp8qK4qK SKPQP耀@A ! 0 ,#P |000 -? 03\@0K @x@T P p]?PS/Kqo0 p0@L H D1 @ < @  0@ @PH -?0 L003S @oK @0@@@S 't6 @F@' @@nPi ',6 @G@' @@\ R '5 @F@' @@JP '5 @F@' @@8@T 'T5 @' @@&^ ' 5 @F@' @@` -\0K?@oOK 03\ @ @@#Q R @?0  003SSK P 0PLH!,P@UP!UD^ T@!T< ): @!R UTp U0Q1 EnoKTA DoK@01h !@ @ ?0oOK   03Q1 PP 01Q !!@P$ '2 @WG@' @@yQ 'X2 @2' @@gP '2 @' @@UP @880Ko/K$ ?x@LA X0@@03QH 0@D @ @ 4! D001 H, L( 4SK0 @.D T 60DT0 # @Ty'0 @zΠ0'  @P \'0 @ZE@' @@b60HT gHT 0?0 0 3R@ 1!@h X L  @$#PQ @ ?@0  003SoK P!! !R!RP @? B0003S$ R 0?  03PoK P@nHT p& HTQ; 'H1 @CG@' @@PW '1 @j' @@m  @hK @cP ` -h0K?@oOK 03\ @NoK @HP =?  03P0 @80K @2Ph -?0 03\SK PGLP H^ D\ @1S  U0@T6*PWEP 0?  03PK0K P000@^ ,@T P0@0 0@ D2DP LPXP tP R@X '$: @' @@IoK @DSK @? !@<': @0'  @_': @' @@'; @' @@ ?  03PK P(X2 SOKp T 2/\ T0SK@K3/8oKPPpPt@pP@t@`p\PKQXpe\40  !\@<?: H X!Lc !@  ?@  0@3TSK P<^   0S RW P0S0p@( LqaW#3WPpcᗏK$< x x2L2 H P=< 81<R1  y@Sp* 0KK@AKAK !K!K RK@0 @0S R o_K@1@01 !@? ? 0  003S!oK PX^1ST ` 8 SKpĐp" <T@t 4/P0pl2 p0l pt p@h td2 0h" lA `ฑT 0hcY$p2S< 8@ | R) Y' x0S Sw SS\@T0SL^ +`  8@0@p L1\@d@D @ @`"01@\ !@ =?0  03QSK0 P @,@T !000Sj oOKp T03/ 1tqWpp  ,QO (!RL W 3 L!R( @ RR(@ @\: DQL@!RIW 6@  R@ 01 1@ $!P  1p p00@L!D2xQ x 1 @H!RD2X  T R @H ^ \ ''0Sx\ ! 1 @ ! DBX 1S !<^8\ '|? @' @P#' @5<*: ' @<h0DP\ 8<먁@ 0? $ 03PoK$ P @xpW Q*1!S*^ \ Pa0 5Q0c1 W5@!,1P# @ |P1! 'L= @R'1 @!@i @ ? 0  003SU0K @P0^ 0 0A ! !H!F<0$SK3/USK @<0K @70K @2oK @-oK @(0K @#K @SK @oK$ @oK @SK0 @ 0K @'|; @rΠ0'  @@'<; @n0'  @@': @iΠ0'  @@': @0'  @@'|: @0'  @@'<: @F@0'  @@ @=?  03^e0K Pp 0|0X X| xTQSK@ @,(!R@P8 1,4A T(0^ '$4 @,'0A 41 @(@@40!9@P P0 t00'|3 @A@' @@XApR$%'03 @@' 00 @@ @oK  @!'2 @@' 00 @@ @Rw'\2 @aD@' 1 @@ '2 @W0'  @'1 @6G@0'  @@o 't1 @0'  @@s0 !@n' 1 @0'  @@^'0 @[0'  @@NooKPz @E'd0 @j `' pd2 @P0`r bd | X | L h ',0 @c 'h2 @0pahr KP9 @0S: p ^ d@L0 @''0 @0'  @@!@'<1 @jΠ<: ' @@'x1 @:<' X2 @L@@'1 @0'  @@'2 @A@' @@'@2 @H@' @@L8 <04.!p .00$$Pd(  @L1 @p0 P0d 0 ',3 @(0'  @@K'l3 @E@' @@<'3 @D@' @@-1@@Q'4 @D@' @@'44 @' @@ 'l4 @D@' @@'4 @A@' @@'4 @/0' @@@',5 @.' @@'h5 @D@' @@`PDtQP!/@'5 @' @@'6 @@@' @@'P6 @0'  @@\@ \[`\[_`\P )@!r'6 @G@' @@c'7 @t' @@T!@Q'P7 @' (1 @@?'7 @' @@0'7 @'  @"' 8 @' 01 @@'`8 @ D@'  @B'8 @,<' 81 @L@@'8 @ ' @@SKNOO',9 @%<: ' @@'x9 @V' @@9' @.' @'9 @~' @@'(: @'D@'  @'X: @' @@': @0' @$E#5@@n': @' @@_' ; @' @@P'X; @0'  @@@'; @gE@' X2 @@0'; @E@' @@!'< @' @@ -Lh80(0S%3/ -Lh80,0S3/ -Lh8,\  ' @=' @KpP P@(KL PP  $ (0T s3XH@ PPPP,"PP -LR@ P@  p-LM@@@QI0P$0 c P KpKP[Q $KP$ IR?' @' @?' @Ϡ' @ -L -L M@P<: K',0 @'  @ -L@1P p-LM@ @1QS% PKp 0`KK$K"0K `K# K $ \    (K&K' K( 0-L M@ 0KC K @,P ( $ 0 P R(0   ,PKK0'00 @J ' @ -L M00@QC Q 7>' @!' @KIPh -L$M@@@P@Kc6p[<8[7P[W000  Y 0 P(K0KP 0 R?' @' @ -LMQ 00 K@@ 0@ -L @1qP -L @1P 0-LMPP@C0S\ P0 PK0 -L @1 -L!P00@ -LP00@- -L00@ -L@H@L@P@D@@@T@X@ -L M@@@@  @0@ @K -LUM`KⰀKp@P`PPPpP@PP PRKPPP\1 0 Sp @ 1d hP  -`! t 0Lx `1 P Q - 0X `Ta PhQ `P h|  X P< T\ K<: [0K8 @@ \4 \` P  K0K 'P L H DP `D0^1  X0 0 l0 @\ 񟗱llll \ |0 CRh"P& 5K.K/QK0!K< 0S 0 0H! 0  0K P R PP0KPPPPK0K0 P@KRK PPL`VQ  ?`!"@Pc `Vk TPP@d 0\H0`PUiP R 0P(K00@P@ `PP @ 0 p$`!P%"&5K/qK0aK'QK(KK K!K1K< .!K,1K&!K$1KH0d 0PPP X P T! L P1 H D F`PQ P T Q@0P0 @0@@0V  0-L@@@1/0S ` 2/PP@@ T@:0 -L|M@@@pp@@PP @``@PP@@㌐KP@0000@@P   '8 @@0' @``@0p_S 0Kp0_S 0Kp_P ',8 @'  @, K 0 `C P@:'7 @0'  @t0 ^0 0P'H7 @ 0'  @W %  R" ,R p gBGBXR~p xR P^ R  0 u·0.0!upP  P R 0$p 0咄.WSQp @@TY``@u@ P@@<:K5' @' @5' @' @P5' @' @As`P '4 @2'  @ @`D2$s "0 0P P 0 @P D @$8 %P D $  P D $ P D $ 0! P'X3 @e' 0 @ i% P0'2 @p0' @000P Q  P  P<2 '`2 @| ' @P '2 @'  @'1 @ @'00<K @<K @ @0PĠ p00@P PU \@4/@@@ 03/PP '1 @' @ R @K@G  EK'0 @Z0' @`1/P@P@^@@(K   hd   < GNU{ҏg4)<.      <:            hifb_start_vcmphifb_dosetcolreghifb_checkmem_enoughhifb_check_varhifb_check_fmthifb_cursor_hidehifb_refresh_1bufhifb_cursor_bakuphifb_refresh_2bufhifb_cursor_showhifb_wait_regconfig_workhifb_refresh_2buf_immediate_displayhifb_open @@ @@  hifb_vo_callbackhifb_tde_callbackhifb_parse_proccmd $ , 4   <: (4@LXdpxhifb_buf_allocmemhifb_alloc_vcmpbufhifb_disp_setdispsizehifb_disp_callbackhifb_set_layerposhifb_parse_cfghifb_inithifb_overlay_probehifbhifbhifbhifbHIFB_MAIN_VERSION[HIFB_MAIN_VERSION] Build Time[May 4 2014, 19:32:12]hifb_versionhifb_ioctlhifb_onrefreshhifb_onputlayerinfohifb_alloccanbufhifb_cursor_attachhifb_cursor_putinfohifb_cursor_changestatehifb_cursor_changeposu32VcmpBufNumsoftcursordisplayvideo))()8)H)X)(((()H& @ @ @ HIFB_DRV_GetOSDDataHIFB_DRV_SetPreMulHIFB_DRV_InitHIFB_DRV_SetLayerRectHIFB_DRV_SetLayerDataFmtHIFB_DRV_SetLayerAlphaHIFB_DRV_GetLayerStrideAlignapszLayerMmzNames < :---- license=Proprietaryparmtype=u32VcmpBufNum:uintparmtype=softcursor:charpparmtype=display:charpparmtype=video:charpparm=apszLayerMmzNames:The mmz names for the graphics layers.parmtype=apszLayerMmzNames:array of charpdepends=vermagic=3.0.8 mod_unload ARMv7 [Func]:%s [Line]:%d [Info]:Start vmcp failed! regno: %d, larger than 255! memory is not enough! now is %d u32Pitch %d u32Height %d expect %d cursor layer doesn't support this operation! Unknown fmt(offset, length) r:(%d,%d,%d) ,g:(%d,%d,%d), b(%d,%d,%d), a(%d,%d,%d), bpp:%d! Unsupported PIXEL FORMAT! yres(%d) of u32LayerId %d should be even when vodev output is interlace xres(%d) of u32LayerId %d can't be less than min_width(%d) yres(%d) of u32LayerId %d can't be less than min_height(%d) xres(%d) of u32LayerId %d should be less than xres_virtual(%d) yres(%d) of u32LayerId %d should be less than yres_virtual(%d) the sum of layer%d's xoffset(%d) and xres(%d) should be less than xres_virtual(%d) the sum of layer%d's yoffset(%d) and yres(%d) should be less than yres_virtual(%d) the sum of layer%d's left_margin(%d),xres(%d),right_margin(%d) and hsync_len(%d) can't be 0 xres:%d, yres:%d, xres_virtual:%d, yres_virtual:%d layer %d don't has enough mem! expected: %d KBytes, real:%d KBytes Cursor should be attached to layer%d No user buf send to fb in 0 buf mode! blit err! blit err 3! blit err! 1 blit err! 2 No cusor img set! blit err! 6 Wait vblank failed!blit err 4! blit err!5 layer %d is not supported! failed to get osd data! open layer %d failed! error layer id:%d Invalid default colorfmt! failed to get layer%d's osd data! tde callback blit handle:%x, end handle:%x showerr:u32LayerId %d no open! cursor layer %d doesn't support this cmd! hidehelphelp info: echo cmd > proc file hifb support cmd: show:show layer hide:hide layer For example, if you want to <: hide layer 1,you can input: echo hide > /proc/graphic/hifb1 u32LayerID %d doesn't support cmd:%s, use help cmd to show help info! unkown layerlayer name :%s Open count :%d OFFONShow state :%s Start position :(%d, %d) xres, yres :(%d, %d) xres_virtual, yres_virtual :(%d, %d) xoffset, yoffset :(%d, %d) fix.line_length :%d Mem size: :%d KB NOYESLayer Scale (hw): :%s ColorFormat: :%s Alpha Enable :%s AlphaChannel Enable :%s Alpha0, Alpha1 :%d, %d Alpha Global :%d Colorkey Enable :%s Colorkey value :0x%x Deflicker Mode: :%s Deflicker Level: :%s Display Buffer mode :%s Displaying addr (register) :0x%x display buffer[0] addr :0x%x display buffer[1] addr :0x%x displayrect :(%d, %d) screenrect :(%d, %d) device max resolution :%d, %d IsNeedFlip(2buf) :%s BufferIndexDisplaying(2buf) :%d refresh request num(2buf) :%d switch buf num(2buf) :%d union rect (2buf) :(%d,%d,%d,%d) canavas updated addr :0x%x canavas updated (w, h) :%d,%d canvas width :%d canvas height :%d canvas pitch :%d canvas format :%s IsCompress :%s attach cursor id: :%d backup cursor addr :0x%x backup cursor fmt :%s backup cursor stride :%d backup cursor (w, h) :(%d, %d) cursor rect in display buffer :(%d, %d, %d, %d) cursor pos in cursor image :(%d, %d) layer name : %s Show State :%s referecce count :%d position :(%d, %d) Alpha Enable :%s<: cursor hot pos(x, y) :(%d, %d) alloc mem failed! The color format %d is unsupported by VCMP! VCMPNo memory! the resolution is larger than the max size of the screen or the layer! ++ setdispsize .memory is not enough! param error! layer id:%d, pParamr:%p ! the sum of s32XPos(%d) and min_width(%d) larger than Vodev screen width(%d)! the sum of s32YPos(%d) and min_height(%d) larger than Vodev screen height(%d)! offonvramvideo:%s layer id is out of range! Layer %d is in module_param---video out of range! Layer %d unsupported, so module_param---video can't contain vram_size for it! Usage:insmod hifb.ko video="hifb:vrami_size:xxx,vramj_size:xxx,..." i,j means layer id, xxx means layer size in kbytes! example:insmod hifb.ko video="hifb:vram0_size:810,vram1_size:810" failed to malloc the fb_info! ovl%dhifb_layer%d%s:failed to malloc the video memory, size: %d KBtyes! Failed to call map video memory,size:0x%x, start: 0x%lx fb_alloc_cmap failed! failed to register_framebuffer! succeed in registering the fb%d: %s frame buffer device hifb%ddrv init failed %s Load hifb.ko OK! NULL arg! not supprot layer %d! you shouldn't refresh cursor layer!doesn't support FBIO_REFRESH operation when refresh mode is HIFB_LAYER_BUF_BUTT! rect error: update rect:(%d,%d,%d,%d), canvas range:(%d,%d) addr 0x%x or pitch: 0x%x is not 16 bytes align ! you shouldn't put cursor layer info!DisplaySize(%d, %d) can't be different with ScreenSize(%d, %d) when layer %d don't scale memory is not enough! display witdh/height shouldn't be 0! u32DisplayHeight(%d) of u32LayerId %d should be even when vodev output is interlace screen width/height shouldn't be 0 u32ScreenHeight(%d) of u32LayerId %d should be even when vodev output is interlace No enough mem! layer real memory size:%d KBytes, expected:%d KBtyes It's not supported to set start pos of layer to negative! s32YPos should be even for interlace vodev! <:Colorkey and premul couldn't take effect at same time! mem size is the same , no need alloc new memoryfree old canvas buffer hifb_canvas%dalloc canvas buffer no memmap canvas buffer failed! alloc new memory for canvas buffer success deflicker is not supported! deflicker parameter is illegal! Layer %d doesn't support colorkey! colorkey and premul couldn't take effect at the same time! The key :%d is out of range the palette: %d! you shouldn't set soft cursor screensize!stScreenSize u32Height(%d) should be even for interlace vodev!the sum of u32Width(%d) and s32XPos(%d) larger than Vodev screen width(%d),u32Width will be changed! the sum of u32Height(%d) and s32YPos(%d) larger than Vodev screen height(%d),u32Width will be changed! you shouldn't set soft cursor origion by this cmd, try FBIOPUT_CURSOR_POSIt is not support VBL! you shouldn't show sot cursor by this cmd, try FBIOPUT_CURSOR_STATE!The layer is show(%d) now! you shouldn't attach hard cursor by this cmd! layer %d is not cursor layer! LayerId %d should be in [0, %d) or it is not supported! Don't allow attach cursor to itself or other cursor layer! failed to attach layer! The layer :%d is not opened! failed to attach layer! The layer format is clut not supported! failed to attach layer! The cursor info is not set yet! The layer has attached another cursor, you should detach it first! you shouldn't detach hard cursor by this cmd! Detach cursor to itself or other cursor layer! cursor image addr is equal to 0! cursor's width or height shouldn't be 0! cursor's pitch shouldn't be 0! unknown color fmt! hotpos err! The cursor image addr is NULL! the cursor pos(%d,%d) out of range ! you shouldn't set hard cursor alpha by this cmd! Layer %d doesn't support Dcmp! hifb_alloc_vcmpbuf failed! Layer %d doesn't support get compression! you shouldn't use FBIOFLIP_SURFACE for soft cursor!the addr is out of range! error! the command:0x%x is unsupported! alloc canvas buffer failed <  :layer_0layer_1layer_2layer_3layer_4layer_cursor_0layer_cursor_1RGB565RGB888KRGB444KRGB555KRGB888ARGB4444ARGB1555ARGB8888ARGB8565RGBA4444RGBA5551RGBA5658RGBA88881BPP2BPP4BPP8BPPACLUT44ACLUT88PUYVYPYUYVPYVYUYUV888AYUV8888YUVA8888BUTTNONETDEVOUunkownLOWMIDDLEHIGHAUTOERRORtripledoublesingletriple( no frame discarded)failed to create proc %s usage as following: cat /proc/graphics/higo display all proc information echo proc on > /proc/graphics/higo enable higo proc. default is disable! echo proc off > /proc/graphics/higo disable the proc information! echo time on > /proc/graphics/higo enable higo print time. default is disable! echo time off > /proc/graphics/higo disable print time! higohigo_logfailed to malloc mmz memory size:%d failed to map phyical addr to kernel virtual addr!The command string is out of buf space :%d bytes ! failed to call copy_from_user ! proc onproc offtime ontime offThe log memory is null! There is a unkown error! ------------------------- higo total information ----------- %s %s OFFONproc status : %s time print : %s The higo don't run yet! surface used : %d layer used : %d mmz memory used : %d bytes ( %d KBytes ) system memory used : %d bytes ( %d KBtyes ) %6s %16s %8s %8s %8s %8s %16s %s numbernamewidthheightpitchphyaddrsize(Kbytes)format%04d %16s %8d %8d %8d 0x%08x %8d %16s ----------------------- surface inforamtion -------------- MOD:COMMONMOD:SURFACEMOD:MEMSURFACEMOD:LAYERMOD:BLITERMOD:DECMOD:TEXTOUTMOD:WINCMOD:DESKTOPMOD:UNKOWN%16s phyical memory used:%8d bytes, system memory used: %8d bytes ----------------------- memory inforamtion -------------- SINGLEDOUBLEUNKOWNTRIPPLEnoyeslayer id : %s pixel format : %s buffer t<!: ype : %s created : %s default canvas surface: %s user canvas surface : %s antiflicer level : %s canvas surface (w, h) : %d, %d display surface (w, h): %d, %d screen surface (w, h) : %d, %d ----------------------- layer inforamtion -------------- HIGO_PF_CLUT8HIGO_PF_CLUT1HIGO_PF_CLUT4HIGO_PF_4444HIGO_PF_0444HIGO_PF_1555HIGO_PF_0555HIGO_PF_565HIGO_PF_8565HIGO_PF_8888HIGO_PF_0888HIGO_PF_YUV400HIGO_PF_YUV420HIGO_PF_YUV422HIGO_PF_YUV422_VHIGO_PF_YUV444HIGO_PF_A1HIGO_PF_A8unkownNONELOWMIDDLEHIGHAUTOHIGO_LAYER_SD_0HIGO_LAYER_SD_1HIGO_LAYER_HD_0HIGO_LAYER_HD_1HIGO_LAYER_AD_0Unkown[Func]:%s [Line]:%d [Info]:failed to get screen width and height! not allow to set pre-mult mode when the GlobalAlpha is 1 not allow to set pre-mult mode when the color format is ARGB1555 tde open failed the height must be even for interlaced device not support this color formatthe global alpha can not set to 1 when the pre-mult mode is enable ASSERT failed at: >File name: %s >Function : %s >Line No. : %d >Condition: %s /home/pub/platform_h3/mpp/component/hifb/drv/hi3521/hifb_drv.cNULL != pu32StrideAlignhifb:vram0_size:8100,vram1_size:1620,vram2_size:1620,vram3_size:32block:%d callback:%d deflciker:%d bscale:%d level:%d par:%p addr:%d format:%d h: %d w: %dblit reg:%d,%d,%d,%d add:0x%x pitch: %d enable region deflicker failed! begin job failed tde blit failed ret = 0x%x handle %d end job failed!s32Ret = %x disable region deflicker failed! $ $ $ $$HIFB_DRV_GetOps\\''''(($(4(@(P(`(p((((((((|+hifb<": A.aeabi$7-A A ,GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1.symtab.strtab.shstrtab.rel.text.rel.exit.text.rel.init.text.note.gnu.build-id.rel__ksymtab.rel.rodata.modinfo.rodata.str1.4.rel__param__ksymtab_strings.rel.data.rel.gnu.linkonce.this_module.bss.note.GNU-stack.ARM.attributes.comment4 \PF)t% H8P 4 H C$Z$$V hh,(d x pT y2`-hP hx$ 0$ p/?<#:`+ D  4 40:DW \ adu0 aPTzT4P a488HP 0 L T    <    a    d < a'p a-? E aKa]n t ahlzl0 a  ad$h$h$4L*,   X D a**t a222- al4p43 9 ? E K Q W$ ]0 cH i\ op u { a4787< ,  `      ( P t    <$:    4 \      4 X #| ) / 5 ; A< G` M S Y _ e$ kH ql w }    D h   a<<  4 X    a|???8   aCCCx$ l aG G" Gp4HaIIA$JTJetK}    aOOORt \ ` d l x    `     & -L 4 ; B I P W ^  at eXSp?pD w@ ~ 0 ` 4  X   l  h accl       h   $ <  l & <%:- 4 ;P adB I P8 W ^< e4 lt s` z  D    l 4   X     | L  0 p     a "@ 3@p > M \ k z     4 H \ p $      H  '\  6p  E  Q  ]  i  x h D  X  l               <   L  & X  5 h  D |  S  b  q           0 + J @ a aS a l t `a a    0a    Ȓ Ȓ,a0lWP aę ę(al lhaP a% 2 @Wl \ u ! h! <&:! " " " <" " " " " " p" $# d# 't# p# Ex# ?# t# # $ 4$ n# " ?$ 09$ $ $ $ -$ 3$ Q$ d$ $ $ E<% WH% ]T% cd% ip% o|% u% {% K% % % % : ' 8& @& H& P& \& X& `& a ?   K ,  aal aW l D W`) \|) ) u) $* a 8* ah* * * $+ d+ aaD  T d x         9 v> S * q a a`) a a@ @a0 0W+ \+ u+ + + , , , $, ,, 4, L, X, aXl, h, , , , <': a0 0 p a+ a a av aa  ! a   03 d,B _ xt | $ ܴ$  hT   $ 4H t4&/?0$Zf87| 4|8lL0t`>l,5<UoD`<(d\%>@Ub nXT+5Q$ay4 p4&3Of?w$ ! -5LTiX,\ @ <(: 5P_w~t0T0/6hDYenv̰H!84(ITet@  (<Sb4zD  (`T$DS>&XCQR`vth$ahifb_getfmtbyargb.LANCHOR0hifb_start_vcmp.LANCHOR1.LANCHOR2hifb_vcmp_callback.LC0.LC1$dhifb_dosetcolreg.LC2hifb_setcolreg.LC3hifb_setcmaphifb_check_var.LC15.LC6.LC7.LC4.LC5.LC11.LC16.LC12.LC13.LC14.LC8.LC9.LC10hifb_cursor_hide.LC17.LC19.LC18hifb_refresh_1buf.LC20hifb_cursor_bakup.LC22.LC21hifb_refresh_2bufhifb_cursor_show.LC23.LC24hifb_wait_regconfig_work.LC25hifb_refresh_2buf_immediate_display.LC26.LC27hifb_openhifb_disp_callbackhifb_vo_callback.LC30.LC28.LC29.LC32.LC31.LC33hifb_tde_callback.LC34.LC35.LC36.LC38.LC39.LC47.LC37.LC40.LC41.LC42.LC43.LC44.LC45.LC46.LC49.LC48.LC51.LC50.LC52.LC53.LC54.LC55.LC56.LC57.LC58.LC59.LC61.LC60.LC62.LC63.LC64.LC65.LC66.LC67.LC68.LC69.LC70.LC71.LC72.LC73.LC74.LC75.LC76.LC77.LC78.LC79.LC80.LC81.LC82.LC83.LC84.LC85.LC86.LC87.LC88.LC89.LC90.LC91.LC92.LC93.LC94.LC95.LC96.LC97.LC98.LC99.LC100.LC101.LC102.LC103.LC104hifb_release.LC106.LC105.LC107hi<):fb_disp_setdispsize.LC108.LC109hifb_refresh_0bufhifb_refreshhifb_refresh_againhifb_pan_displayhifb_disp_setscreensize.LC112.LC111.LC110hifb_set_parhifb_overlay_cleanuphifb_cleanuphifb_init.LC113.LC114.LC115.LC116.LC117.LC118.LC119.LC120.LC121.LC122.LC123.LC124.LC125.LC126.LC127.LC128.LC129.LC130.LC131.LC132.LC134.LC135hifb_ioctl.LC142.LC137.LC168.LC180.LC196.LC136.LC169.LC138.LC193.LC170.LC172.LC190.LC164.LC189.LC179.LC192.LC159.LC154.LC155.LC158.LC141.LC173.LC187.LC167.LC166.LC143.LC182.LC174.LC140.LC171.LC161.LC175.LC163.LC186.LC194.LC150.LC147.LC181.LC145.LC183.LC188.LC162.LC160.LC178.LC177.LC176.LC191.LC148.LC195.LC144.LC146.LC153.LC152.LC139.LC157.LC197.LC156.LC151.LC149.LC185.LC184.LC165s_stArgbBitFieldCSWTCH.518__func__.49889__func__.51257__func__.48662__func__.48793__func__.48745__func__.50147__func__.48917__func__.50035__func__.49039__func__.50077__func__.49171__func__.49221C.317.47693__func__.47680s_stDefVar__func__.50465__func__.49817__func__.51761C.495.51598C.496.51599C.497.51600s_pszLayerNames_pszFmtName__func__.49965__func__.48684__func__.49338__func__.50729__func__.49584__func__.51483__func__.47623__func__.51359s_stDefFix__func__.48567__func__.47861__func__.50988__func__.51074__func__.50928__func__.50209__func__.50400__func__.50377__func__.50339__param_str_u32VcmpBufNum__param_str_softcursor__param_str_display__param_str_video__mod_license6195__mod_u32VcmpBufNumtype560__mod_softcursortype557__mod_displaytype554__mod_videotype551u32VcmpBufNumsoftcursordisplays_sthifbops__param_u32VcmpBufNum__param_softcursor__param_display__param_videos_stDrvOpsg_bSoftCursor__key.47690g_bDisplayOnHIFB_ProcWriteHIFB_proc_openHIFB_proc_opss_pHIFB_procs_proc_itemsC.227.16045C.229.16047s_pu8LogMemKVirtAddrs_u32LogMemPhyAddrs_HifbLayerToHwLayer__func__.47412__func__.47363__func__.47347__func__.47212__func__.47198__func__.47166__func__.47156__p<*:aram_str_apszLayerMmzNames__param_arr_apszLayerMmzNames__mod_apszLayerMmzNames52__mod_apszLayerMmzNamestype51__kstrtab_HIFB_DRV_GetOps__ksymtab_HIFB_DRV_GetOps__param_apszLayerMmzNamess_bTdeColFmtCSWTCH.278s_pTdeCallBack__module_depends__mod_vermagic5unregister_framebufferHIFB_DRV_SetVcmpModeHIFB_PROC_InitVOU_GraphicsSetColorKeyValueLog_PrintSurfaceInfoHIFB_DRV_SetPreMulhifb_TdeIsSupportFmtHIFB_OpenLayerparam_ops_uintTdeCalScaleRectVcmpOpenTdeOsiCancelJob__this_moduleHIFB_DRV_SetIntCallbacksnprintfLog_ShowTdeOsiOpenprintbufHIFB_DRV_DeInitHIFB_DRV_GetHaltDispStatusfinish_waithifb_print_layer_procHIFB_ProcIoctlprintoptLog_PrintMemInfos_pszFormatVOU_GraphicsSetLayerGalphaunmap_mmbg_stLayercleanup_modulehifb_read_procparam_array_opsprepare_to_waitHIFB_ProcUnlockedIoctlmemcpyVOU_GraphicsSetGfxPalphaVOU_GraphicsSetGfxKeyModeHIGO_Log_Deinitkfreeseq_lseekhifb_print_softcursor_procHIFB_PROC_RemoveModuleVOU_GraphicsSetGfxAddrframebuffer_alloc__wake_upLog_PrinSysInfoHIFB_DRV_ColorConvertdelete_mmbHIFB_DRV_SetLayerDataFmtHIFB_DRV_SetLayKeyMaskTdeOsiEndJobinit_modulecreate_proc_entryTdeOsiCloseVOU_GraphicsOpenLayerLog_Ioctlschedule_timeoutVOU_GraphicsSetRegUpHIFB_DRV_IsVcmpBusymsecs_to_jiffiesHIFB_PROC_RemoveAllModuleVOU_GraphicsGetGfxPreMultVcmpCloseVOU_GraphicsSetColorKeyMaskHIFB_CloseLayerVOU_GraphicsSetDcmpInforemap_mmbVcmpStartkmem_cache_alloctde_get_procentryfb_dealloc_cmapHIFB_DRV_WaitRegUpdateFinishedVOU_GraphicsSetGfxKeyEnHIFB_DRV_GetOSDDataTdeOsiBlithifb_write_proc__aeabi_idivVOU_GraphicsGetLayerDataFmtHIFB_DRV_SetLayerAlphahifb_buf_freememVOU_GraphicsSetGfxExtVOU_GraphicsGetDevStatusstrstrVOU_GraphicsSetLayerOutRectHIFB_DRV_SetColorRegHIFB_DRV_EnableLayerVOU_GraphicsSetGfxPreMultIS_AD_LAYERstrncmpIS_SD_LAYERnew_mmbVOU_GraphicsCloseLayerstrncpyregister_framebufferVOU_GraphicsEnableLayerIS_CURSOR_LAYERpanicfb_alloc_cmapprintkLog_PrintHelpInfoHIFB_DRV_SetClutAddrHIFB_DRV_SetTdeCallBack_ctypeHIFB_DRV_OpenD<+: isplayLog_PrintLayerInfoVOU_GraphicsSetLayerInRectVOU_GraphicsGetLayerGalphaTdeOsiBeginJobVOU_GraphicsGetIntfSizememsetHIFB_DRV_GetOps__memzeroHIFB_DRV_UpdataLayerRegparam_ops_charp__aeabi_uidivHI_LOGHIFB_PROC_CleanupHIFB_DRV_SetLayerAddr__init_waitqueue_headVOU_GraphicsSetLayerDataFmtstrcmpHIFB_DRV_Inithifb_checkmem_enoughIS_HD_LAYERseq_readsprintfVOU_GraphicsSetCscCoefVOU_GraphicsSetGfxStrideVOU_GraphicsSetCscEnHIFB_DRV_GammaEnableHIFB_DRV_LayerDefaultSettingHIGO_Log_InitHIFB_PROC_AddModuleremove_proc_entryVOU_GraphicsGetGfxAddrHIFB_DRV_ConvFmtseq_printf__aeabi_uidivmodsimple_strtoulhifb_alloc_vcmpbufvideosingle_releasefb_pan_displayVOU_GraphicsGetGfxStrideTdeOsiEnableRegionDeflickerautoremove_wake_functionapszLayerMmzNamesVOU_GraphicsSetGfxDcmpEnableframebuffer_releaseVOU_GraphicsGetDevMode__copy_to_userHIFB_DRV_SetLayerStridesingle_opens_astHifbGfxCapHIFB_DRV_SetDcmpInfoVOU_GraphicsSetVoCallbackHIFB_DRV_CloseDisplayHIFB_DRV_SetLayerDeFlickerhifb_buf_map__copy_from_userhifb_buf_allocmemHIFB_DRV_GetLayerStrideAlignHIFB_DRV_Blithifb_buf_ummapHIFB_DRV_SetLayerRectkmalloc_cachesLog_WriteVcmpIsBusyHIFB_DRV_StartVcmp0+ 4, H+ L, `~+ , + , +-,-Xl|+,+,+-,-+ , 8+ , + ,,<+@,DP+,+,(4Xpp+ t, p+ , + , +, + , l +p ,|  + ,  ~ + ,  + ,  +$ ,0 < +@ ,D \ +` ,l  + ,  + ,( < +!@ ,!H ` +d ,p  +" ,"  + ,  +# ,#  + ,  +$4 ,$H +<,:L ,X x +%| ,%  + ,  +& ,&  + , $ +'( ,'4 L +P ,\ p +(t ,(|  + ,    +- ,-H<+,+,,, 0+4,HT+-X,-\t+x,+.,.+,+-,-+ , +,+2,2+-,-d+h,tx+6,6+,+7,7+-,-8+ <, HDXt+x,+-,-+,+-,-+-,-L+P,\l+,p,,t+,+>,>+, +?,? 8+<,HT+-X,-\h|+-,-+,1 I %@%X+\,ht+Cx,C|%+-,-!!#D#+H#,T#\#+Gd#,Gh#$$+($,4$<$+HD$,HH$d$$~$p$+ $, $+ $, $+ $, D%x%%3%D&L&+-P&,- (+L(,L0(+M4(,Mp((+(,((+N(,N( )j8)3D)p)+),))+O),O))h)3*+*, *,*+P0*,P4*D*p\*3p*+t*,**+Q*,Q**+*,**+R*,R******** ++-+,-+=++ +, -]$-].+ ., .+.,..+U.,U./<-: //0]0]<2+ @2, P2x22=22+-2,-3+3,43D3+YH3,YP337l44+-4,-4+\4,\4i4+4,44+]5,]5$545+^<5,^D5iP5+_X5,_`5ix5+|5,55+`5,`55+5,5p5+ 5, ,6p86+ <6, T6+X6,l6x6+a6,a66+6,6+b6,b6s6+c6,c6s6+d6,d6s6+e7,e7s7+f 7,f7s7+g7,g7s 7+h$7,h(7s47H7+ L7, 7+k7,k7+l7,l7+m7,m78+n 8,n8+o88,o(8+p,8,p88H8+qL8,qP8`8+rd8,rh8x8+s|8,s88+t8,t88+u8,u8+ 88+v8,v8, 88+w8+x8,w8,x9+y9,y9(9+z,9,z89D9+{L9,{X9d9+|l9,|x99+}9,}99+~9,~99+9,99+9,99+9,9:+ :,:(:+,:,8:D:+H:,L:X:+\:,`:l:+p:,t::+:,::+:,::+:,::+:,::+:,::+;,;;+;,;,;+4;,@;P;+X;,h;x;+|;,;;+;,;;+;,;;+;,;;+;,;;+;,;,<+0<,4<@<+D<,H<T<+X<,d<p<+t<,x<<+<,<<+<,<<+<,<<<+o<+m<,o<,m=+ =, =+l=,l=+ (=+,=,0=, 4=@=+D=,T=`=+d=,h=x=+|=,==+z=,z<.: ==+=,==+|=,|==+}=,}=>+~>,~>>+>,(>4>+8>,<>H>+P>,T>>p>+ >, >&>9?k8?+y̱+Ա,ر+,+#,#+f,f+,+,+, +_(,_,+A4,A8+@,D+BL,BP+?X,?\+d,h+p,t+X|,X+,+e,e+,+u,u+Z,Z+xIJ,xȲ+в,Բ+ܲ,+Q,Q+,+,+K+ ,K,+$,$<+@,Lb`T<+@,|R+,Ĵ+ȴ,Դl+,G+,<}T+X,dp+t,xȵT+X,h+,gܶ{^ +$,0<+@,D\+`,lx+|,FO!ķ+,+, + ,,JX+\,x5̸P Y$+(,`zdĹ+ȹ,Թع+,+ ,4+8,DP+T,Xpg|+,+48N\+`,lx+|,++,Ļ,л+Ի,ܻq+,$+(,4;\+d,5a4ȼ+м<40:ܼ+,o +$,D+H,h+l,+,s+,s+,s+Ľ,Ƚsн+Խ,ؽs+,s+,s+, s(+,,0s8+<,@sL+T,`sh+l,psx+|,s~+ ,Կ+ؿ,X\`dh|4[d+h,|U+,C+,U$+(,,sC,+0,4sDT+X,\sdl+p,ts+,s7 + , 6v<M@+ DH, T+ , + , (0+4,@D+ H, L+P,T+ \+-`, d,-x+|,+ , +,c+,+,+w,wH+L,X`+h,l+,+, p,+0,<H+P,T p|+,c+,+ , +,+,+, +, 0+4,@L+P,TXl<+,+,+,+ ,$,D3T3`jx33h33p33 (+,,8H+P,`t+,+,r +$,04+<,DLnd+h,t|+,+,+,+,+/+\,/,\<5%: ,+ 0, P+ T, t+x,+,+X,Xv3~+, + , ( + 0 , 8 T MX \ +` ,d st x -|                                                     $ ( , 0 4 8 < @     $ ( , 0 4 8 < @ (,  $,04<@D0L K $(,4Plp8txe2m  D.<6 :mkimg.rootfs9Y'X8Y==%#!/bin/sh #$1: rootfs dir #$2: output dir #$3: name #$4..: types rootfs_dir=$1 rootfs_image_prepath=$2/$3 while [ -n "$4" ] do case "$4" in "jffs2") echo "making filesystem image jffs2 ..." mkfs.jffs2 -e 0x20000 -d $rootfs_dir -o $rootfs_image_prepath.jffs2 echo "making filesystem image jffs2 for nand ..." mkfs.jffs2 -e 0x20000 -n -d $rootfs_dir -o $rootfs_image_prepath.nand.jffs2 ;; "cramfs") echo "making filesystem image cramfs ..." mkfs.cramfs $rootfs_dir $rootfs_image_prepath.cramfs ;; "yaffs2") echo "making filesystem image yaffs2 ..." mkfs.yaffs2 $rootfs_dir $rootfs_image_prepath.yaffs2 >/dev/null chmod a+r $rootfs_image_prepath.yaffs2 ;; "cramfs-initrd") echo "making filesystem image cramfs-initrd ..." mkfs.cramfs $rootfs_dir $rootfs_image_prepath.temp mkimage -A arm -T ramdisk -C none -a 0 -e 0 -n "initrd in cramfs" -d $rootfs_image_prepath.temp $rootfs_image_prepath.cramfs.initrd rm $rootfs_dir $rootfs_image_prepath.temp -f ;; "cramfs-initrd-img") echo "making filesystem image cramfs-initrd ..." mkfs.cramfs $rootfs_dir $rootfs_image_prepath.temp mkimage -A arm -T ramdisk -C none -a 0xe1100000 -e 0xe1100000 -n "initrd in cramfs" -d $rootfs_image_prepath.temp $rootfs_image_prepath.cramfs.initrd.img rm $rootfs_dir $rootfs_image_prepath.temp -f esac shift done ==)^binA9Y9Y9Y>&>pppoe-stop9Y'X8YO ?3#!/bin/sh # ../scripts/pppoe-stop. Generated from pppoe-stop.in by configure. #*********************************************************************** # # pppoe-stop # # Shell script to bring down a PPPoE connection # # Copyright (C) 2000 Roaring Penguin Software Inc. # # $Id: pppoe-stop.in,v 1.2 2005/08/10 00:25:19 dfs Exp $ # # This file may be distributed under the terms of the GNU General # Public License. # # LIC: GPL # # Usage: pppoe-stop [config_file] # If config_file is omitted, defaults to /etc/ppp/pppoe.conf # #*********************************************************************** # Set to "C" locale so we can parse messages from commands LANG=C export LANG ME="`basename $0`" LOGGER="/usr/bin/logger -t $ME" CONFIG="$1" if [ "$CONFIG" = "" ] ; then CONFIG=/etc/ppp/pppoe.conf fi rm -f /tmp/pppoe_startup rm -f /tmp/pppoe_fail if [ ! -f "$CONFIG" -o ! -r "$CONFIG" ] ; then echo "$ME: Cannot read configuration file '$CONFIG'" >& 2 exit 1 fi export CONFIG . $CONFIG PPPOE_PIDFILE="$PIDFILE.pppoe" PPPD_PIDFILE="$PIDFILE.pppd" STARTPID="$PIDFILE.start" # Backward config file compatibility if test "$DEMAND" = "" ; then DEMAND=no fi # Ignore SIGTERM trap "" 15 # Check for pidfile if [ -r "$PIDFILE" ] ; then PID=`cat $PIDFILE` # Check if still running kill -0 $PID > /dev/null 2>&1 if [ $? != 0 ] ; then echo "$ME: The pppoe-connect script (PID $PID) appears to have died" >& 2 fi # Kill pppoe-connect $LOGGER -p daemon.notice "Killing pppoe-connect" echo "Killing pppoe-connect ($PID)" kill $PID > /dev/null 2>&1 # Kill pppoe-start PIDS=`cat $STARTPID` kill -0 $PIDS > /dev/null 2>&1 if [ $? = 0 ] ; then $LOGGER -p daemon.notice "Killing pppoe-connect" kill $PIDS > /dev/null 2>&1 fi killall pppoe # Kill pppd, which should in turn kill pppoe if [ -r "$PPPD_PIDFILE" ] ; then PPPD_PID=`cat "$PPPD_PIDFILE"` $LOGGER -p daemon.notice "Killing pppd" echo "Killing pppd ($PPPD_PID)" kill $PPPD_PID > /dev/null 2>&1 || exit 1 f?<:i # Kill pppd again, in case it's still hanging around if [ -r "$PPPD_PIDFILE" ] ; then PPPD_PID=`cat "$PPPD_PIDFILE"` kill $PPPD_PID > /dev/null 2>&1 || exit 1 fi rm -f "$PIDFILE" "$PPPD_PIDFILE" "$PPPOE_PIDFILE" "$STARTPID" else echo "$ME: No PPPoE connection appears to be running" >&2 exit 1 fi exit 0 ?O: >ionice9Y8Y8Ybusybox@>mktemp9Y8Y8YbusyboxA >pppoe-start9Y'X8YB#!/bin/sh # ../scripts/pppoe-start. Generated from pppoe-start.in by configure. #*********************************************************************** # # pppoe-start # # Shell script to bring up a PPPoE connection # # Copyright (C) 2000 Roaring Penguin Software Inc. # # $Id: pppoe-start.in,v 1.2 2005/08/10 00:25:19 dfs Exp $ # # This file may be distributed under the terms of the GNU General # Public License. # # LIC: GPL # # Usage: pppoe-start [config_file] # pppoe-start interface user [config_file] # Second form overrides USER and ETH from config file. # If config_file is omitted, defaults to /etc/ppp/pppoe.conf # #*********************************************************************** # From AUTOCONF prefix= exec_prefix=${prefix} # Paths to programs CONNECT=${exec_prefix}/bin/pppoe-connect ECHO=/bin/echo IFCONFIG=/sbin/ifconfig # Set to "C" locale so we can parse messages from commands LANG=C export LANG # Defaults CONFIG=/etc/ppp/pppoe.conf USER="" ETH="" ME=`basename $0` # Must be root #if [ "`/usr/bin/id -u`" != 0 ] ; then # $ECHO "$ME: You must be root to run this script" >& 2 # exit 1 #fi # Debugging if [ "$DEBUG" = "1" ] ; then $ECHO "*** Running in debug mode... please be patient..." DEBUG=/tmp/pppoe-debug-$$ export DEBUG mkdir $DEBUG if [ "$?" != 0 ] ; then $ECHO "Could not create directory $DEBUG... exiting" exit 1 fi DEBUG=$DEBUG/pppoe-debug.txt # Initial debug output $ECHO "---------------------------------------------" > $DEBUG $ECHO "* The following section contains information about your system" >> $DEBUG date >> $DEBUG $ECHO "Output of uname -a" >> $DEBUG uname -a >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG $ECHO "* The following section contains information about your network" >> $DEBUG $ECHO "* interfaces. The one you chose for PPPoE should contain the words:" >> $DEBUG $ECHO "* 'UP' and 'RUNNING'. If it does not, you probably have an Ethernet" >> $DEBUG $ECHO "* driB:ver problem." >> $DEBUG $ECHO "Output of ifconfig -a" >> $DEBUG $IFCONFIG -a >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG if [ "`uname -s`" = "Linux" ] ; then $ECHO "* The following section contains information about kernel modules" >> $DEBUG $ECHO "* If the module for your Ethernet card is 'tulip', you might" >> $DEBUG $ECHO "* want to look for an updated version at http://www.scyld.com" >> $DEBUG $ECHO "Output of lsmod" >> $DEBUG lsmod >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG fi $ECHO "* The following section lists your routing table." >> $DEBUG $ECHO "* If you have an entry which starts with '0.0.0.0', you probably" >> $DEBUG $ECHO "* have defined a default route and gateway, and pppd will" >> $DEBUG $ECHO "* not create a default route using your ISP. Try getting" >> $DEBUG $ECHO "* rid of this route." >> $DEBUG $ECHO "Output of netstat -n -r" >> $DEBUG netstat -n -r >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG $ECHO "Contents of /etc/resolv.conf" >> $DEBUG $ECHO "* The following section lists DNS setup." >> $DEBUG $ECHO "* If you can browse by IP address, but not name, suspect" >> $DEBUG $ECHO "* a DNS problem." >> $DEBUG cat /etc/resolv.conf >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG $ECHO "* The following section lists /etc/ppp/options." >> $DEBUG $ECHO "* You should have NOTHING in that file." >> $DEBUG $ECHO "Contents of /etc/ppp/options" >> $DEBUG cat /etc/ppp/options >> $DEBUG 2>/dev/null $ECHO "---------------------------------------------" >> $DEBUG else DEBUG="" fi # Sort out command-line arguments case "$#" in 1) CONFIG="$1" ;; 3) CONFIG="$3" ;; esac if [ ! -f "$CONFIG" -o ! -r "$CONFIG" ] ; then $ECHO "$ME: Cannot read configuration file '$CONFIG'" >& 2 exit 1 fi export CONFIG . $CONFIG # Check for command-line overriding of ETH and USER case "B:$#" in 2|3) ETH="$1" USER="$2" ;; esac # Check for pidfile if [ -r "$PIDFILE" ] ; then PID=`cat "$PIDFILE"` # Check if still running kill -0 $PID > /dev/null 2>&1 if [ $? = 0 ] ; then $ECHO "$ME: There already seems to be a PPPoE connection up (PID $PID)" >& 2 exit 1 fi # Delete bogus PIDFILE rm -f "$PIDFILE" "$PIDFILE.pppd" "$PIDFILE.pppoe" "$PIDFILE.start" fi echo $$ > $PIDFILE.start # Start the connection in the background unless we're debugging if [ "$DEBUG" != "" ] ; then $CONNECT "$@" $ECHO "1111Start the connection fail" exit 0 fi rm -f /tmp/pppoe_startup sh -x $CONNECT "$@" > /tmp/connect_log 2>&1 & CONNECT_PID=$! if [ "$CONNECT_TIMEOUT" = "" -o "$CONNECT_TIMEOUT" = 0 ] ; then $ECHO "Start the connection fail" exit 0 fi # Don't monitor connection if dial-on-demand if [ "$DEMAND" != "" -a "$DEMAND" != "no" ] ; then $ECHO "Start the connection fail" exit 0 fi # Monitor connection TIME=0 while [ true ] ; do ${exec_prefix}/bin/pppoe-status $CONFIG > /dev/null 2>&1 # Looks like the interface came up if [ $? = 0 ] ; then # Print newline if standard input is a TTY tty -s && $ECHO " Connected!" touch /tmp/pppoe_startup /etc/ppp/ip-up exit 0 fi if test -n "$FORCEPING" ; then printf "%s" "$FORCEPING" else tty -s && printf "%s" "$PING" fi sleep $CONNECT_POLL TIME=`expr $TIME + $CONNECT_POLL` if [ $TIME -gt $CONNECT_TIMEOUT ] ; then break fi done $ECHO "TIMED OUT" >& 2 # Timed out! Kill the pppoe-connect process and quit kill $CONNECT_PID > /dev/null 2>&1 # Clean up PIDFILE(s) rm -f "$PIDFILE" "$PIDFILE.pppd" "$PIDFILE.pppoe" "$PIDFILE.start" /etc/ppp/ip-down exit 1 B?:>mount9Y8Y8YbusyboxC>ftp9Y9Y9Y3DELF(|4 04 (444$$   H    Qtd/lib/ld-uClibc.so.0av6N>EZ%hWnR&Yc[1@eqX"SGkVI/Fb<o_\0mi3-Q(? tjspBlCuJ^r f4d 5MO)P,g  '7:;A$T8.29=H`]+DK#* aUL!'̒3ؒH, d ,JL,8IDP\hty]ȓԓ:H,bb:(4@L"Xdp|2V6ĔWДܔHP,T,D:|P  $.0z<<HT`Alx/~ؕ̕.H,7T Cp ,8mDtP\HhtiX,F'H, \,\[ȖԖT*"N(41@LXidpmemcpymallocabortraisefreelibc.so.0strlenvfprintfstrncasecmpmkstempclosedirsetsockoptfflushstderrshutdownputsstrdupfgetcfopenfgetsforkacceptbindgetlogin__errno_locationopendirinet_aton__fgetc_unlockedgetpwnammemmovereaddirgetenvreadstrerroraccesssleepherrorputcharstrncatinet_ntoafdopengetservbynamestrcatisattysnprintfgetcwdgethostbynamefeofchmodlseekexitselectconnectsenddirfdsscanfrindexwaitstrchrfstatstrcasecmp__uClibc_mainferrorgetpasssignalfputcgetpidperrorlistenpopen__sigsetjmpstrncmpchdirunlinkstrcmp__ctype_bfilenorewindsocket__fputc_unlockedstrncpyexeclstrcpygettimeofdaygmtimefseekgetpwuidumaskfclosegetsockname__data_startgethostnamestrrchrgetuidpclose__stdinatoiatol__stdoutfwritesiglongjmp_edata__bss_start__bss_start____bss_end____end___endH,L, P,5T,6X,]\,d      !! ! ! ! !!! !$!(!,!0!4!D :8!!?!@!A!B!C!D!E!F!G!H!I!J!K!L!N!O"P"R"S "T"U"V"W"X "Y$"Z("[,"\0"^4"_8"`<"a@"bD"fH"gL"hP"iT"jX"k\"l`"md"oh"pl"qp"rt"sx"t|"u -L-,Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ Əʌ  --- 0|$wLOGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 RD:   /`, @-0S0S3/ l% - @ppWpW pp0Q0W0S@T* Zh<P@0@ZY T  T `\QP@@@T h  @/`Qh<0@@-0G @@ x@ @@r3\S :0@ @-xH@@ x@ @@r3\> :0@ @-E @@ x@ @@r3\) :0@ @-J@@ x@ @@r3\ :0@ @-J@@ x@ @<@r3\ :0@ @-hG @@ x@ @P@r3\ :0@ @-,G @@ x@ @`@r3\ :0@ @-H@@ x@ @x@r3\ :0@ @-dG @@ x@ @@r3\ :0@ @-D @@ x@ @@r3\ :0@ @-lH@@ x@ @@r3\ :0@ p @-@@v: 0@ 8 @-@@k: 0@   @-@@`: 0@ @)89 @0@PH @8@-dG @@X)P @P@0P 0 P88@-dG @@p)` @P@0P 0P88@-dG @@)| @P@0P 0P8G-`w p@P@@dg X0`@P@Td(  @ 20@Q! R PT @P * @^ @P@ @G0E-tM*@`0 @0 00000 0$0Q 0S $S \S S p al h @D:`l0`@FS- L[S@P \S $Sc 00S [S0$S  S,SB ]S \S $S 00 S,SBS A0 S ]S \S 0 S @tЍ 0Q 10Ap1l\ Hp$ W 0 g W Q 0 W 0 Wl   0R 10Bp1l R Hp$ R 0Z Q 0Q 0Z bn0Sh00Ÿ0VP @p f 0W10Gpp1n lpWT Hp$ Wn 0g W   \ 0 W 0  W  bQ0SS  p1@pPU 0 S `ppQ lpQ SpP$lPHQ 0S 00S00,S ]S R 0S  00S0S  00Sph< @-@GP @0}Sd'  @Q @@7 @8@-H dG 0@@@P0*P P8@}P$ @{L @@-` H@@@0 0s03R0 Sx@T @:@Q p  @0D @@V0S  @@-`H @@0p03S0 ( @Q @ @:0@P @D @@.\x@8@-@@P 0|S /S 8!PP D  @/P @ @L8 @@: 0@ h 8@-@P0S8'@` @ R T PU A$D: 8 @TPP2$P@-Pp t8J0@@@`@ `(U` lE @@ `l @`tH@@ @ :0@ P@- @@d3 0@ +@  @@`p@-H@@M0S ' H  @@Sx@P p  *87 @@ @0@@dG A,g lh @@@`@@ Q xL0P@@@ \``QS00R  @`"% x @@ `@\V   :@0@8  @QR  t@`VO T l% @ @@p:0@PU? | h( @ @@`H @@@Q `xLP@@@ ^V  @ @\g @`@Q R @0S ڬU @P@ @@ Rʔ@Ѝp @p @\ @x@PTPU @IG l @@@x @-@0S @0S  @  @0hLPA-M2pP@ `Hpdw ` Vp X `Fj ` Vp `F` ` `F pX ` Vp  @ Ѝ @j@-X<0@ @08@-H@@0S8 \U @P@P x @@ Q 8\7 0@8@-H@@0SZPRP p@-B@@`PU(PU% PU R P @Pp @4 `' @ @p @Pp @: 0@ p0 @8 @@ @P@-D: @H B@@@ R @T @ \@R` @: 0@ d @@@G-M@ p~T P5 `uT, ` k`D|T P Z   `[nT Re ` I\T @P ڍ>P:P ,7 @-0@M 0Sڍ  @@)HOO@oT @ <P *nPNPP@-@ MP P p`00q`p0@@P@nU PPP= 0@ Ѝ @  @ Pp @P |Q P @P  @ "@-4MPJpF`_@P 6T:7 @4Ѝ.+t @:0@@  @@P+ /P% p`-00@(P +d(  @QU - @0jZP@@h@@pM4@@ XH|p@Yx}O-M M@`P/R  /R  Vw .R  /#P` 0 S /S ?S*S .SQ0 S O@ P> PF @*@ 0|S0 /PSP+/S!p p'P @0/S0/S .S /@P PL@ OPVD:0S/@PpWp@g Ѝڍ  @@$ @P  @@7 O-0@,M@P`V h @0S,`, @1h @Q `l`@qW& `L @@PP  !0Pg ,Ѝ`<0@P@@AP`\P@P a@?#0&* ZYd `(  @@0U 0pp/p0 S7 >P  0@@PP@U0T 0  @`\PP@& qx @pw3Hx@~3AP@@ Q{@v@qP0@-MM4 P @: 0@ Ѝڍ0@P 7P P @ 8 @  @ X @P0 @@DC @@ "R ??@, 0@" P@-#@ P$dH @@R px@@l@o :0@Rp @@0dH @@ p 3P@U: 0@ @- DHG @@@0S |* @PPTPvXl,W P@`@p@PpFpc]E-G @@ MpP+P`(@PT @ 0 e0*P P PE7  0@ R T"00\ Ѝ@$$G-M0M_oP0_OoOp@ \\ejO0P P`:0 0Q X@ * @P+ 0P L, @D: 0^ 0*O0S0 L  @ 0 00S0t@^|p* @0SmO00W%ds p@ Ru P$0@P/0Ѝڍ/ @BP*0O@^: 0@ GWe PZd dw @p@X0 O0@ P[ \ @b  200Pu \Nʼ/ @P??O 0A<//O00f?ʍ0?OwPUP@ ^F? ?O0 0ds p@oP=ʍO0, ds 0p@ bʍ$ʍ ʍ\ ʍ*:@, (0@ tX ʍ,0v. \ S!  0p0ds p@6@<::_0_OXL@@P@0 @ &:( Q  0p0ds p@ $R* 0\ ^ ? ?O0 0ds p@=@- 0@@P, @@cd# @- @\00@@@ T 0@l\0 0@hP0@-4M<d dG @@@PP  @ P \ @dP4Ѝ0 @P$ \ , (0@@ 0,@(  $0 `  @Pl@: 0@ P- M@ Ѝ`  @ Pl@: 0@ O-\G @@ M0S/ P ,W P@Q0U P@ ` _0Sq!`x `C` `PZV P|D : p@ H [ 0S*0{ [ ` VA X. H[ 0S*0{ [ ` V-0S~*0{ [g `H[K 0 Sq*0{ [I ` V H RQ{@@:0@P|p@0H R&  RI* P p`@w: 0@ Ѝlg `@ `0H\;  R:* P 0H R{ { [0\'  @ \i XHPm 0\'  @  P[ VFP_ a_\U@$({ { [M0\'  @  P2 VFP6 ?{w { [J0\'  @ ^ VFP <#  @ P@  @ l0@`0dJ@@]@UlP@- MC P0ڌxpJ*0@@ @p@xj0 `@0GP@UZ`P@`/o P hX P@/ Ѝ Q  @&@! @ >P@^@pJ@@@| :0@ P0@-M Bdpm ^v  \- P :0@Ѝ0 @@{  \0 0SB A3/( @0S4 @c @3H, @P!  @P@: 0@ @PU@H, @28 o@00P 0/P 0|@\: 0@ P- M@ P Ѝ@}Pd7 0@ R@ " @  P@,: 0@ @NP- M@ P Ѝ@}Pd7 0@ RH@ " @ P@: 0@ @P@-XM0:0CS@ P 0PSP/ XЍ\@  @ H@0 @Q2@ PP  @| 0P# @ 0 @ n @@H@T<P0@  0 @0@@ 00PO-,M0S@C@!  >Pa0]XL@@P@@g  `@@lP>P$PDg `@ R Qڈ~@|, @p@@@@PT00$ !0 S R7 0@ ,Ѝ0 P 0  R0 @PL^ 0|Q 8 \  @P @/ @P 0v@: 0@ @# @P 0\P- M0!S @ P Ѝ$ @ P@: 0@ D : (@} # @ P 0PO-M RXLw @@Pp@` @Pn DW Ht|, ㈿PP@p@@@@@`@P 0S 0@P'  @@ЍQ *P - R0S  @P @#  @!P0@A: 0@ P- MH@ Ѝ/ @ PX@#: 0@ P- M@ P Ѝ@}Pd7 0@ R@ p$ @ P@: 0@ @O-M4M?OʍP0 ?OOO#0O@Xl `@@P  @P.YF(ش@_xj:O0_O`@@ @*0@$@P 0S'  @0*0@@P/ @@4Ѝڍ @0S 0 VP @Xst@Qp@0S/Y  / p 0.R p pY S 0\.S /S00$ pY \.R0p S.RjpY00CP T $=@ 0@  @Qv|@0Sq ,  @@@@ P  @0, @@\Q L, @00가0^ 0 0 灐 Ⰰ Qt@Qg Dp@0Sd `/R  S1Rxw/R  ?\-R0r 0p/RP O^ #0 @D : P00@ :0@ !JJ? 0!J0J>\  S-,G @@R, @ r3@ y!00J$0J 0O-M$M?OʍP ?OOO _ _OXL7 @@0@P  @P.Dx@P) OOW ztLl OOP@p@@`@ ʍ P 0SFʍ0 P7 0@$Ѝڍ??O  Rw tpOp@@@P@ RaO @P^h @P  5` @P Z v \ *  0P Q& 0SIp@PL <@45@0@\ R 0 Y|@ R ,7 0@D@@tP ,'  @m: eP P 0 Q5 0@4<@@\RU 0p Rw| @Qr , @D`@@6P 00, @`_7 0@?ZU Qn ` f<4%|:@@ @0@  0 R`QW 0S VR QO R;QI 0S  P Q ^ 0PR 0 R0P ,'  @D@@P ,7 0@ 0P Q \ 0PR 0 R^ ,7  0@D@@ P , @ %  @P\ @ :D  :0@Q  0 0R  0    Q0 S p @P      04P$ QF \R @P0RM 0H R0\ ,  @D @@P 0, @c   @W ?,7 0@0|03, @0q03_{ , @0~03,7 0@0|03.7 , @0~03ʍ +PA-M7 P;`P* 0Rf TS pPG PaUD <@4P@@U PPV t@0SCp@\7 0Q, 0 Ѝ0  `0P/ @  @P Pʼ/  @PL@@ pUP@0X0p 0 p : 0@ p@-H@@M0S^Pd@QNhP`@Y`PspP\ Ď|PD 8P@ @P}4 `7 0@@8 P@ P@ql  @P@ @h|8p 0@P@ @_t @@ @PVX 8@0@ R 0@#  @ Ѝp7 x0@@q`% @  @ 0@PO-M1\7 0@Xe `@@ pH PP# @T Z  PxP @T @Q mP @TQ bP @a @ 0 ` Ll `@ @D:Tb 0僀p  0pP SW P@ $Sj \Sc 0p0SZ0@Sp0PPpP P ^ @P d @^k 0Sc 3/l( @\ 0S \ @H^~ 0 S}*  0 @V0S @T^ YЍiRY9p0@p0 p 0@Ap0 0@Aἀ B\0/A0$0Pu0S- 3/ @40 @ 0P\\ @!: 0@ @@P@1/h@T e Q`@ @: 0@  @P @>0@ /-0M  0 ЍO-n4Mp0`@@0.W x:0@ RPDCx:0@Q (S@p倘w @p@Q ? ТT TDDXu p@4 @` @ 娥 @㠕 @x@蘊@\ @t@刀,<B-40 (0$ 0  @d0,l0dl0p0pphp0hp0ttxpx0p0|p|倀p00pp,0 p@l  @(( l @p:0@/@$ppp$ p@ph /@ w 0@Bh p0@ ^ >0@R  2/4ЍJL d A-@@MPQ- `D: 0Xc*J`p4 .1D 0"`P70 P?C @ Ѝ=)@ G-/P@P^ o/00X_AgyX. P 41`P9V@`p% `SP`v`$0V$ @YpdW7 9VP` ~`=P0V PP 9V@`p-P0`0T.S D0`0U.S 00EPD @( @= X @@ 0 @wO-Q$`0 0`X @H0S1  R2* AR?ttSL 0 SR*0\ P @@ 0Y0S5UMTK7 G$ `0_ ?H0@H0S( 0 @"0P0d'  @Q X @H@<Ѝs4K00 D?:c1U  5 0@ 47(\P . @^ 4 ,0RR0ES5U1\@H0S  }$ !f2/0E[A-0M @ 0SXU `P@yqs0ကn  pPЍXWH @|: 0@ .@- BH@> ' 0@dN @@C@dNt. @  @-@@WH<0@tb0. @  @-@@DH<0@aO@@- H, @V >0@@0 Q @:07 @-0@$M Pp WJ@@ Q`P 0# `^P $Ѝ@y @ @E-BM M`P! \U 0 @@P@ 0P 0 @8 @Z0P 0SXe `@B͍rq0ဠT` B}렢0 q ကV: P'T B]r1Pl UR Pe*PSP OЍڍ@PE @dP @@`0 @Z-d @ 0@-^ MP@S `/\E @@0SE @$p /  0@@W5 0@@@p3 @RW+ Ѝ@Ѝ/D $p@L @ pP HL @@ \E @@(0S` @@@7/T HL@@@@-$@M@@0 0P& @4 @00^D*: %  @Q$ @\ 00` @ R  @iP  @Ѝx<%@4 @@Q@0S* `7 0@\ Z  @@?P PPB @@@` `)P`~  @|* @> 0@$@0P\ xJ@@P E @@^~ kx:E 0@@@p3}\ ^x:0@~3r @\$ 0@P0SXU P@b0ap |p AQix @0SZA.  @dQ @oIx* @Q .) @@P`N @@0 0+K  @0[PU @ zP Q PUz @ hP Rp mUP  @d^  @ `0 @ 07 O-0@ (d0@oO (PO| @ pLČ@,l\ Dx ̆Tdd'Č`J(@@P)80 # 00PPP @ @Z } @Z00rPp @ @g` @~b @v] @qXJ@@ TO-M$@ +0 p30S d7 0@Q^ P  -R  @ R  @x@Q 0S*0 @000P$ P0`P' U P@@T @QJ@@P00^ r:0@Ѝ0\008P@_@P  |P PNx@ R 9P Q 4' `  @@Q -P P0S @QP0S  @ _P@Q @TP |P <@T @{PHP:H0> 0@+R*;S HN P@@P  Hx` @0S j@CTgN @@[U0d N `` > \|H㔘@@@@p@ @@#``6+PPڤ/ U`0S  R^ PUQ  T \ʀ [P0^`7 0@\M J (XP@@0 @Vn@X @@P0 @ApP  SP @ RB @* @T D<:^ 1/\ mJ@@P00P @x p0#P0PL*0 0RH^qH, @@@:0@/Pm@P P00UJ 0Z/ PlxXP@^  PP_Q 0 S$ @Pbd&x`8 0@@T$ P! \ \L@@H^ 0S*#0\, @H0S 0S* @@0H@]@P 0S H @H, @M^P @ T d @zP X @@P0 @S\ 03/e R  _p@:0@Qڐ^  @0x N @@\`H \|Hl@@p@`@HQf 0S*0 X XH0 @@#PX# 0\H*P0 0R 0Q^ HXh 0R^ X\D0H\1 0 S3*0 X^HP 0 S*0儀 gPHP 0 S*  0X x X  } E g0Q   R` @@T# \ ڄ  R \<0@H^ 0S*#@@0\, @H\ 0S* 0H@2H@@0S \UkVVXLl @@ @D@P: 0 q M @0S  D&: @< /P[@  P"* P@ TU0H R~pX<@0@P0@ Q n\  0Q~PD H0S 0 S* 00P.J  D`8 0@^$ *\ ڈ P \@H R 0 S*#0\, @H0S 0S* 0H@A80@PLUkT5 \  @ 0*0*X@@0 @Hʍ > 0@ R 1/\00@ 0~ ʍ Pv : +D0: ^lʍ6: 2H @H, @X@@0 @ H @H@PX@P0 @ x au [#X##Y#OV@E-dM@`X T0@!PT@X@ P\`T@ pVK`Pl   @AO [@P r G` aLPVV\` @Pm 0PSTQ @x @Qp\ @pWkڬe D `@@G@P PU^X D @@P PUR@P UM@QD @P!@PD @ L  @@P8P `\p0P @ `VO @P X( @@0 dЍXQ! @P @0 @T0x0: 0@ X@@0 8 @XO-n `@P$MtQ^xQ@|QQ;P ~ p@]?NG,ZG ]@@ @P~ p@XHv!@㲀@,Uk Qg [ px ` @ tp 00gpx  @S z@Pg 8P PP"PP 0P# PPP@XU P@@\e `@\u Ps d7 0@Q@PB 0 # xPA   @ @$ЍPP7 ]OR ~ p@4NG,j0:GV @:0@ H @P ~P zd( D%:  @P  @XT @@ p @  @{ @X,  @@0 P N 5 0@0 S Pp {P@0 //@-@PPG-p @ pH W*@@X P`&P`P@Xp W@: A-@TPQp4 P0@P U`V`5 % 0@ @ pe``8P5ZPP `FQ @O-pD @@MPp~Qb `%  @` @@0 0RG RU*/Q  FLU*0/S /R xL/P HLU:/Q {^ 0S P @U PP Z 4P  PZ  ` & @ @ =Q1 \: 0W Wv*``` @@`AAa Ay0rSY00_Q0 Ar  R-Qb P\:` pT P@^@ @+pЍXaP@ @$0$p @P+ ^ ` .\0.S(y(`P( $${^dJ 0Sx D @`` % @ @ `/QQp @X& 0P   Z:` @@   0P Q0 4;0@O-M0M{Sx `00{S0Ss @ }S? [S4 0S {S0 Sp pP@ 00UW- a V  -YC D%: LPFFWPU0{S1 ,S [S P]PP ]PP R  BЍڍ}S SW PW pGP0P]SS 0S]SS PpP Y `@E-pT 0P@`\M 0 0@?S [SJ {SD S \Ѝ*S. /S Sp3\ 0`?S @PP` ` u @p@(00p Q. S*0SB /SH P;`Q0S* ]S@ -S PQ0PSp$  @:`u % p@ @  Ppt p@0  P `\/@Q@ @{$ $ O-jM4M j( p *5 p@0@` WP& @~TJ 0 @rP 4 @lP T 0 0R4 T{T@@`@vT`pWV'[ `PpP`p ʍ:S @P@0 PSߍۍq```΍j `E PU00@@0 _Op/p@Њ z#pD  ` 0@@Њ$pP 4 @P;@ @$@p4 0@T p PGp@Wp@ R: 00^ JPPp* R% 0` 0 ` Rj= 0Єp pPU s @t@0 @\3-0@ R- `PpQ"V Q  @Q T  R PXp/ `\D0: U@ p-h(w h XJP@Mp@ @@@@㌸`P0@pRSj0, 0@`!Vp`P0E$Q!Q Q7 Q5 QpSpV P @  @Ѝ/S=pp Qp0 Q Q 0 QS: pV`"Q \QQ Q "Q 0Q "QS 0pSpS `0@00꠴0+PO-P$M@D 0@ PS `p (p @PEU $Ѝ 0@  PEU`@p  P  0@  `PE@p P @ @p @@ d@@@\# @p $'WP`V`U:`P`PDP\#x: @0@ 0P\\P@   RFpQ P @T  0RC* 0@vT *H^ P@\1 S.b@T@@H R 0 ^*T00 Qp \A  N K  0`0p@-H@@0S \U P@P ZP@P R\ \U P@P 00* @p@:` @-@O-MM_Oj _OOOP @H@8 0@ @@PP *0xh , X 0 @@p@@D3:@/PP  @uP0 @@@??Op*Oj@hW 0G p`@P@@@Z -R,  X d pd8 @@@@@0@ Rl dB[ VpR`RRPRQQRRRRQRQRRRQR|Q P P      @g @dH @ap @^ @[ @X @U @R( @O #   H\D P@@~ XL @@@0 0@0lTL|j@@`@)P d @Ppp5 x*㠺㈘0@ @@@P P `,*@@dO`ZO^` @P jP 8@=T @8?O?O L` @P \L@@H`V 0 S* 0|j` H|G T\8PT`@@p@@@P@@@@QS PW P@ @ \Q Pe ʍ*0S ~pL PN P 80@^> 0S6 *3/l@P 0S \@H RN 0SM*0 弚@ Q  Q %n =P P 0S+ 3/\ @8@4@0h @,  R * P p 0HPE ʍ1/ O L8@eT @aCP8@-D @@P@0H RL  QM* @ P\,P "PD&: L Q R3* P P P,P \P 0HPp 0S K@@PKPH @YP880H\  R* [p 0RP  R* "P \P 0H R;p0H^  R *  8&O-CMMD (P@@ @ 0DD3 ( 0@ @P05@P` B]@Pa.@ X!@xP@@ $6P Pn P \:, PpP2 W \P@`P* .PP $P Pf /PP`V .`P $pPT P@`n PP0SZ\ u Ll@p@`@P8 PP5  @Rh]\\$\ R ) Qa* P P_0HPpp @*(P8?NP \ 0|rP-  @?P t*(P8?9P \ h0NP P P @ @( Pp R 1!H0^ P* q0H R4  R* `H R=  R* PH RD  R* @H R?  Rz* 0H R6  Ro*  H R5  Rd* H R8  RY* D<: Q 4 Q* P+ 0H Rp @\Ѝڍ 0S   0k 0qT?0S C1   ! 0Sp   H\~ \*p \ 0S\ R HQ Q*p R 0SI  ` RG* pp Wp 0`pHQ#  R:* p0 S0! `V& 0HQpx pp Wp0VFS `0pHQpe p0 S0WGP `V @Xl7 0@ 0EB00qD 00 p< p \~SC^{ x00q+00p% p R zSC\d t00q*00q 00q  0 00~0q00 0 00k0q000000000000000 p `  UUZ@X< 0@00 @3@cX\ P@0- @&< 00 @ X\ P@0- @ 01 @~lQ  aB Qp 00`BSoq /oo @ r S?C S?C S>C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°D*: T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{ 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3#@- -LPassive mode %s. Receive uniqD?:ue %s. Store unique %s. Carriage Return stripping %s. Case mapping %s. Globbing %s. Interactive mode %s. Use of PORT cmds %s. Verbose mode %s. Packet tracing %s. Bell mode %s. We only support %s structure, sorry. We only support %s format, sorry. We only support %s mode, sorry. STATSTAT %sSYSTHELP %sHELPSITE IDLE %sSITE IDLESITE UMASK %sSITE UMASKTYPE %s %sTYPE %sftp: internal error: unknown type %d nmap: unbalanced bracketsCDUPCDUP command not recognized, trying XCUPPWD command not recognized, trying XPWDXPWDTick counter printing %s (%d bytes/tick increment)Hash mark printing %s (%d bytes/hash mark)-malloc/%s: %s Ntrans off.restart: offset not specifiedrestarting at %ld. %s execute get, put or append to initiate transferConnected to %s. Not connected.Connected for proxy commands to %s. No proxy connection.Mode: %s; Type: %s; Form: %s; Structure: %s Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s Store unique: %s; Receive unique: %s Case: %s; CR stripping: %s Ntrans: (in) %s (out) %s Ntrans: offNmap: (in) %s (out) %s Nmap: offHash mark printing: %s; Use of PORT cmds: %s Tick counter printing: %s Macros:Account:ACCT %sftp: %s QUIT%s: unknown mode tenexasciibinaryusage: %s [%s%s | ]Using %s mode to transfer files. %s %s? usage: %s remote-directory local-file LISTNLSToutput to local-file:wSHELL/bin/shsh-cTry again laterIncredible pattern: %s Extremely long filename from server: %s../Filename provided by server doesn't match pattern `%s': %s /tmp/ftpXXXXXXError creating temporary file, oopsaRefusing to handle insecure file listfdopen failed, oopsusage: %s local-directory local: %s: %s Local directory now %s %s: bad debugging value. Debugging %s (debug=%d). Continue withsorry, arguments too long(%s) remote-filelocal-fileusage: %s remote-file [ local-file ] MDTMD <: %s%*s %04d%02d%02d%02d%02d%02dRETRLocal file "%s" is newer than remote file "%s" r+wfilenameusage: %s filename %s %02d/%02d/%04d %02d:%02d:%02d GMT SIZE %sLimit of 16 macros have already been definedmacro nameUsage: %s macro_name Enter macro line by line, terminating it with a null linemacdef:end of file encounteredMacro not defined - 4k buffer exceededNmap off.mapoutUsage: %s [mapin mapout] commandusage: %s command ?Ambiguous command?Invalid command?Invalid proxy commandNot connectedfile-nameusage: %s mode file-name SITE CHMOD %s %sarguments to SITE commandusage: %s line-to-send SITE command line to senddirectory-nameusage: %s directory-name RMD %sRMD command not recognized, trying XRMDXRMD %sMKD %sMKD command not recognized, trying XMKDXMKD %susernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: Login failed. remote-filesusage: %s remote-files local-file from-nameto-name%s from-name to-name RNFR %sRNTO %susage: %s remote-files DELE %smdeleteusage: %s remote-file remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWDXCWD %sWarning: embedded .. in %.*s (changing to !!) mgetlocal-filesusage: %s local-files STORSTOUmputusage: %s local-file remote-file APPEAlready connected to %s, use close first. tousage: %s host-name [port] %s: bad port number-- %s non-printstreamfile8AIimageebcdicsend account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftptoggle carriage return stripping on ascii getsdelete remote filetoggle/set debugging modelist contents of remote directoryterminate ftp sessionexecD!): ute macroset file transfer formattoggle metacharacter expansion of local file namestoggle printing `#' for each buffer transferredprint local help informationget (set) idle timer on remote sidechange local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesshow last modification time of remote fileset file transfer modesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingenter passive transfer modetoggle use of PORT cmd for each data connectionforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename filerestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filesclear queued command repliessend one filesend site specific command to remote server Try "rhelp site" or "site help" for more informationescape to the shellshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle printing byte counter during transferstoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode!$accountappendbellbyecasecdcdupchmodclosecrdeletedebugdirdisconnectexitformgetglobhashhelpidlelcdlsmacdefmdirmkdirmlsmodtimenewernmapnlistntransopenpromptpassiveproxysendD"*: portputpwdquitquoterecvregetrstatusrhelprenameresetrestartrmdirruniquesitesizestatusstructsystemsuniqueticktracetypeuserumaskverboseUsage: %s macro_name. '%s' macro not found. %ld bytes %s in %.3g secs (%.2g Kbytes/sec) runique: can't find unique file name.%c%c%c421 Service not available, remote server has closed connection%s: receive aborted waiting for remote to finish abort send aborted waiting for remote to finish abortftp: acceptftp: setsockopt TOS (ignored)abort%cABOR ---> PASS PASS XXXXNo control connection for command PASVproxy server does not support third party transfers.No primary connectionPORT %s%s %slocal: %s remote: %s ftp: socketftp: setsockopt (ignored)Passive mode refused.%ld,%ld,%ld,%ld,%ld,%ldPassive mode address scan failure. Shouldn't happen!ftp: connectftp: setsockopt (reuse address)ftp: bindftp: getsocknameftp: listenPORT %d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %ld Bytes transferred: %ld Bytes transferred: %ld netin%s: short write WARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly.received%s: not a plain file. netoutName (%s:%s): Name (%s): Login failed. Password:init$initftp: %s: ftp: connect to address %s: Trying %s... ftp: fdopen failed. ftp: setsockopt8Arguments too longOut of memoryPathname too longUnknown user name after ~./Bad directory components{{}`{[*?Commands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s %d ftptcpftp: ftp/tcp: unknown service pftp Usage: { ftp | pftp } [-pinegvtd] [hostname] -p: enable passive mode (default for pftp) -i: turn off prompting during mget -n: inhibit auto-login -e: disable readline support, if present -g: disable filename globbing -v: verbose mode -t: D#?:enable packet tracing [nonfunctional] -d: enable debuggingftp: %c: unknown option ftp> sorry, input line too longHOME%s/.netrcError: `password' must follow `login' in .netrc anonymousError - .netrc file not correct permissions. Remove password or correct mode (should be 600). Remove account or correct mode (should be 600). Missing macdef name argument.Macro definition missing null line terminator.4K macro buffer exceededUnknown .netrc keyword %s defaultloginpasswordpasswdmachineD$%:  w  ̋l a  0`00 8}@}xy0}}-$Id: cmds.c,v 1.33 2000/07/23 01:36:59 dholland Exp $$Id: cmdtab.c,v 1.8 1999/09/28 15:36:05 dholland Exp $ȳ@8}Tl@}̆\ ܤ( 08`D<DLP\d lHp(x\@JܝЈTP$<<l,H<؉D0ďH̏dԏH܏H4@Hh  <܋D%0: H(|0h84@PtHP\Xx`Ȍ hppxTč0} ԯ@p< ܎<JJ$Id: domacro.c,v 1.4 1996/08/14 23:27:28 dholland Exp $$Id: ftp.c,v 1.25 1999/12/13 20:33:20 dholland Exp $$NetKit: netkit-ftp-0.17 $$Id: glob.c,v 1.9 1999/10/02 13:25:23 netbug Exp $$!z@(#) Copyright (c) 1985, 1989 Regents of the University of California. All rights reserved. $Id: main.c,v 1.15 1999/10/02 13:25:23 netbug Exp $ $Id: ruserpass.c,v 1.9 1999/10/02 19:12:33 dholland Exp $A0aeabi&CORTEX-A9 A ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.init_array.fini_array.jcr.dynamic.got.dataD&3:.bss.ARM.attributes.comment d ll`!̋ a) 0002 ``0;6A||TGwMwD"U  a  m  r  {  "" H,H,pH,1y,z/D'0:>tar9Y8Y8YbusyboxE>ping9Y8Y8YbusyboxF>date9Y8Y8YbusyboxG>login9Y8Y8YbusyboxH>fgrep9Y8Y8YbusyboxI>parted9Y9Y9YJELF(Ț44 (pll l 444tt,YQtd/lib/ld-uClibc.so.0EYjt.v3V#Rosc\47ikpXWT5nK2[a^_y?eJw~bz|,LufH:q{r%>Sxd}Q&mOgI](8hl"  ' 1BD<=@-6FG 09!U+*)CM/ $P;N`AZHT`ldxhl _nؕ̕Q, ,(8DP\ht8Z{PvȖԖ@sJ:/(v4$@ELXdMp5|pcI[,0!ȚP ė)З'ܗ0< $0<BHT`lqx D6̘Xؘ,Jj , 8kD5P\Uhot;f,"a}!ș"ԙ[DȒ(4@L,Xd7pb|K=Wgetenvmallocstderrfree__data_startmemcpyabortcallocreallocmemsetraiselibc.so.0strlenvfprintfsrandomstrncasecmpvasprintfiswprintclosedirfflushstrdupfgetsvsnprintfforkreadlinkgetppidlseek64fcntllstat64ftello64__errno_locationopendirstdinmemmovegetpagesize_exitreadfseeko64fsyncaccessfdopenstrcatisattyfopen64__fpendinggetcwdsigactionfeof__fpurgefscanfstrtollmemcmpconnectsscanfmbrtowcusleepunamewaitpidstrchrioctlstrcasecmpsysconf__xpg_strerror_r__uClibc_mainferrorfputcfputsgetpid__sigsetjmpstrncmptolowerftruncatestrcmp__ctype_b_stdlib_mb_cur_maxsyscalJ:lstrtolfilenoposix_memalignreaddir64rewind__assertsocket__fputc_unlocked__freadingstrncpylocaltimeexeclsigfillset__glibc_strerror_rstrcpygettimeofdayjrand48gmtimestrstrumaskfclosembsinitstrnlenstrrchrstatgetuidatoi__stdoutfwritesiglongjmp__cxa_atexit_edata__bss_start__bss_start____bss_end____end___end:^g      $(,048<@DHLPTX\` d!h"l#p$t%x&|()*+,-./012345678;đ=ȑ>̑?Б@ԑAؑBܑCDEFGHIJKLMN OQRST U$V(W,X0Z4[8\<]@_D`HaLbPcTdXe\i`jdkhllmpntoxp|qrstuwxyz{|}~ -L-Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌJ : Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌ  --- 0c(gD$GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/H-M   0 00 0S  000 0000  0  0  0  0KH-M 00000 0K-M  00 000 0!000S0!00  00!00 Ћ/H-M  0 0 00 0S0700 #0!0000T0S S0!000 0S  0s0 0 0 0 00 000 0!000S 0s0 0!000KH-M 00 0 0 000c0w00 00 0 00S0KH-M 00 0@h0 0x000 0H0S 0 00R*00  0   ~K8gH- M 0 0S @ @00 n0 @-0 0K  00S 00` 00P+ 0 1Y8u+ 0@P00  "?c0t0#0"? c020b1 c  0$00 Kp m(mH-M 80S 800 @$ 0!*00KHmH-M 00I&0S X00S 00  `, 0)0 S000KmH-M 000 )0S00KmH-M !K0 K0SHHH H0$!KK0S0!K 0K4nhn ~H-0MK0 40 0"K 0!K00S 00s "2$000S  0 0000S 0 000 ? 0!K4!KK0S K"K P0"K00 0 000S 000 ? 0!K4!KcK0S K!K P0!K00 0 00 000S* 000S% K"KPK"KQP00S00 K!KPK"KQP00s00  0C$000S 00 000S 00 0S 0S"K 0!K  0Ktnhn-}nM0H- `MP T X \0 P0 "KP0!#K 0#K 0$K0L0 L0H0 "KX@0 0 #KX@00 0 00!QP000 T0S T0 ,K\0S 0J: H0 T0!4K0S 0L0 0RH00H0 L00L0 "KHK <K \000 #KLKDK 000 #KR$KR\\\"\2#0S> 0S;0S8K#KPH00H0 "KHK <K \000 #KR!1w#L00L0 #KLKDK 000 $KRlTh!T1]#0S 0! 0S 0 0 0"K"K0S0 0 00S0"#K#K"K\J0S 0.##K J0Sl l0##"KKPtDj/D0#"KCKK@TPPH K0nhn}nnnoLoH- M   D0<00"   0@L0KhH-M 0=00 0S K$H-M00  001000  01SK$H-M00 \ X010 D0!80 1$000  01SK\o0iH-M 0S 00 0S M0KH-M 0 0 '00 300 0S '' 0KR0S6 0S /0S& 00SK0S 50 0400 0S 50S 500 0S P0 0 40Kto H-pM` X(0@0 0$K 0%K0X0 0\0 0 0 00 00 00 00 `002080 80S 870S 70S008 570S 800Y60S0<0 <0Kd8 J: 0S 800F60S 800000S<0S 00 0 0$0 <0S $0S 6 $000000S 0@0 @0KT0Sp $g`0L KX0Kh 0Sg `0T K\0KH0S` <@K%K 8 :040 40SS 40 X0\8 \`0X \0 q000 00S%5f!l50S`00%0,0 @50S`00$0,0 `00k$0,0 ,0S$ %5B!0,K0(0 0#L,!L(0S &84( A0S00 0K(L 0[0#0S &`00N00 84 A0S00 0KK 0[0#0SX40!G0S \40"G0SB`0$K--00 `0%K&-00 `040!-00 `040"-00 30S   t30S @00XQ D  #0%0S{20S84 k00#0S 20S84 ^00#0S 20S 0`0|"|%0@SR%;% 0S 4 ;0S$ "1| ?0 0 @04A;0SE 4:0S 4 N:830S8 8%3X0S X0E\0S \0E`00 0S D1 0484rA49  82X0S X0E\0S \0E0KoВoooooooohna}okp4ppp H-M 00 0000 0 0S3 0K  WJ:0S# 0j;0 000 0S 0;0S  730S 20 ~ v20KqoH-$M(  (00 0 0 0 00 D00 6(90S, 0S 00 0 0 00 K' 00 0C00 0 0  @000 K' 00 jC00 0S0Kq- M 0Ћ/H-M 0S 0A0H0 0 00   ?A+00 |00S p 0 0 00 H 0 0 00Kqhn?}(q8q0H- xMh l `2dK H0 h 00+00 (00 h0h0! B 0 0Q Q R0h*00 l0S l00010 10S( 0S Sl}dz\wXAh0h0 W0! PK 0h0h0!hPP 00P  0#h0 h0 W0 K 00  h00  h0!h IG(0S (0Sh*(00S80 K0|}qqqqqqqq r0H- M 00 0t0 0p0 0l0 0h0 0d0 d0S> d e0SP0D0 D0t0 -d` V0SA0@0 @0p0 d( G0S d @0S+0<0 <0l0 : d000000h0 dt0Sl0S00.00 0S 30S `:0S00 530S~ t0SC 040 y4040! B J:0 04)0\0 )400\ O\41040 40S000080 Y8d 0 00S0K000S0B8o0>l0S X080S h0S 00 000 0K 0S 06000 N00000t0S |80Sp80,0 ,0H0S ,0 ,00R*,00  ,0  ,+ ,0010|0 0010x0 70SN'0S'0 0(0 00'7 0(0 |0S (h (` x0S (L (D (L0o00 (90H0 p0SH60S H0400Sn%0P0 H000S&H000P b6PT&\P 0$0 0H0!)0`0 0H0 000! B 0 0 0(0\0 0H0"(0X0 &0S$`5 $\2 $`. $\+ $X( H0400S+|0S H040@0T0 $T H080S H08004$ x0S H80T0 $T H0 0 $  E|0S $h $ x0S $D $8 $$U P+`)\'X%HW80H0 H0S=0L0 LL(5 B80H0 p0SH60S H0400SH000St#H000\#\30 0H0!P(00 (30H0 000! B 0 0 0'00 2s%0S 0H0"(00 \2aH040J : 0SYH080S "H0800O100 0H0S 0 00R*00:  0 ::+x0S AH?70((100 0H0S 0 00R*00:  0 :Y:H00 0H7Hw70H0 H0S27.02.00 K0$r,rg4rВ8roDrLrTrXr`rhrtr|rrrrrrrrrH-M0 0  0K000 0H0S 0 00R*00  0    00 0 0S0KH-M 00H-M !K600 0S 00!KA0S00KH-4M( (00"0$0 $0S0j(00$!0 0 0S0^(00 MA0S t@0R G00 (0 0 0! ( <0SE0;E 0 0 &00 0 0!&00 $0@(040>000000Ft 0y00 4@RP0S @S0 0($L5(00-0KrpH-M  00! 0OP 00b Q00 000"dK 0L?p20#`20X$0 "Kv<2`0 K P0 @P0!  0  0!0#0DK 0 "K?1@100"PKDKdK! 0 C0!K  7300 0S0KD#T0K :0S V0S S s# 0KD0'J : ;An30KDK 0 0"K0"KPH00Hc#0 :R30KD0Kp$sh?H-pMx 0"K 0#Kx00;*0 0 0S x0 ,0K 00S x0 40K 00S K"K P0 0" 0@Px000 ?T K"K P0 0" 0@Px000@_x0002 ?R*K"K P0 0z" 0@Px00i0 ?T K"K P0 0c" 0x00S0 ?x00K02 ?!Kx0K!K P0R 0xBKaKV`p`pK@PTTK =x0K!K P0R 0xBKaKV`p`pK@PTtK =T Kt0K  S0S +x00 0S H0 0  y+0Koo H-M 0 0 008)00 0S% 0K 0S 0C0S 09+K+00 0S <0 0<+0Kq H-M 000 0Kts0S000S0 00 0 000K0sH- M  0 0R  07000 0S00 0 0S0 0 l\h \00 0 G! 0 QP000K 0[K@3000#340  p0L E@!0  0\0pl 1P` @300 0 C0z P@\200  *04a P@200  0Hlh P\@1H2 D20 00  0T) P@1 10 0  0  P@100 d 0LH ` H0mS mShS lS aS -vS  S% sS &00 &00 #T1 H1 0 0 01 ,1,J :! 1!1 1 00 0 00 0! 0S{D0S>0Se8 0 t00 c 0 $0 X001 $0 0K{g$xg {dgВ{(H-M  00S 000%00 0S0$00 C0 00 0 00 0SP@ F0S 00S00K|H-M  0S; 5.0S( 00S{0S"0S 00S00 0S || t0 l00S X0 0 0K|`($H-M 080S 0 0S l h00S \00SP00S < F000zKT| |$H-M  00 K0Kn0 0 0S00Sp00S  0 KT00  0K8 00 00S00K@$H-M &0KH-M 0 0K 0[$0KH-M   0KH-M     J0KH-M e0KH-M [0KH-M  P00 0S  0R 00 0KH-M  00 0K~H-M00 0 0KH-M 0S 00KH-M 000 KH-M 00 00 0 0KH- M 0J:S @00000K-M  00 000 0S 00S0S 0  00Ћ/H-M  0S 00 000 00Sy 0 000 q00 00 0  0KH-M  '00KH-M  00 0 0  00S 000S#0 00 0 0S0KH-M  0v0K-H-M00 0S 00  0  0 0 0S0KHЍ/-H-M00 0S 00  0  0 0 0S0KHЍ/H-M 000KH- M 00 00 0 0 00 %00S 0000 n 000 0 0 0   0 0700C0 000 0S 0K~H-M 00 00S 00q000 0SK-M  00K00  000 [R0000  0R0Ћ/- M00K\0 0[000;S 80 0[000;S00Ћ/- M00K0[ S00Ћ/H-8M0 4 8 <0 4 <00c Sddo/`3A4 800c0 00(0 (00S (00$0 $0 0 0 0 0 C00CR000   0R0 $0000S 000 00C0 0S  $0000S 00C0 0S  $0000S00$ O00 0s 00C0 0 0 0S 0J: 0 00 000   0R $000l0S0S00$0$ 0$0 00c 0 4 <00c0 (00S$00S 1<!& 0S 000 0H0S 0 00R*00  0  T   0RU$ 0SO$G$0 0c0 (00(0 (0S2K~4~H~@~~H- M  000S00@0 0S00KH-M  0 0  00 0KH-M  00 0 0 00  00  0R00 000 0S 0KH-M  00 0 0 00 00 0S S 00S 0 0 00 000 0S 0S00K-M 0 0 00  00 0 000 0S 0Ћ/- M00 H00S<00S 90SP00 0Ћ/H-000S$ $00L -Ћ/H-M 00 0 0  0S# 000 0H0S 0 00R*00  0  0 0S +K`pH-M   0S (0 0 K脠0H-M   00 0S0  i 00S S  003 ppY/l0h T00< L 4002 , 0܂L `oH-M   10lZ 0Sl1 " 000CSJ*:G$Dd$!$10, L> !10& D6 00* <. 00$ 4& 00% , 00* $ d00- d D002 H $000 u܂ă@hĄH-M   10 0SXl1 000CSG$Dd$!$10# > !10$ 6 00, . 00! & 00&  00(  d00& d D00) H $000 ܂,Px̅ HtH-M  81  ,1  1  0S 0;L0000 @00 00 0S 00S  00yx0000S `0 C00 00 0  0K`p-M  0S00 000  00S 0000  0R0Ћ/H-M 00S0000 0900 00 00L <0(00 0 0 JK܂H-M 0000 000S0200S0S00S0#0 00c00 0S 0SP00S D00S 400S $0 00 0K0H-M 00t 0 K4H-Mp00Sddd d0 L000 0 40000 $0J?: 00  0K44H-000 4H-,00S 00004H-0004- M 000 D0 00000 0S00S00Ћ/H-FM  00 0 0K101 10 S 00 G10 S 0S1SB0S?0S 10L0S 00 10 0K$0S 10 [R00 0S 10\S100S 101 1 0K0 000 101 10S0S1S  D0K 0 >K10S 1SKІH-M  @0000 0"00 0KH- M  /00 0S 0S 0S/1 0SI 0SD00S 00 0 0 /  0R |00 0S p0SH00 00 $00 00 00 \ 00 0 0S00 $0S 00S r00 |m00 h00 `c00 00S <Y00 0KԆ  H- M  $0 0 0 00 0S  p0S C0 0 00 00S 0S6 3  <00  !00 0S0 00S 0S $W0S 0S 0S K0H-M   0 >0S$ 0 0 0S 0& 00 0SJ<: x 0J 0S 0H00S 0  0n0S0KH- M $ $00K A$00S 0K0  00 0 0S0 ,0$ 00 Y0K,H-(M  $0 0 00 0  00 0y0 0 0S$ 0  0S$0S 0 {. $0 $00S00  0 0S   0 $0S $0 0  $000 0KH-M  00S 00!0 0 000 0 00  000 0S0L000S 0 0 0K<@DH-M  00S 00000  00 0 0S0 y 00 0S00  0KH-M  00S 0000 0 0K0S000Shhh h0C00 0R 0000 0S00  0K0H-M   00S 00000 0 0K0S@` R 0 0 %00 0S@( C 00  0K8XH-M  00S 0000 0A0 0 0S@p  0 00 0S@@ 0 0 0  0KTtH-M  00S 0000 000 0S@\ 0 0 00S$$$ $00KXԇWJ):H- M  00 00 \"0S +00 >00 H00 >,00 0S 00 0  0S 6, 0 j00KH-M 00 9$0S0 000  0R0KH-M 0S0000S0G#0S 00KH-M 000S0.#0S00KH-M   0 0 0S 0 0 0 0 0S 0 0 0 0 0S \0 0 H0 0 0S@(! 0A 0 00 0S@ 0/[0S U0S0 L0S pF0S0 P=0S 870S0 0K$H-M  00  0 0   0800  0000  0 0 0S 000 0S0!~0 0  00S  00S  0 0 7 0KH-M  00S 00a0 0 00Z0 0 00  0T00 0S0D000S 00 00KHLPH-M  00 00 000 000 0 S000  00 0  0S  0 00KH-M10 0 0S0 0 0K !00 0K,0H-J3: M00  030 @ P 0 \0! P01S0 000  03@S 00 K0<H-M00  001000  01SK<H- |x t l0 hd m X0 H00@<000 0 0@<D@DH-,00Y 00U00Q<@DH- |x : l0 hd 3 X0 H00g@<00b0v 0 0HHPLPH-,00 0000HLPH-M0 0 0 0 00 0 00S0#  0 0 0S 00 d0 00 D0 <00S0 00 0S0KTH-M0 00 d0 00 D0 <00S000 0S0KX-0Ћ/H-M0S 0S H0S ~0S 0S0Wd( 0KT1T! P1P! L1L! H1H! <1 K0 1!1 0 ( 0 0  0 0 0 0 0 0 |0 t0 d0 \0  P0 D0 80 0K$| xH-0000TXH-M,2 (20200 0H0S 0 00R*00  0   w!10 v100 0H0S 0 00R*00  0   J&:T 10 0 0H0S 0 00R* 00  0   7 00 6000 0H0S 0 00R*00  0  i $0  XdpH-M  00K蘈H- M $ $$00 1$  1 10 00|10&00 0 0 H+<100S $100 0H0S 0 00R*00  0   0K 0w0S 200 0S T000 0  0S  00S@=8H- M  $0 $1  00 0!$000a000   0R'00 0S& 00>0 0  0S 000Sl l00: FP 0S 0S00K8H-M 0S\\= X0F<00  0 0  0  0 0KlxH-M 0SN 1#00SO 00 0 !00 0 010 0100,000 0 0R0 0100 00 0 0 0R000 0  K耉x- M  0R00Ћ/0H- M 0Sh 100Sthi d10 0S0010 0 00 0 010 000 0 0R00 -00 "0 01@0 010P0 010 010 |00J%:000000 0 0R000 0 0R K0耉x`H-M  0S 0T0 0001V0 0 0 0010  00 0 eK耉x܉H-M  01 00 00 0!0@00000!000S000 000 0SKH-0@0S 0@00#0S  00@0S 0@00#0S x t0 :00 0S0 0  0  0 0 ,i0K( P?<ZH-M 0S 00nvKH-M 0S 0 0 0 0R0 0 00  3/KH-M 0S 0 0 0 0 0 0  0 KH- M  0S$ 0 0  tO0S0@0 000c400U0 0 KH-M  0S 0  KH-MK!KK!K 0 0!K? 0K- M 0  Ћ/,-00Ћ/,0H- M  0L0 P  ?!K0 SX(`4`@`L`J):\`h`8a```t````0!L 0I/0F=) -0BE? ?> <+09&06!03 <00!B 00"0!00! B 0 0d 0 0 @@ s 000 ,0 K0ʚ;@- M  01Ћ/0H-M 00  H010S0000 0 S0K0H-M 0000 0S00KI-M +K0! K` 0#K0SPP L4$0S:0H0 0 0 00 ?KH 0 00 ?? 0`p 00 ?K5 0 00 ?,@P 00 ?K$K`@!d {0K00S 0S 0S0c 0 K 0@PU 0K@ d W0Ks00S&+KP00+K&P00+KP00 +K' P0000 Kx@P 0n 0 0 56y 0#K0@K 1 70S 0@0S > 0@K 1Y80S 0@0S >  56#K` 0"K0@K 1 70S 0@0S @ @K 1Y80S @$@ @K#K $00 d 0K0KrN T{Gzt??$H-M !K0S444 400000!K0K  ,0H- M !K0S``` `00!J<: B 000 K00H- M !K0SddJ/`00!B 00(s0 K0,H-M   0 ,00    0w0K,-M 0 0 $0 000000 0S 000 0 C00  000  000S 00 0 000SЋ/H-M 000 00S P0 000000S00$0S0K(-M 00 00 l0 000000;S  00 000  000SЋ/-M 0 0 00 00 |0 000000;S00 0 0 000  000S 0S00Ћ/0H- 8M0 4 8 <0 40L04 P  ?!K000 0S07( K(0K0(K0S @!0`$ 40L0R40L00C@!S 40P0R40P00C@l!F(0 ?B 00$4P 0 ? 08 8040"PP4000@ 00S<0S 80 4 <0 "<0S <00S 00 8 0 <0S <0 0 K0,8`-M !K!KR 00 0!KP0 0 0!KЋ/H-(M "KK  P0 0!KK 0 0 KK K P0PK"K P0P0 K!KP 0 0 !K0KH-J?: M  r0S&0000iS000g0C S񟗂pprprprpprpprprprprprprp 0 0~ 0| 0z00Si 00h0%0COS`hrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtr8r`rtrtrtrPrtrtrtr@rtrHrtrtrtrtrtr0rXr0000000 0 0S,00S000 0K,- MKK 0 K 00S000Ћ/0H- 8M0 4 8 <0 00S 04< 0)000$0 $0S $p$0 0 8080 0 $ ",0K %0S @!i48 0!K40!K 0 0!K!KR 0!KK0S 0!KK"K 0@P40! 0J 0 0< $00-S<040" 0< 0S <0 K4| 0 00S4000@ 00n <0 4E 0< $B0$>< 0 0S 0 0 K0БԑH-M 0SxxF t0Y00S`TG P0P00S@0H ,0G00 0 0  KThp@H-M 00 00ST 0)0SU 0!00 0  00 00 0 0S 0R 0SXHZ D0 0S 0 0 0 0 K@hܢT- M 0S 0000Ћ/@H-M 0J*:0 0Sttz p000 000S 00 0S0KĒhȢH-M 00 0S 00S0100 50S 0 00 00=0003/0S00 0S@00S '0KԒh,H-M 0S 0\0S, 0 0 0S00@ 0 z00 0S 0003/0S 0  0 0KԒhH-M  000,03/0 0 0S% 0  X0S   00 x0S 0S 3 0S 0  0KH-M 0S 100S xl h1000 0SP@,<1000,0S($!1000 03/0 0 0S1 0S&  00 j0S {0S  00 0S 0S 0 0 0 D0K h4LtH-M v00 000S0g00 0S0K0H- 8M8 80S!1H8t0Sk 040 40S!17400083/0S00-0K- [0"K80! V 0 0 0"K"K!K80BK"K 0P80"K P0!K!K 8"K0S% 8080"BKT"K 0 P0!KK"KP"K!K80!K P0 8!Kَ0S 8HJ ):08A0 K0Ԓh7=H-M  0S@@@!@10S0 ]/ 1000S !00H00 00S 000S^/00003/0 0 0S 0S 00S lDh D0 0  0 <0KԒhslȓuwH-M  00 0S 0  0  0  0 00KH-M KH-M 0SPPP P0.00S <,.,0%00003/K,hX<H-M 0S 0 0060S p00003/0S 00a000Z0K,h@(H-M 0S,,,!,100S !10000S000@ ,000S$ 00S 00_0S 0  00003/0S 00 0 000K,h(<PH-M 000S 0S `0S 000 000KH-M 0S444 40W000003/0K訔h/(H-M 0S444 40<000003/0K訔h;(H-@M8 80S@@/<2!80 000 0080,0 00So ,0Sn 000,0(0 (0Sf 00"(0!00cS0c ?"K00" @P 00"d 0 0*0!K000([0S J!<: "KKP000K80(0!00 (q0[0#0S 8000"0 0 0000    ` 00 vt00 0 S 0k80000 00Sz0K,h- M  0 00S00Ћ/H-M 00 0S 0r0 0 0  30S 0400S000  \0 0 0S0K,hH-M 00 0Slll l0C0 0 0 00 0R 0000  20 0 0S0K,hH-M  0Sddd d0000`0SH8D 80000`0 3/0K,htH-M 000d0S800d0000d03/0KhH-M 00S``/\0000\0S@4< 00000\03/0K$hH8H- M   0S 00000 0S0$O0Sn0   @l x000 3/0 0 0S0 0K,h4tH-M  0S``` `0i0000 0S00 03/0K,h H-M  0SXXX X0C0000 0$0S00$03/0K,h/H-M 0S$0@ 00K訕H-M 0 0  00 (0S "0S 0 0 0 0S0K- M 000Ћ/H-M  0SJ"?:  0000s9.000S 00000 0S 000L0S\/\0000S\4X 4000L03/0K訔hԕT H-M 0S 000S:.0}0000 0SlXh X0q00P0SL0H 00g00P03/0K訔hؠT8H-M 0S!1I00 0 0  00 0S 0S0# 00 0 0R0 00 0S 000s0S000 0S0K,hH-M 0 0 0S/0 00 0 0 00 0S 0400S 0400S  N 0S0K,hH-M 0SLL/H000S000X03/0K,hH-M 0 0  00 0400S  A .0 0 0S0K0H- 0M( (e00 0S0V0!"K00 0<00 (0!BKPK 00A 0 0 ( 00 ( w00 0""K000 0S0"KPK 00" ( o00 0S ( 00 < 0 K00H- 0M( (p0S0g(0S0`00 0"K(0 00 (0!BKPK 00A 0 0 ( '00 (  00 0""K000 0S(00J#*: 0 0KPK 0(00B 0 0 ( 00 0S ( &0(0  0 K0H-M 00S0S000 0 0S000 0 0KH-M 00S 0|00S0S000 C0 >0S000 C0 0Kdh{pH- M   0S 0DH00 0S. 0 0  0  00 P 0 0    0S 0 0 0 4 0 < 0 8 0Կ0K,hXH-M ĿKH- M   =0 0  0S 00 00 0S 00  } 0 0KH-(M   0S<<0S 06!K0S 0 0 00R 00!K0  P0 K KR0 KP 0 KKT l`H-M   0 0SC 10SD 00SE 0 PF 0!PG 0 ? 0 : 0  0  0  !!!0Kĥإ H-0M   0 00 0S 00 ! 00S 0L0K0H- XMP T P0SDD @1tT0S0$ 1lTP0S 0aP0T0 P@T@TP,K FP0P0!TAP@TPLK 3`0PX0@P0T0!,KLK  00 K00إ<HhH-0M( (0STT P0(0(00"$K 0$0K(0K0إ|H-M 0SXX T0P0H00!   0;0K<J,*:إ`h0H- M 0Shh d00P0@00 00!  00 K0ĥإDH-@M0 4 00S 40S0m00 400l0,0 ,0S_ 00 400`0(0 (0SO 00 4000$0 $0S? 00 40 00 0 0S/ 40!0R 0!K40!0P 0!K!K !K ,($  000 0S ,($ 0 $(,0KH-M 0STTB/P0,0000000 0Kĥإ0H-M 0S ѭKH-PMH H0!HP0gH0H0 H0 0  0"KH0H0 H0 0! 0!KK 0QP K 0QP "KKPH0!KP08H0!KP 0 0!K!KR 0!KH0!KP 0 0 K KR0H00K!KP 0 0DK  !KH00D K0KH- M "K00 0S 0 00"K 0 K KK0H- PMH %KH0 00 0 H0%K 0 0 BP09H0%K 0 0!KH0%K 0 0!K 0 0!KP 0 0 0!KK!KP 0 0DK  !KH0 0D K0 K0H- M "K"K00 0S 0 00 ^ 0 K KKH-(M $ 0S0T$0SLLi/H1 00 $00R (J-?: $!1$0 D 0!KK 0QP01$0! !K 0!KK 0QP0 $0K!KP 0 0 !K00 0S0 40S0, 00Klإ|H-8M0 00S000000 0 0 0,K  0n,0K0x0KH-M  0S<< !K B>!KPL 004 0$J!K  I> !K 00$ B> !K 00$0(4 $ 0$0K谨 ,H- M  W00 0S+ 0 0 0 00S 00S 00$0 00 T 00 q0j0KH-M 0K00 0S 0S00KH-M 0K00 0S 0S00KH- tH- tH- 褓ԓH- 褓ԓH-|xt}p{lyhwdu`s\qXoTmPkLiHgܖ$Hlؗ J0 : 8PhȘH-}{yw|uxstqpolmhkdi`g\eXcTaP_L]H[ܖ$Hlؗ 8PhȘH-"M( (20!S R 0C(2!@P`0:K 0 (@ 00S0-?K 㒥0S$ 2/ S04 ?"K|0pK !K(2(2@ 0 0$ $ 0c 00  0p00KdH-H-0H- (M( , (00!S R 0K,0S S s B( 0 0 (n0 0 (0 0 0S/ 0 00 00S 000 0 B 0 0!K!K(0!!K(0(0 K 00 0S 0 0 K0H-,M( , (0 00 {0/ S04 ?!(000! 00 0  c00KܩH-,M( (00 0S= 0! w0 00 000! 0P0S# 00@0 0C00  X0S0  0  0$0K ܢ00K$0K@0 0K(H-M 0KH-M 0KH-M 0KH-M 0KH-Dg@e<c,4 (   dtH-8844(,pnld tH-xM  \K 0  0 0S0\0X0 X0#L3RX000 3 ?%KX00 0$KX0 0 0$KX05 0#KX00 0#KX0L0(0 0$0 0 0 X0\00S00$0 $0S& X0d00SX0d00SX0d0 0SX0`0@0S X0`00SX0`0<S 00 0 0S 0$0 X0S$0S 0S 0m0S$0S0e0S 0S0](0S?#KP@90@@0< 80D D <0c 00P#K P0!K!KRp060H0T P0L L T0C 00|K  !K|0K4000@H0T P0L L T0c 0J2:0  00X嚢0KSH-M  0KH-M 0KH-M 0KH-'% #DTH-HF DDTH-M 00 0 0R 0*00 0 0 S0" 0 0 X400 p R400 0 0 0 0c0C D400 0 0R00K44PH-0M(   (K(Q P 0R! 1 0 1 0 K 0 ( 00S 00 $K 0 ( K|0S $00 0S 0S 0S x0SСΡ0K 0 0!Kġ¡(0(0 K 0KH-iДH-ДH-!M K 0  00S0?K0T 0S 22 K( 00KH-2H-YH-M 000 0Sll+ h00SXL, H00!S R @,  10(0 ^( 1!002!P`N( 1!0 K0 0SA ?K40P 㠛0S ?K400 㗛0S ?K40 ㎛0S'0pK048#8 0"K(2 0!K0202@ 0 0$ $ 0c 00  0l0(00(0 ( 80!0 0QP0KЫܫH-0 00T(H- 00TH-cMM@ @6!P`0c>K0C0C@ 00S0c>K0C0C80 80\5,80\5#408 80\5#848#8 80\5#< 1RF8000,8000#408 8000#848#8 8000#<04 0#K80$0,80$0#408 80$0#848#8 80$0#<0 0"K@6@6@00, (04 4 ,0c 00  00(80\%0R"80004 0"K80$0 0!K@6@6@ 0 0$ $ 0c 00  000KTH-bMM0 06!P`0b>K0C0C0 0Y0S0b>K0C0C(0 (0\5,(0\5#408 (0\5#848#8 (0\5#<0"S !S !SF(000,(000#408 (000#848#8 (000#<04 0"K(0$0,(0$0#408 (0$0#848#8 (0$0#<0 0!K0606@ 0 0$ $ 0c 00  0 0.(0\5 S S SJ6: "(0004 0"K(0$0 0!K0606@ 0 0$ $ 0c 00  000KV#P H- ,*@XH- PNX@K-M0 02 0R0K 0 0 00S0," 4R (24 0"K3K "K0202@(0$  0, , $0c 00  00,2,,2#408 ,2#848#8 ,2#< <3R(2,(2#408 (2#848#8 (2#<04 0"K2pK ̠  2K "D@#T 0 0HB PR )~K@ mK`F@Pt2pK "h`#x 0 0Ġx | =K @P(2`K "# 0  0ppr t '.KB1@K PlR `hb lr'4h ̠` `"0`2 l2S0~!K Ћ/H- M 0S 0嘾0!P0%0K0 0l_0S00@0 0 0 0   0<0 40R000K0.0[KDPWEVH-M 0!/ 0 0  4M00 0S!  0 0 0  0S 0,ブ 0@00  0W000E000V0000}0000    0 X Y Z [ 0!0(")"*", + 0P0 0,"-".", / 0L0 00"J8:1"2", 3 0H0 04"5"6", 7 0P0 L  08"9":", ; 0P0 L  H  0<"=">", ? 0  H  I 0  J K 0 L M 0 N O 0 P Q R S 0 T U V W  0W000E000V0000}0000 0 0 C0 0"$("( 00KXPH-M 000 00PB00 0S0 00 0 0,㬔0K萕H-M 00ᶕKH-HM8 80000 88004 K  0]0S00 40,40ᓕ00@0,0 0(0 (0 C,0   "000<0S (0C, 0 00S (0 C,0      "000<0 0!K(0 C,0      "000<0(0 C,0   Ġ Ƞ"0 00<000C 0!K!K !K 8 g0$0 $0S; $0@0 0 (0C, 0 0 0 $0( 0 $00 $08 $00+0 0 0S 8$ 0S000K 0[0#0S(00(0 (0S+00KH- M 00 K  J9: 0\0S# 00 0@0 0 00S 0   0<0 @0R000 0,h0|KWEVH- M 00 0S000#03夻 00S # 3囻 000 0@00 00S 00 ֓0 0 q  '00 0Se 0@00 0C0 00 0C0!0  !  !  ! "00   0C0"0  ! ! ! "00   00 00 0 0S08#808#(0"$("(  0 0"$("( 0'0 ,Y[0S 00ᠽ00K舯PVtWH-(M    t0 0 0S$ 0S "00 0 @ 0S 0 0  0  0  0 @ 0 c0KH-,M 0@ 04 08 0 0"  00 0S0 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0KH-M 0S@@n/<0S0S 0@0BK謯P\H-M  0@00 0 8 0S0 00%0S 0 0 0KH-M   0S 00@0S 000Sv/00@00 0S S S0  00S 0 0  0 0S 0  J:: 0  0K謯PDدH-M  0S 0Ĺ0@0Sxht h0廹0@00 0S S S00000 00K謯P,- M  0S 03b0S 00Ћ/- M 0Ћ/- M  0 0Ћ/H-0M( (0 0 0$K ( 0Z$0K_0KH-M  0000  N0S 0@ )0KH-M 000s 00 0 00 00 0S0 0 0 00 0 0S@ 0K H- M 00 0S 000S&.00000 0 0  0 0 0S   0S s00K舯P_H-M $Z0S000K@H-M0K@Z00 0S $$$ $0嬸!KK@LPvH-M0K@Z00 0S $$$ $0呸!KK@LPvܰH-萕H-D萕H-M 800  0 ሐ0S00K蘱-M 00S 00S 00 000 0 S  S S  S  S000S0000S 00Ћ/H-(M 0Sxx t2( 0!P00K0  0X0S000 0!1408#(1Rg00 0 0  1 00S000  1 00S  1 00SF 00 0 0SJ;:0S0q0S90 0  1 00S/ 00 0 0S00S 00S00S00S 00 0S 000 3/0S0f00V0KU H-M 0S 0zx0 0 0S ׿00 0S .00 0  0K6H-M 00L00 0S00 00 0K蠕H-M 0S00V/,0/000 K-M   000 0S0S  0 00Ћ/-M  000 0S000Ћ/- M  0S00Ћ/- M 00 00#3040Ћ/- M 00Ћ/- M 00?00CЋ/0H- (M( , 0 ,0SLLL!L1島00S<,8!,1嫶00 ?"K00 ?!K00 ?!K"KP@ 0'!KRP 0 ,00 ?$ $B 00K,00 ? B 0 0K 0 K0$8H-(M0 4 #K00S!1O0S!1G40S00H040 4004   ?Ki 0"K400 ?K` 0400 ?W"K400 ?KP!K"KP/ 0"K4000C ?"K4000C ?!K"KO_ "0#P 0 0 "0# R0 0 $ [0  [(0<,!d`(0Ct030000 J<: 0 Kx8H-M   0Sddd d0ǵ0STDs/D0念0 00  0KhDH-M   0Sddd d0垵0STDP D0喵0 00  0K\DH-M  !K0S||| |0t 0Sl\.\0l 0   0<0!K 0KLDH-M  !K0S 0E 0S|lx l0= !K 0 Ġ  Ƞ 0<00C 0 0K@DH- M $ 0SDD~/@1 00S, (!1 0@0S !0 0@0 0 0$0S0/ 000 0$0 0$  0!K 0$0 0$ 6 0!K!K 0$0!KQP 0 !K 0$0!KQP 00KX h|H-M  00 0Stt!.p0宴s0S 0S0 00 0S0KH-8M0 4 3,K00 40S"2~00S/2v000S"2m0000St"t2c0000!/ 0 0 P,L",2Q0000!0ᱼ00 0S0u0080Si 00 00  '0!K 0 00800Ꮜ0S00 000  '0!K 00S0SE 00 0  00S: 000 000400 000 00040 0 0S$0?S! 0S 0S40  40  00000 J=: ? 040 00 哌0Kط$'Xh)*+H-M  0S )9屳0@0S )8娳0S(8堳0@00 0$0S0&0$0!00 0 ?)K0 ?)K0 ?(K0$0 (KK(K P0'K0$0%00 0 ?'K0 ?&K0 ?&K0$0!%KK&K P0%K)KR&KR@ )KPP&KP`0)KKPp0K 0 0@,@ 00KRP0'KP`0'Kp0 0$KL0;H0 0L0 K 0 0$K'KKP%KKP@00l h 0l b0p0  0t t 0C 0 0 P0$K$KP0ix0l h |0|l b0P0  0T T 0C 0 0 P0$K 0#K80D @0< < D0c 00xlh||l@PP TTa TSR 0#KPp0 #K P0)KP@0< 80  <0c 00K P0)Kዻ 0#K#&KPpp0< 80t t <0C 00K P0&Kl 0#KD @# 32#KPP0#K?P`0000"#KK 0"KK#KE 0"K#K!K"KPp0"KP0!KP@0!K?PP0~K 0 0$ $b 00J>:K 0B 00K%KQPK 0 0'K0$  0  $0c 00 K 0B 00K(KQP 0.p0$  0t t $0c 00K 0B 00K%KQP 0 , 0 $ 0  0 0KX|$>H-M  0S<<$00$0" K4 0$0S% 0$0 00 0$0$0!QP 0 0 ' 0$0$0"QP 0 0 0KDO(XH-M   0SG.1Q0Sx!t1I00ShTd!P1@0 0  0 0 c0" " ", 0!0 " "",  00  000! 0 0 0KDqr0H- HM@ $K@0Sddd"d2ڬ@0SL<H"<2Ь0S40"2Ȭ@0!"K@00, K $KM0S0o,00 0o?0@  0U0100U00100 0o?0$K0SH 0000@70(0 (0S1 @0(00!(B(@TP 00 0S' 80K(0s?08 KK  (00!(@w0S @0 0 $K᙮00 ,0 0 K0سH-"M K 2S 0-2 0KK M0S 2/K,Ƀ2݄?Ko?0@ ^L00K2K$ 0 K K0KUH-(M 0S 0 0 0 0K  00 0S JA3: 0! 0 0! 0KжH-M0Ku00 0s0 0KH-(M 0S"2孫 00S"2夫 00 K  0L0S00 0 00S  0,ك 0 K 5 0!  1<0S 0""", ! 0o?0@ 㫃 0U0100U00100 $ 00 0S 0o?0  B"0 0C0S* 040S 90S# 000 0S 0 0   0f00 00S0 00Э00σ0KĶH-(M    0 0 0S6 0S( (L00 0 @ 0S# 0 $ 0| 0  0  0 0 0  0  0  0   0 @ 0 {0KH-,M 0@ 04 08 0 0"  00 0S0X 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0$0S% 8Ȳ0 0$ 0$0S00$ 0$0@0$ 0$0 00$0$0##0KH-M 0S\\\ \0-0S 0@00 0$00@0KXeH-M  0@00 0 8 00S 0S 00 0S 00W0S 0  0400S 0 0 0  0 JB0:  0  00S 0 0 00 0S 00S 00'S 00S 0 000S 0q 00 0S 0 000S 0 000S 0A 00S0| 00P0S00S 00 000 00S 0000 0 q00ʁ0S00S 0 0 000 00S 0000 0 P00D婁0S 000塁0S0 00 00S 0000 0 -00冁0S 00~0S0P 00r0S0@ 000S 0} 0| 0K - M 0 0  0  0  0  0 Ћ/H- M  0S#3Ȩ0@0S"2忨00S"2嶨0@00 000 00C S񟗟XPP8tPؖPPP040S@X"{00  080X0~0  0S0v|0 0  0R <0S   e0 0 0S0U 0S k0  080 0F 0S \0  08007 0S M0  0800(0  0800 0S 40  0800 0S %0  08000KX|h H-M  0Sb. 10@0S 00@00 00C S+XJC%:4p|d040S000000 00 0 00 0000000KXt|!- M  0S 0#P00S 0S 040S0000Ћ/FH-M   0 0 d 0S0 00 x00 V0K0H- 0M0 4 8 <0 4004   ?"K80S<0j<0S80e80 "K| 00$0 <0 "Kr 00 0 $  0R%80400 ?c 0400 ?Z@P<0400 ?Q 0400 ?HT"00!80 00cS0c ?!K00!<0 00cS0c ?!KK!KP<808<0 K00H- M  00 0 00   ?!K4K!K  00S0vDK!K  00S0j0S- 0!KP0_0 0!K P0dK  !K0S0K0! BTK 0S*09 0"KP!K 0!K 0!K P0dK  !Kp0S0 0"K   0b0S0 0"4PKD@KdKK  00 K00H- M  0 00 0 00   ?!K0!S R+0!K00 ?!K4K 0 !KL0S0\DK!K  0@0S0P0S dK 0  !K0S0@0! BTK 0S0. 0!K P0dK  !K0S0 0"K   0JD?: 0S0 0"4PKD@KdKK  0 0 K00H- Mp t 'Kp0,0 p00(0 t00t   ?"K,0S!1娥<K"K 'K0S0XLK"K  00S0L0S ,0!,lK (}0S,0;,0 0 0"K! 0!K,0!KP 0 0!K,0"KP0lK!K (!KR0S0(0" $0"?KH00H!00 0SA 00q 08 $0 00 A0/K s0S ㋴000 0 H H0S000K {0[0#0S !$00$0 $0S 0S H0HY0K,̸ܼDA H-M  0@00 0400S HH.D1Z0"00"0#4080"0#848#80"0#<0 0 0!00!0#4080!0#848#80!0#<0 0 00,00#408 00#848#8 00#<0 0 K谹̸ȼH-M  0@00 0400S   ! 100,00#408 00#848#8 00#<0 0 JJ*:0!00!0#4080!0#848#80!0#<0 0 0 r 00 qK̸ܹH-M( (20 0 0S$$$%$5壙(b">K,q5 2 0408#80C8#848#( 0408#80C8#8#48#808#8 4 K 0008#80C8#848#( 0008#80C8#8#48#808#8 84 K 080S 080(00 0".K p 0K(20H08#848#((20H08#8#48#808#(t3 K (20L08#848#((20L08#8#48#808#( 3 K (20P08#848#((20P08#8#48#808#(2 K (20!8#848#(20!8#8#48#808#(x2 K 00 00(ጵ00 0S  0001 ">KN?0j000 0S(20"0(20"0#408(20"0#848#8(20"0#<0p0 0l0 4h0 00 00(L00 0S 0"">KH00000 0S0(0 ">K0L">K0#408@">K0#848#8@">K0#<0(0 ">K(,80S (20$0S 00K,̸ A H-(M    0 0 0S0 0S 0 @ 0(㚠 0@ 0@00 0S 0S00 00 T0 o 0"04 0 0  0K(H-,M 0@00 0@ 04 08 0 0"  ឰ00 0S- 00 00 孱0S0 @ 0JK?: !C 0@ 0@00 0S 0 0 0 00:o0 0 0幰0KH-M z0S 0@0S,,, ,0姗0@0hp困K̸NH-M  0@00 0 8 040S0 0040S00S 008o0S0 0 0K$H-M   0000 0S S S. D040S 0S @!30:0S 0000 40/040S 0S @ 0#0S 0000 00040S 0S @P 0 0S 0000 8000K(X-M  0000 0S S S 04 000R0000 000R0008 000R000Ћ/- M  00CS00Ћ/H-M  0@00 040S 00 n0 @ 0嗛K贺-M 0@00 00Ћ/H-0M( (0$K 0 0㌻0S0$0Kk0KH-0M( (0(00 0 0$K   0l0S0$0Kl0KH-M  0S 0[040S000000  J0S 0@ %0K̸| H-M 000s 0L0004000S 00 00徲0S0 0 02000 0Sڸ 00400S 0 0 00 0 S 00嗲0S0 0 0 000 0S@ ƚ0JL%:KT̸+dX- M 0Ћ/- M  0 0Ћ/H-0M 0S!1嵕 厱00 0S 0! 00 00 0 0  Ϯ00 0S 000 0  :0S000K m0[S 00Kt̸WPH-M $=70S000K輸H-M0K@s700 0S $$$ $0S!KK輸̸s0H-M0K@r700 0S $$$ $08!KK輸̸sH-Ĥ谕H-谕-M   00 @0 0   0000# 80!$4@" 00 0 0R:0K/H-MK!KK!K 0 0!K 0K- M 0!0Ћ/- M \0Ћ/H- M @00cKH-M a'00 0 0 0\"]"^", _ 0KH-M 00 0 l0\ ] ^ _0<0@0 l0K0H- M  00 0S 0i0 l0\ ] ^ _0<0Pv 0@z0 k0 K0N H-M 0S! 0\ ] ^ _0<0SXXW/T0)0\ ] ^ _0<0llK 0H- M  0S!10\ ] ^ _0<0S 000 0R00 0S00 kJM0:  0P0\ ] ^ _0<0@0 wk0 K08e fH-M 00 0Sc/0屓00,00#408 00#848#8 00#< 0 0048#(00#48#808#(0 0048#(00#48#808#(0 KDH-M    L00KH-M   0S 0\0Si/0T=00 0S00   0<0 0 k0KT8H-MK0K0 Rk0KH-M 0So/00!1408#(x0R 000  T0 00S0000 0S0K`UH-(M 00 00 0S"2ڒ 0"P0q 0300  0  0Ȕ0S 0 0 0 幔0S# 0 100 0  Ġ  Ƞ  ̠   Ġ  Ƞ 0<00 QP00 OkE0S0#0K0  0a30S00 0 0S0S  00T P00 0S0 0 0%k 0KEFI PARTTl0H- (M( (p0$0 $0SQ 4㭚0 0 $0  $00SB (0! i 0 0 0!K(0 0@P@P(0! S 0 T0!K K!KP 0 0 (!K 0 ,, ! " # 0$0 0$0<$0$j0 K0pH-$M( (000 0 0S0e(0JN3: 00 000 (0 0   @  0<0P0`d`h`l`d`h0<0  0ᛶ0 ! " #0<0 0 "!""", #  0$$ 0 )i 0KpH-M Q001j#KH-0M $ ( 000 $0T U V W0<00 0 ! " #0<0 (0 (00 00!< 000 00!c 00 0Pi0 0@ 00!0 ၙ0 0 0S01 0$0H I J K L M N O0<0 0 0S si000 imi0  0 0KH- M  0K j0 0 0S00 O00 0X Y Z [0<0 0R00  0 vi0KH-K0C0C 0g0S B>K0C0CC0S 0400`"j0S0(0 (0"B>K0C0C<0 0 o0S0  0!K0  0 K!K K 0 ~00 0Sz 0@00 0SY/1ke 00$ 00 0 00}0S0000 0S0KH-M 0S 0`00S,0v`000s 05z0St`p `0f`00 00 000S@4 =e00KH-(M 00 0S   ! 1;`00S 02`0000 00D0  @  ? KK 0 0  Iy00 0S  庀0Sy00Kd- M 0Ћ/- M  0 0Ћ/Jg:H-M $0S000KH-M0K@00 0S $$ - 0_!KKH-M0K@00 0S $$ - 0_!KKH-1oH-XoH-(M  0 0P+ 0{_00!0g00 0S0 7  00 0 00! 00c  70 0  0a00 80K<H- M !K0!0 g00 0S\\D X02_ !K2a0S70 0  0KH<H- M !K 0 00!K0K0H- 8M0 #K00! P@[ 1^00! %h 0"K"Kh 0"K 0!K (0 0, , 0C 00K 0K0a0S08K 0 0!KK"KPP(0 0, , 0C 00 P0!K!KP (0 0, , 0C 00K 0K0$`00 K0T<\-0 @ BRн d @ P @ < @ ( @0 0@0K/xH-P0S'S%0@-TT t00010` 0R 060S 0001 000x`H-(M  6000 0S0.0"0!QP 00!!@t b00!0 QP 00 !@ b00KtH-M  z60Jh:|00 0S00  0KH-M  `60b00 0S00! 0KH-M 800 E60 50S00KH-M   060 0 0R 0 0 00 0 00  000   0RK-M 00 0 000   00 0Ћ/- M 0 S S S S S x S s h S \0 X0 T0P0L0H0D0@0Ћ/GESLTOOBDHSFBDABKSDRTRAP $,4H-M  e00 0S00  0  0KH-M 0 0  000 50 0 0SK-M  00 0 0R0000 0S0Ћ/-M 00 00,00#408 00#848#8 00#<00 000,000#408 000#848#8 000#<00 0 S<0 0 0 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0R0Ћ/0H- M 00,00#408 00#848#8 00#<@z00cL00,00#408 00#848#8 00#<Pa00c#408@00,00#408 00#848#8 00#<PE00c#848#8@00,00#408 00#848#8 00#<P(00c#<0 0 K0H- M  !K 0  !K]0S0Z0S 00, 00#408 00Ji: #848#8 00#<00S0; 0S5 00, 00#408 00#848#8 00#<0O!K ap p0`0S @S0 , 0  !K]0S0 0 0K@$H-M  `00 0 0 ) 0 ?x0S 00,00#408 00#848#8 00#< H0RO 0 00 0 0SD0KKSDRH-M 0Sttt t0@[0!0c0 0 0S0  00 30s00KtOH- M 0SXXX&X6[ 0D0 @  ?!K 0m00 0S0}00!0ec 0 00S30l000 00!P%5Z00!0 (30p% 0! 0 00!000!0#40800!0#848#800!0#< 0 0  0  0  0 0 $ 0 ( 0<0, 0<0#408 0<0#848#8 0<0#< 0@ 0D0, 0D0#408 0D0#848#8 0D0#< 0D 0@0, 0@0#408 0@0#848#8 0@0#< 0H 0 L 0<0, 0<0#408 0<0#848#8 0<0#< 0P 0<0, 0<0#408 0<0#848#8 0<0#< 0` 0<0, 0<0#408 0<0#848#8 0<0#< 0d 0 h !KDc 000 0 0 0C0 0 0,0#408 0#848#8 0#< 0 0, 0#408 0#848#8 0#< 0 0<00CJj : , 0<00C#408 0<00C#848#8 0<00C#< 0 0,0#408 0#848#8 0#< 0 0 0 00 0 00 00 00t 00\ 00D 00Kta oRDSKH-M 0S 0nY00Sk/0eY00St t0\Y000 00dk00 0S000 0 ,00KH-M 0SPPo/L0.Y00S8,4 (0%Y001kK-M   00 0!00 0R0 000  0R:0!00  0Ћ/0H- %MH H2Sw/6XH20S&6XH20!/ 0 0 &6XH20Sd|&`6XH20@0 H20@.0s@@&@6]0H2 @0@0@0@0#408@0@0#848#8@0@0#<0<0H2 @0H0@0H0#408@0H0#848#8@0H0#<0@0H2 @0D0@0D0#408@0D0#848#8@0D0#<0D0@0H0,@0H0#408 @0H0#848#8 @0H0#<0@0D0,@0D0#408 @0D0#848#8 @0D0#<0 0 B 0 0#K#KHzH20!0`0<0 <0S00,0 , 3! PK 0 ,00,0 ,0S0,0 @00,@00#408 @00#848#8 @00#<080 ,0 -K8 0SH2<80 00S<00<00,<00#40Jk:8 <00#848#8 <00#<0 0404B 00"K"K<00,<00#408 <00#848#8 <00#<0 0 0404B 00 0!K"K !K H p0(0 (0S<O00V(0@0<,0/(0, 0 (0 4 (000_ (08 (00ቄ00 0S08H( x0S00 0KG 0[0#0S (p<00",00,0 <00,<00#408 <00#848#8 <00#<080 ,0S80s6</0 K0,H-(M   0 0S$$$#$3W00S #3 W0 0 K 0!000s K a"2[0@S000 0 K0S000,00#408 00#848#8 00#< 0R 00,00#408 00#848#8 00#<0Q00 K @!1[0Y 0!00 00,00#408 00#848#8 00#< (1R0H0,0H0#408 0H0#848#8 0H0#<0  P0S000,00#408 00#848#8 00#<0 0 KK 0QPK0K67`DHSFGESL-M   00 000 0!00 0R 0!000s0Ћ/H-M  r00 r00 0S o0S 0K0H- `M` `0S  -;U`00S +;U`00S| hx+d;U`00!0I^0X0 X0Jl: S0`00XH0$0 $0s0$0 <0 `0 0 000@-)0S0,! 200!)0S0! &00)0S0 00 )0S0 00(0S0 0 0Ko,<LNXEXTSWPFAT FATHFSJFSNTFS$RFS0SUFS8HUFS@XFSH-M   0Sxxx!x1cP0@0SdT`!T1ZP0@00 00CSELLL 0S 00$0 00$0 000S 00$0 00$0 0 0S 00#0 00#0 00S 00#0 00#0 00K<H-M  0S 0O0@0S 0O0@00 00CSDD$Jo: 4004 0040030030K<- M  0S 03r0S 00Ћ/H-M  0S\\>.X0O0@0SD8@ 40O0@00 0$0 K<H-M 0S\\\ \0}O0@0SH8/80tO0@00 0$00K<H-M 00D0  @  ? K K}0K0H- hM` `000 0D0 @  ?!K,K!K  0Z}0S0/<K!K  0N}0S0#0. B0 0\K . 0t0S00",PK<@K\K\K  0[x0 K0H-M  0S 0N00Stdp d0N000  g0S 0@( S0KDH-M 0S 0N00S 0N000s 00 0 00 Nk00 0S0 0 0 00 0 0S@( |S0K'(xH- M 00 0S 0}N00S 0tN00`{00 0 . 0  g0 0 0S   o0S g:y05y0KCpD- M 0Ћ/- M  0 0Ћ/H-M $0S000KlH-M0K@,00 0S $$$ $0 N!KKlhLH-M0K@+00 0S $$$ $0M!KKlh0H-}]H-Jp%:]H-M 800 k&0 %0S00K8-M 0 0 00K 0 0[0"0K 00 0 0?0 S0 [ ! [ !Ћ/-M 0?0 0 00K 0 0[0"0K 00C 0 0 R*0[S00Ћ/H- M 0S 1xM0K0 0V0S0/0 0 00 0!1408#848#( 01408#8#48#808#(d0R 00 0S00 @, 'R0&0KHT8\0H- 0M( (0H00 00   ?!K!K 6M(_0$0 $0S {U $0 $00S $000 00@_(0"!K1V 0UT  5L(0"!Kz 0 00 0 ,2% 00%00100A001 0 ! !008#848#(008#8#48#808#( 0"$("( ! 0  !  ! 0 !  ! 0 ! !008#848#(008#8#48#808#( 0"$("( !008#848#(008#8#48#808#( 0"$("( !(0"!KU 08#848#H(0"!KU 08#8#48#808#( 0"$("( ! 0`000 0000!00000000 0  0  0 0 ! ! ! !0 00 0#4080 0#848#80 0#< 0""", ! ! 01408#848# 014Jq0: 08#8#48#808#8 01408#848# 01408#8#48#808#8 01408#848# 0A1408#8#48#808#8 0A1408#848#H 0Q1408#8#48#808#80 0# $0$9^0 K0T,H-M 000 00H]00 0S000 0 /#0KH-M 00$^K0H- (M  000 0!1408#848#(01408#8#48#808#8 0D0R!0!1408#848#(01408#8#48#808#8 0@0R0 H0< 0!1408#848#(01408#8#48#808#8S  01408#848#01408#8#48#808#8S0001408#848#01408#8#48#808#8S00S00!1408#848#(01408#8#48#808#8 0P0R0!1408#848#(01408#8#48#808#8 0L0R 0H0L0P0!1408#848#(01408#8#48#808#80!1408#848#(0A1408#8#48#808#8 0A1408#848#H0Q1408#8#48#808#8 0`! 0O0@S0h0!1408#848#(01408#8#48#808#8 0P 0!1408#848#(01408#8#48#808#8 0L 0!1408#84Jr3: 8#(01408#8#48#808#8 0H 0P0 L  H  ?P 00`( N0 S 00 K00H- XMP P0S )9IP00S )9IP00S )9IP00@0 PkkP00H K  0f0SF @000 H0,%!H09"P'0S7 P00P0P  L  ?"KP00H0 ?$ $B 00@ 0<0 < 07    !000<0< 07  A@ Ġ A@ Ƞ !0 00<0#408< 07  A@ Ġ A@ Ƞ !0 00<0#848#8< 07  A@ Ġ A@ Ƞ !0 00<0#<0S <0 "0 00S <0 "0 00Sw < 07 !000<0< 07  Ġ Ƞ!0 00<0#408< 07  Ġ Ƞ!0 00<0#848#8< 07  Ġ Ƞ!0 00<0#<0 0$ $B 00"K"K< 07    !000<0< 07   Ġ  Ƞ !0 00<0#408< 07   Js&: Ġ  Ƞ !0 00<0#848#8< 07   Ġ  Ƞ !0 00<0#<0"K 0 0#K"K #K P `080 80S^ 80@0D0 <0 "0 0 D0 D00S  D0 D00S  D0 D00S  D0 D00S  D0 <0 800 800O 808 800st00 0S# P8 h0S00 0K3r 0[0#0S<00<0 <0S0 0 K0T= >?H-M  0 0 00S" 0!1408#848#( 01408#8#48#808#(80R000 00,0K0H- 0M0 00S(8F000Sxht(h8F000( K  00S0(000S(000000 00$0 $0o?@ $00 00 G000Lc00 0Sf0Sc0$ "0 0  $07 !00 0 00 0#4080 0#848#80 0#<$07  !  !  ! !00   0S 0@0 0 0  $"00 @0000P00  L  ?PO 00\0000P00  L  ?@O 00#408P0000P00  L  ?-O 00#848#8P0000P00  L  ?O 00#<$07 Jt<:  ! ! ! !00   0"0!00c00"0!0 0c0#4080"0!0 0c0#848#80"0!0 0c0#<$07  !  !  ! !00   000 0S000H0S000H0 `" 0 0$0R 0$ 00R t  0$ 00R 0 0  00 0 0 p0R 00!t0000-S 00!t00000S 0 0$ 0 p0R0 00!t0000S$ 00 0 0 0$0R 0$ 00R t m 0 0$0R 0 0 0p $ 0p  0 p0R  0 0$0R 0 0 0 00!t0000-S  00!t00000S 00S0 00 t    0 0 00!t00 |0S 00t00000-S000 0 |0S 00!t00000-S 0S 00!t00000S  00!t00000x:0S0T0 0P0 0L0 0H0 0D0 00`0 `00`0 `00S `00=S`  000c\0 |0X0 0@0 IX0 00\ 0S8X000 \0RX0T0 @0D0 0L0 2T0SX0T0 @0D0 0ST0 X00R T0 X00RT0 X0 0R 0<0 <0X  <0P  <0P0 X00X0 @00@0 X00SP0S_ L0S\d0S> T0l0 P0h0 l0KP0 <;t0 00t000 ;*P000 P00P0 P0S:080 80H0S 80 800R*800  80  8Jz): 8Q 0@ 00l0 0 00 0 0  ?0P0040 P40P0 P0ST0S D0@0 00 0 `00SB T00S `0 0 qd0S& 000C!t00000-S L9t0 T00$9t0 000Ct0000T 0@ 00 0 0 T0 0 ?0T00S3 0 p0R 00 t    0 !d0S 88t0 T00N 0@ 000 0 T0 0 x00:S:0?0V 0@ 000 0 0S 0@  T00S T00T  0;T0 080S 00!t00000-S 000x0S4d0S$ 00!t00000-S 6t0 006t0 00t0000 < 04& 00 0 0  ?0 00 - K 0 -0[xc0,0 000S 00 0 ,0S -0[:S -0[;Sd0S 5t0 -0[d- [ 0 ?0,00WS],000;SX0 0 00 00 00 000S 0 0 00 0 ) 0 p0Rd0S 4t0 -0[o- [ 0 x00:S:0-0K?0-0K-0[ 00 t    0 0 0(0 0(  (00(0 (00S (00=S|0$0 00 F$0 0 ( 000c G0S1(  000c@$000T$0 0 00 00 ( 0S$0 0 00 0S 0 $00R  0 $00R 0 $0 0R 00 $00$0 000 $00S0S 0Sd0S 2t0 0 0J{<: \ 0@ 00n0 0 00 0 ?0 0S 00 (00S 00S (0 0 Nd0S 1t0 00 0@ 00?0 0 ?0 00S/ 0 p0R 00 t    0 d0S 1t0 00 0@ 000 0 x00:S:0?0 0 0@ 000 0 0S 0  00S 00  0r@p$Hx 0 0` 0  W0[,000:SU,000:S 000S 0 0 00 0  0 0  : 000S 0 0 00 0 ( 0 p0Rd0S 1t0 -0[ - [ 0 x00:S:0-0K?0-0K 00 t    0 0  -0[KH-(M   0 0 0 0 0 0000h00 0 0 000 <0 00 ,0 ,0 0 0 0K(d,$0H- M   000000  00KH- M   0 000000  00KH- M   0 0000000 0  00KH- M   0 000000  0w0KH- M   0 0000000 0  0V0KH-M y00 (0 $0R0  0K4H-M 00 (0 $0R0  0K4H-(0 0$0 T00K00KO0S `00P000[0#0S 0(0 , D0R*@ ,00(  ,00,0 (00(0 (00S00K0(0 ( 0$0 0000K0[0#0S , D0R*@ ,00' ,00,0 T=(0 0$0 00K, 000 <00K0[S $0S 0 $0 L0RH 000($ \ 0S0[Sk00KH 00000K0[~S񟗝mqqqqqqoooopooqqqqqqqqqqqqqqqqqqpppppupppppuuuuuuuuuuuuuuuupppp nquuuuuuuuuuuuuuuuuuuuuuuuuup pupupuuuuuuuuuuuuuuuuuuuuuuuuuuhpphpp0[S< 0[S, D0R*@ ,00\ ,00,0 00 L0R%*00 H000/S00 H0009S, D0R*@ ,000 ,00,0 , D0R*@ ,000 ,00,0 000K000S N0S S 0[S00S 00 L0R*00 H000?S00 H000!0CS #80S 0[Su00 H0000K00000 , D0R*@ ,00? ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00? ,00,0 a00K"b00Kf00Kn00Kr00Kt00K J~0: v00K0[0K0[S 0[S $0S0S0[S0[Ss 0[0KL0sH000S000L0S000S`00S_0S^0[S] 0S[0[S, D0R*@ ,00' ,00,0 , D0R*@ ,00\ ,00,0 , D0R*@ ,00' ,00,0 40[S 00 6 0[000@0S000K80K 00 00KL0sH 0L0 0 0 H00 00L  c<K80K 00 0Sn 0s00Kk0s00K000 0 0 L0R[*0 0 H000SS0[S: 0S70 0 00 0 0 H000[0C!S!xxsxsxsssssssssssssssssssssssssssx 00 0 0R:<00S00K 000 80K 0S 0S0[S 0[0#0S 0 000 0[S9 0[0#0S4 0[S, D0R*@ ,00\ ,00,0 , D0R*@ ,00 ["# 0  ,00,0 , D0R *@ ,0 0[1000000,00,0 0[0000K0[S , D0R*@ ,00\ ,00,0 00K00 0R_*, D0R*@ ,00 [ ,00,0 00000 H 00000K 0[0#0S 0[0#0S 0S 0[20! 00 0[030S0[0#0S0[Sz, D0R*@ ,00\ ,00,0 , D0R*@ ,00 [ ,00,0 00000 L0s H 0000S000 ptxQ80 L0R000S,0S0S0[S9(0S 0[J%:0#0S , D0R*@ ,00(  ,00,0 (00(0 (00S, D0R*@ ,00 ,0# 00 0000 000@DH L00KH-8M  $0 0S 000 00 0 0000( 0,0 0 $000 0  0KH-M     00KH-@M $ ( ,0 ,0S ,0 10 000 0 (0S0000 000( 0,0 0 $0H00 0 00 000( 0,0 0  $0.0  (0S 0 C(0 0KH-M00 0 00 0! 000000 00 R: 0 l0R 00T0, H0@  80R 0 0 KD8<H-TM8 < @ D0 B0000 80,0 p20(0 80SX2 ,0R4,00$0 ( 82R000K$0s0[S 0(0$ !?0(0 1(  0[S (0!10!(0 10$0c1 |1$  80!(0000 80!(0000 D0000 D0D0D0( D0,0 0< @0t00  0R+80!(00      0R 80!(0@00 00D0D0D0( D0,0 0< @0B00  0KD8<H-M    0F0KH-M     060KH-M 0KH-M   0KJ%:H-@M8 < @ 40K<40K8@ 0KH-@M8 < @ D0 40K<40K8@D 0KH-M   0KH-M    00KH-@M8 < 0=0KX04K4 K=0[ 40K8< 0KH-M 0 0K 0[ 0KH-M :0KH-M   : 0KH-M   0 00  00KH-@M8 < @ D0 T04K40K<@ 40K8D c0KH-M    00KH-M   0 00 00KH-Mx | x00 0S 0 Cx000/S t0Kx;0Sl0 0x| 0KH-M  0S00 00 0S00 00 0KH-M   90KH-M  0 0 0S00: S 200 0 C000/S0 0 0KpH-4M  $0 0S ,4$    0z 4 $0s#3n 00 S$(Dh4 <00 T0 000tK0 000D>0 000 -0 000 0 000  T0 000@ @ J0: i0 000P @P@ dH0 000` P@ `P@ #0 000` P@ `P@ DwKp| `p<lH- M   0 00 000 0!000S0000 0KH-HM8 < @ D0 00 000 0 S0 + K  + 1K000S00K0008<@ D0K0-H-$M   0 0 00 0KHЍ/H-00x,,, t(00$? m(LH-00 0M$H-M  .0 0R*0 a0KH-M   .0 0R* 0 [0KH-M   000 0S0S@.00 0S00 00 p.0 0R000 00 0  0 !0K說H-M 0KH-M 00 0S0S n0KH-M  0S0S  0  g00 0S 0S O0KH-M    0KH-M 0 i0KH-M  $00 0S!0KH-M  0 0KH-M 000K- M000S$0J3: 0 0  Ћ/(0- MK $ !40*"*0@P0>00K0/- MK  ,&  6000Ћ/H-(M( , 9 0 00 0 ,0 ,00S0e,0 00$0 ($)00 0S0S$ / 000 0 0 0 ,00 00 0S 000 ,00+0  03,0  0S,00,0 0#,0 00o0 0 0S 000 ,000  0 ,0  ,0 00 0KH-(M( , 0 0 00 s00 0S0] 0Kj0S0R 00  00 A00 0K0 0S   0S%00 # 0$0 $0S $00,E0S $0K 00  (0R 000 [ 000  g00 0S 0u0K- M 00C6S8강00Ћ/- M 0GS0OS0gS0oS00Ћ/- M 0OS0WS00Ћ/- M 0S0S00Ћ/H-M 0KH-M  0S 0(000S  0(00\0S00@00#00P8 0,0S 0K4H-M 0X00 |0KJ&:0S0l0: S 0 0%K00 0  %K0 0 0  0S 0 S 0@S0GS0S 0S 00S0 0S 0?0S0 00S 00S0 0rS 00S0 0S 00S0 w0^S 00S0 l0pS 00S0 a0S 00S0 T0S 00S0 G0S 00S0 :0bS 00S0 /0S 00S0 $0S 00S0 0S 0 0S0 0 S0 0 0KH-M00s 00'c?K0S 0 00c?Kp.Ke?KfK0S H0 <00 1(14 1 0 00KĖH-MP00s @00 00  (0R  0 00KH-$M 0X00 ,0!,0!0(0S 0& 0R,0!$0 0K 0S 0@00!00,0 L 0R+0 ?!0!!K(h8H-MY00  D0R0  00R $0R00KH-4M0 00X00 0"K00(0Stt/p1)&00!/ 0 0 @4K[ 2 1[0S 1[0S 1[K 0S0|>K0K\tH-M  0X00 0 0 p0Kh c0p0 `0l0 0h0K05020g0K`0d0K0f0K0e0K0c0K0 p0K s0S0 Kp0K0 00K0K 0 Kp0K0 0J):0K0K 0 0KH-M   lk 0 Xe 0 00S 00S 0  0KxH-,M( (0X00 ($0Sm 0 0K 0S(0 %(0 %(0@0000`\!0j(0 SB(0S? ($0E08#((0%08#((0%+0 (0 (00S)  K 0K( 0S (0  00 0(0 x0 (~0S ($0 ($0KSK-xM 0K0Sp L$0Sm ,0!0$0 $0S $0 0 0S 0;;S 0 ?!0!!|0: S 0"K0!, 0"0"P 00@ 'A$*>$0"lp 0C@S 00H 0 L 0 P 0 <0H <0 0 00KdK-M  0Kt0Su #0Sr '0S 'ZM 06''\3''00`|!a'0 0 0 S @SL S;"'K ?Ϡ Ϡ 0;0 *K 0d`t 0"0"Ϡ Ϡ 塌 0C@S 00H 0 L 0 P ,0!,0!ddd d01"s0 0 #0#0KhlH-M   \ 0 H 0 00S 00S 00KH-M K0K 0S p 0Kp0J*:080 K (0b0K(0KH-M 0S```$`4!` *00 0S 0 0 00S * 0X 0X0S 0X0 0 0 0 ( 0 , 0 0 0 4 0 8 0S 0 0S񟗞ꄳԱ\̲x@h$Գj0S0S0S0S~0Sy0St0So0Sjl0SexT0S`q0S\k 0 0Sg " 0 0K 0s\ 0m0S000K00[0#0S= J\0S8CU0S3<0S/6\H0S*/DA0S%(@(!%# 00X0{00uq0K(@Xt0LH-M 0X0 0 0 00 M0X0I00E00A?KH-M 000S 000 0 0 0S0 00 0S 0000 0S0KH- M 0X00 0,0SK0 4 00,p0SA00 80 0 0S8 U0S&  t00 0S0S0S00000T 0$0S 000 0SKaxH-M 0X00 0J?: 01 0 00s4Y00X00 00 0 00s0@D00C00P 0$0S 000   H $0 , 0 , 0SL0K- M 0Ћ/H-M 0X00 040S 0000S00)0S0@00000 0B$0S 0KxH-M 040S 0K0H- (M "K 0!/ 0 0  01 0S 0) 000S  0  0X00 0!,(,B 00!K!K00 !K!KQP00 K0cdeH-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K F0sP00O0  pT #00 0@S00S 0K{|l0H- 0M( , #K(0X00 0 0 (0S#3(0!/ 0 0 #3 3R<(0 0S8 (0"000S1 K  0(0B 0 0QP  0 0 (,#K` 0S 0 00$,00(S0S 00(#K0S (0!0 0 (0!0 K 0S&'000(  p"#00 0S SS S @S 0d"0a!10Z0 0 00 0S 0,  0R 00?0S0 0c0 0, J?: 0,0 20S@@[00Z0(  p "00 0S SS  S @S 0|0 d" 0u0<D 0 K0l<H-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K 0s000  pT E"00 0@S00S 0Km\0H- 0M( , #K(0X0 0 (0!/ 0 0 #30(0,0S (00`# "0 S 00" p3R?(0 0S; (0"000S4 K  0(0B 0 0QP# 0 0 (,#K:0S 0 0(0!0,00(I0S 00(#K0S (0!0 0 (0 4 (0!0$ K |0S&'D00C0(  p!!00 0S SS S @S 0YQ!0V|`x!`10O$0, @$00 0 $0 00  0RF070S0 0c0 $ 00$0 *000(  p L!00 0S SS  S @S 0 !08< 0H K0!ttlO\{H-(M $ "K 0X00 0!K 0SXXX!X1% "K0S 0E04 K 0S 08 0!K)0!K P0 0!0  00 0S 0$ 0S0 0!% 0K 0!KK J*:P0!KKhH- M 0X00 0050 0 0S0%?00>0  pp 00 0S SS S @S 0L 0 0K\l\H-M 0S||| |0000S hXd X0w0,0S 0 0S00KPH-M 0Sttt t0R000S `P\ P0I0,0S 0r0S00K@- M0  0K@0 0[0000S   0R00Ћ/H-M /0S 00 0 0 ' ??  0cS000 00S0000S0000 000S 00 0 0S00S00KH-BMM00 !100 0S0[">K g0SO ">K _0S-G2>K0S 1@2>K@0 C1 K 000000S A>K 0C0C A2.KA>K 0C0CA>K 0C0C">K &0S "K` K0K K2K0S 00 0KtH-M d00 0 00 j0S0000 00S0K萖H-M000 0S40A 000S- 000S(0.K 00.K!>K0 00!S 00.S0/ 000 00S>Kv"0 0 0S0KH-t]p[lYhWdU`J):S\QXOTMPKLIHGDE@C0 $0<HT`lxH-y0S-H-M0 0 0K V00 0S00KHЍ/H-M  00+00 0S0 00C00S 00C 00 00 0 *0 0S 0 0S 0 0S 0 0 S |0 000C000000S H0D00 008 00 0 0KdH-M 00 0000KH-Mx K 0x00 0S 0*K G>K0C O0SG.K Bt0K_0S K\0K QPK0 ?K 0S>0KtH-MKX K0S D K0S0 K0S 00KH-pMp l0Kp0S 0 \0: S 0$K0KH-M u20S000 0000 0 0S0 00 Y0S00KH-M 0SHHH H000040S00K H-M 0S 0a0S 0040S0<00 0S 0000 0S0K H-(M $ ( 0X00 (00 00 00 $0 0 0 0K  0S00Ki0H- M  0S"200!/ 0 0 TDP"D2o0S000b,0S 300 00 0 000E00 0J<: S0f0K #000! B 0 0*K0400S 0"SR,0+0*K 000! B 0 0*K0000 0 K @ 0S 0KT0@ Y0 0K O0S00 0K0 K  `< `0 S000 K03 4 PH-M  0S00K 00 0 0K 0KH-M @000 K 00 0S0S@0! K000 0S@0d 0K 0S00 0Kc 0[S 0S0@0K,t@H-\MX X0SLL.H6X00S4(0&$6D0KX+0S D0@X000T:X000D0D0 X000D0 D0S0_0@0 D00<0 <0S0RD01(080 80S? @540 000 000%40,0 0(0 B(0S 400K00 ,0!<000S"0!<0@00X(000!80@0000!<000S0!8000S00K000 D0 R0[0#0S(00(0 ( ,0R:0(0 X(300 0S{ (00C!<000S](00C!8000SU 0%KX00(00 0S 00 0s L0K  0ST0K 0S @"00s KX00!R 0%KH00!QP"0"%KQP(00C!<00 X0Sr00q00P!(0hJ&:(00(0 D0( Rt0$0 0(0 1(00C!<000S#(00C!8000S $0S D 0100$0 $0S: $0 $F $0 1( (00(0 D0( R$0S0@0 $+0 C$00 X0000` $0j0 S0@0 $B8:<8@0KD '@BrXH-MP00s @00 [00  (0R  0 00K茖H-M 0S000 0S 0S888 80 0S00K -M  00,00#408 00#848#8 00#<0S 0a030C!000,030C000#408 030C000#848#8 030C000#<0S 050 0 00 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0# 0R0S 00Ћ/H-@MH L 0 0 00 00 H0S8 |4H00Sh\9 X4 040$0 $0S@,$,4XH$0S[ $00,$00#408 $00#848#8 $00#<00 $00,$00#408 $00#848#8 $00#<00 0S 000 $00,$00#408 $00#848#8 $00#< $00$00#408$00#848#8$00#<03 0 $ 04p0@0 @0S@h"`2H0H0  @0SH0 @"2t@00,@00#408J3:  @00#848#8 @00#< L0R\H0 0 ? 00 ? P0#KK 0 0OP 00b "KH0@0"K 0 ? b 0 0 0#K#K   0H0 0 ? @#K0S#K @x d0f @ \0S@ 04 ,0$,04S@%c04,044S@$Y0*, B> @$M040000 ,00$,004S@l$;0 ,004SS00 0408#8, $ ?, 00' ( ) *0<0 ,0@$,0 p$, E>ӀK, 3,044 ?  0 0K 0,x ,0t4",044 0 0,@ , 03, (3 0,F ,004Se00$ % & '0<0, $ 0, 00C D E F0<0 ,0@$,03, $ ?,X ,03, $ ?,4 00, - . /0<0 ,0p$, 0 , 0 , E>ӀK, 1,044 ?  0 0K 0,F , @1, F> P, B>  0,0($,0040(0 ,0(40, 0 tpd(0 ? 0R , 0 TPD(0 ? 00 C,0($,042 ,0,$0K $\8XxHhH-M 0SXXX X0(,q0< 0Z0( 0K6 H-M  0 00 0S\\\'\700L 048#848#(0 "$("(  B>04 ?J: 0 0  E>04 ? 08#(0"$("(  044 0 004S0t48#80 #48#800 604 ? 0@P004S"0    504 ? 00 "!""", #  $504 ? 08#(0"$("(  0 ! " # 0  048#(0"$("(  048#(0"$("(  00 0""",  004S0    304 ?; 00$"%"&", ' 0 ( ) 0 * + 0p$0,"-".", /  204 ? 08#(00"$("( 1  d204 ? 08#(02"$("( 3  0<<@00A0040 0) B 0@$0C"D"E", F 0G0p +0R0\ %= 8104 ? 08#(0"$("(  0 $ 0) & 0@$0'"(")", * 0+0t 060d  0U0100U0010KCl L8HhXdpH-M  0 00 0S 00 0  0-0S0004S0 `0  -0S000l-0KT J:hH-M  0 0 0 0Si/00 0  ,0S0%0!  1<0 |0R 0!  1<0`@ 00 0@S00K|< HrrAaH-M  0 00 0Sppp p0~0 `0  '-0S000,0K|$ H-M 00 00K000 00/S 0 0  00/S00K0[S 00 00K 00 0 00S0Ћ/H-M 00 0 0  00C 0 0S 0 C000/S 0KH-M  0S 0S00 00 0 0 0 0R 0 00 0 0KH-M s0S000K0S000K!0S000K0[S 0[S 0[SO00 S 0[0#0S E0 00KH- M 00 00 ;0 0 0S0)0S +0  00 0QP ?0S 000 00 0S 0  00 0KH-M `,A00 0S@0 0"SJ(( 0  0K H-M   0 0 0R* 00 00 00C 0 C00 "00 0KH-M   0S0S 0 "020 000  0 0 0S00 0 00S O0 0S 00S00 0}r0  0K H-M  J : \0#90 00 0S (0#9 0cf0KC@B0H- M  0@0 ? 0T 1 0$0 ? 00 P@ 1 000 ? B 0 0 0 K0H-M   00 0 00 0S000  B S0KH-8M0 4 8 <0 00 80S80$SS 440S$0K40 0 0 0 8  0"K 0 00R0S 000S 0000S  0"K000S 00"S 000 0S"K< 0 000S ;0 0 0 0000S"K< 0000S 0000DS iS BS  0000BS  00 0 ?0 00 0 000B0C5S񟗍<-..d-.-...-.-..-........@.`........ -X-...-...-.-.........$.,0K00 V,0K00 O00 L,0K 00 D,0K 00 <,0K 00 4,0K 00 ,,0K 00 $,0K 00 ,0K00 ,0K 00 ,0K 00 "K< 00 000 0 0 0 000S 000 "K< 0K0 X d H-M h0 0   00c0 00 0S  00 0R:0KH-M10sZ0K7 1 10s t1 l1J: 0S\1000 0S41 00 zh08@0 $0 "00".[08#(08#80"8#88#(0 08#(08#80"8#88#(0  00"C88#(d0 0K 00"00 00C0 0S 00Kp  0H- (M0 4 400 {00 00 000 0S$ 0 0 0 0S 0S000   S   00c0 0 00 00 0S000 0 0 @0P030 0"000000 00 0 40R(0K 00@08#8 0"8#88#(0 000 0 0 @0P(0K030 0"000000 00 0 40R(0K K0H-MMH  00 0S0hC>K0C 0C+*;@0 C>K0C 0C<0 @0Kl J0S0O@00 0 0 C<0 000 08 K 80K .0S*80K00 00S000S000S000S 000S000S H4S H :F0 0 0 0 0R80K'H-PMP T X \0 (60sw00 B. 5 l50 5 50S50 5 03K03K080 040 000 p50S'l5000 S 00S 050}505 4 <0K 0S40S4@ KD0KHKLK0S@08#89#9|$0D0 p4 H0 `4 L X4 L40S<40S(g409#9 $0J:%30 C3 ,0K, 30R , 30R( 30R3008#89#9t#0t3 d3, K, L30R( 830R ,30 S30 3 3 2, K( 0100 200 ?"K,0 ?` 00K 0"KK? 0"K\0S= \00S9\00 C020 $2 2 20qA?0c 1 11C!? c0100 c1 1 10aA?0c 1 1 1sC?0cx0cX!0810S8410$1@ 10 10 !00 00000S 00 000003K`0 <0K 0@P P0 $ T0 40 X0 0K@    gfffC@B  H- M  0 0 00  9 00 0SB00 S =00S 0S 0S000   S 0S 000S00 0 0c 0 0 00 00 0 0S 0KH-M00 0 0 5 0S( 00 0 0RK H-NM( , 0! 0\0 0 0  600 0S00C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$//SRQPM`-QЍ /SRQPM`-2Ѝ /@-mp@- 0P@Pp@ p0p@- D0`p/@G (0 0&  Ѐ=C-@P`pNT$ 0`Vp 0`C-@P`pT$ 0`Vp 0` *& *Z>>*SJ51:3////QO-`MSS@P3R??oS c0"C$S *x'x % SI* SI c   XXWPJ*WJ p\BpV 0 r0ЍR@oZ d($x   Z % SIJ: * SI c  G8#XXXPJ*XJ poW g201;(   ' "Ƞ'8P0Kt:@` 0 @ ("Ƞ 8Z0@D[:j *Ƞ" H"(Q:Ppp Wt Jpq r0`0p`* pj57J;$x _(" ,8R0K(:b K Ƞ ,8R0I*RI0 Z bM\R!0-Z0@DPK0RK0SO-@ M`pP3R?oS c0"S%h H$H ( SI* SI c p m("TpG*TpG SooV~ f20v4'    K0 H #6 RI: b  0 P 6 8#(0(T PE:@d )#X  " (,T:RQ? I<RPoY6@e!%x` (( SI* SI c r@ Ƞ,Z@D*Z@D SR! Ѝ pi8Y4g%xL* ,hHS@K :@c9`H$8HR@`F*R`F@@b hT PEo RIWSK@0 0 R =) -L nonecylinderminimaloptimal@gHgTg\ghelplistmachinescriptversionalign-pretend-input-ttyghglgmgJ:sgvgagdisplays this help messagelists partition layout on all block devicesdisplays machine parseable outputnever prompts for user interventiondisplays the versionalign=[none|cyl|min|opt]alignment for new partitionsgLhghhghghghhiNUMBER is the partition number used by Linux. On MS-DOS disk labels, the primary partitions number from 1 to 4, logical partitions from 5 onwards. LABEL-TYPE is one of: FLAG is one of: UNIT is one of: desired alignment: minimum or optimalPART-TYPE is one of: primary, logical, extended FS-TYPE is one of: START and END are disk locations, such as 4GB or 10%. Negative values count from the end of the disk. For example, -1s specifies exactly the last sector. STATE is one of: on, off DEVICE is usually /dev/hda or /dev/sda NAME is any word you want Copyright (C) 1998 - 2006 Free Software Foundation, Inc. This program is free software, covered by the GNU General Public License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %s... %0.f%% (time left %.2d:%.2d)Partition %s is being used. You must unmount it before you modify it with Parted.Partition(s) on %s are being used.The existing disk label on %s will be destroyed and all data on this disk will be lost. Do you want to continue?ped_geometry_test_sector_inside (range, *sector)parted.cwhat == SECT_START || what == SECT_END0start_dist >= 0 && end_dist >= 0start_dist >= 0end_dist >= 0ped_geometry_test_sector_inside(start_range,start)ped_geometry_test_sector_inside (end_range, end)start <= end -%c, --%-25.25s %s New disk label type?ext2Partition type?dvhPartition name?File system type?Start?End?user_constraint != NULLdev_consJ:traint != NULL Is this still acceptable to you?You requested a partition from %s to %s. The closest location we can manage is %s to %s.%sThe resulting partition is not properly aligned for best performance.ped_partition_set_name (part, part_name)Partition number?, dev != NULL%d:%d:%d:%s; BIOS cylinder,head,sector geometry: %d,%d,%d. Each cylinder is %s. unknownCHS;CYL;BYT;%s:%s:%s:%lld:%lld:%s:%s; Model: %s (%s) Disk %s: %s Sector size (logical/physical): %lldB/%lldB Partition Table: %s devicesfreeall%s (%s) NumberStartEndSizeTypeFile systemNameFlags%2d %2s Free Space%d:1:%s:%s; free;A %s %s partition was found at %s -> %s. Do you want to add it to the partition table?searching for file systemsNew device?part->disk == diskpa->grain_size != 0alignment type(min/opt)%d aligned %d not aligned Flag to Invert?New state?Unit? %s %s align-checkalign-check TYPE N check partition N for TYPE(min|opt) alignmenthelp [COMMAND] print general help, or help on COMMANDmklabelmktablemklabel,mktable LABEL-TYPE create a new disklabel (partition table)mkpartmkpart PART-TYPE [FS-TYPE] START END make a partition'mkpart' makes a partition without creating a new file system on the partition. FS-TYPE may be specified to set an appropriate partition ID. namename NUMBER NAME name partition NUMBER as NAMEprintprint [devices|free|list,all|NUMBER] display the partition table, available devices, free space, all found partitions, or a particular partitionWithout arguments, 'print' displays the entire partition table. However with the following arguments it performs various other actions. devices : display all active block devices free : display information about free unpartitioned space on the current block device list, all : display the partition tables of all active block dJ: evices NUMBER : display more detailed information about this particular partition quitquit exit programrescuerescue START END rescue a lost partition near START and ENDrmrm NUMBER delete partition NUMBERselectselect DEVICE choose the device to editsetset NUMBER FLAG STATE change the FLAG on partition NUMBERtoggletoggle [NUMBER [FLAG]] toggle the state of FLAG on partition NUMBERunitunit UNIT set the default unit to UNITversion display the version number and copyright information of GNU Parted'version' displays copyright and version information corresponding to this copy of GNU Parted partedGNU partedhlmsva:--alignUsage: %s [-hlmsv] [-a] [DEVICE [COMMAND [PARAMETERS]]...] No device foundWARNING: You are not superuser. Watch out for permissions.You should reinstall your boot loader before rebooting. Read section 4 of the Parted User documentation for more information.You may need to update /etc/fstab. partition_align_checkscsiidedac960cpqarrayfileataraidi2oubddasdviodasdsx8dmxvdsd/mmcvirtblkaoemdq}}}$}0}8}@}D}H}P}X}\}`}d}l}t}x}_print_disk_geometrydo_mkpartsnap_to_boundariesprefer_snapsnap%sline_length - indent > 10strlist.c %*sstr_list_print_wrapGNU Parted 3.0 Welcome to GNU Parted! Type 'help' to view a list of commands. Usage: parted [OPTION]... [DEVICE [COMMAND [PARAMETERS]...]...] Apply COMMANDs with PARAMETERS to DEVICE. If no COMMAND(s) are given, run in interactive mode. You found a bug in GNU Parted! Here's what you have to do: Don't panic! The bug has most likely not affected any of your data. Help us to fix this bug by doing the followingJ: : Check whether the bug has already been fixed by checking the last version of GNU Parted that you can find at: http://ftp.gnu.org/gnu/parted/ Please check this version prior to bug reporting. If this has not been fixed yet or if you don't know how to check, please visit the GNU Parted website: http://www.gnu.org/software/parted for further information. Your report should contain the version of this release (%s) along with the error message below, the output of parted DEVICE unit co print unit s print and the following history of commands you entered. Also include any additional information about your setup you consider important. 3.0 Error: SEGV_MAPERR (Address not mapped to object) 0ui.c Error: SEGV_ACCERR (Invalid permissions for mapped object) Error: A general SIGSEGV signal was encountered. Error: FPE_INTDIV (Integer: divide by zero) Error: FPE_INTOVF (Integer: overflow) Error: FPE_FLTDIV (Float: divide by zero) Error: FPE_FLTOVF (Float: overflow) Error: FPE_FLTUND (Float: underflow) Error: FPE_FLTRES (Float: inexact result) Error: FPE_FLTINV (Float: invalid operation) Error: FPE_FLTSUB (Float: subscript out of range) Error: A general SIGFPE signal was encountered. Error: ILL_ILLOPC (Illegal Opcode) Error: ILL_ILLOPN (Illegal Operand) Error: ILL_ILLADR (Illegal addressing mode) Error: ILL_ILLTRP (Illegal Trap) Error: ILL_PRVOPC (Privileged Opcode) Error: ILL_PRVREG (Privileged Register) Error: ILL_COPROC (Coprocessor Error) Error: ILL_BADSTK (Internal Stack Error) Error: A general SIGILL signal was encountered. : command_line != NULL'"str_list_match_any (possibilities, def) /[]? ]? invalid token: %s%d*valueExpecting a partition number.Partition doesn't exist.Expecting a file system type.Unknown file system type "%s".Expecting a disk label type.*value != NULLprimaryextendedlogicalJ:Can't create any more partitions.Expecting a partition type.onoffoptimalminimalOPTIONs:COMMANDs: Report bugs to %s bug-parted@gnu.orgUsing %s (parted)This command does not make sense in non-interactive mode. command_line_get_disk_typecommand_line_get_disk_construct_promptcommand_line_pop_wordsa_sigsegv_handler ncols >= 0table.ctt->ncols > 0s != ((void *)0)**s == '\0'table_render_rowstable_render_rowtable_add_rowtable_calc_column_widthstable_destroytable_new3.0[%d] %s:%d (%s): %s Assertion (%s) at %s:%d in function %s() failed.path != NULLdevice.c/dev/mapper/dev != NULL!dev->external_modedev->open_count > 0dev->external_modebuffer != NULLped_device_sync_fastped_device_syncped_device_checkped_device_writeped_device_readped_device_end_external_accessped_device_begin_external_accessped_device_closeped_device_openped_device_get_ped_device_probeInformationWarningErrorFatalBugNo Implementation FixYesNoOKRetryIgnoreCancel8<@DHPXn > 0exception.cA bug has been detected in GNU Parted. Refer to the web site of parted http://www.gnu.org/software/parted/parted.html for more information of what could be useful for bug submitting! Please email a bug report to %s containing at least the version (%s) and the following message: bug-parted@gnu.org3.0%s: %s Out of memory in exception handler! ex_fetch_count > 0ped_exception_leave_allped_log2fs_type != NULLfilesys.cfs_type->ops != NULLfs_type->name != NULLfs_types != NULLwalk != NULLalias != NULLfs_aliases != NULLname != NULLFile system alias %s is deprecatedfs_type->ops->probe != NULLgeom != NULLped_file_system_probeped_file_system_probe_specificped_file_system_type_getped_file_system_alias_unregisterped_file_system_alias_registerped_file_system_type_unregisterped_file_system_type_register3.0J:Out of memory.handler != NULLtimer.cnest_frac >= 0.0nest_frac <= 1.0ped_timer_new_nestedped_timer_newsBkBMBGBTBcompactcylchs%kiBMiBGiBTiBCannot get unit size for special unit 'COMPACT'.0unit.cdev != NULL%lld,%lld,%lld%lld%s%1$.*2$f%3$s,.-%d %d %d"%s" has invalid syntax for locations.The maximum head value is %d.The maximum sector value is %d.The location %s is outside of the device %s.%lfInvalid number.ped_unit_formatped_unit_format_customped_unit_format_byteped_unit_format_custom_byteped_unit_get_sizedisk_type != NULLdisk.cdisk_type->ops != NULLdisk_type->name != NULLdisk_types != NULLwalk != NULLname != NULLdev != NULLPARTED_DEBUGprobe label: %s %s: unrecognised disk labelold_disk != NULL!old_disk->update_modeold_disk->type->ops->duplicate != NULLold_disk->type->ops->partition_duplicate != NULLgptgpt != NULLtype != NULLtype->ops->alloc != NULLbios_geom->sectors != 0bios_geom->heads != 0disk->update_mode == 0disk != NULL!disk->update_modeThis libparted doesn't have write support for %s. Perhaps it was compiled read-only.part != NULLPartition %d is %s, but the file system is %s.disk->type->ops->get_max_supported_partition_count != NULLdisk->type != NULLdisk->type->ops->get_max_primary_partition_count != NULLThe flag '%s' is not available for %s disk labels.cylinder_alignmentUnknown disk flag, %d.part->num != -1part->disk != NULLdisk_type->ops->partition_align != NULLpart->disk->update_modedisk_type->ops->partition_enumerate != NULLdisk->update_modedisk->type->ops->partition_new != NULL%s disk labels do not support extended partitions.part->disk->type->ops->partition_new != NULLped_partition_is_active (part)ops->partition_set_flag != NULLops->partition_is_flag_available != NULLpart->disk->type->ops->partition_get_flag != NULLpart->disk->type->ops->partition_is_flag_available != NULLdisk_type->ops->partition_set_syJ: stem != NULL%s disk labels do not support partition names.part->disk->type->ops->partition_set_name != NULLpart->disk->type->ops->partition_get_name != NULL!(walk->type & PED_PARTITION_LOGICAL)!walk->prev || walk->prev->next == walkwalk->type & PED_PARTITION_LOGICALwalk->prev->next == walkloc != NULLpart->geom.dev == geom->devext_part != NULLpart->disk == diskpart->geom.start >= 0part->geom.end < disk->dev->lengthpart->geom.start <= part->geom.end%s disk labels don't support logical or extended partitions.Too many primary partitions.Can't add a logical partition to %s, because there is no extended partition.Can't have more than one extended partition on %s.Can't have logical partitions outside of the extended partition.Can't have a logical partition outside of the extended partition on %s.Can't have overlapping partitions.Can't have a primary partition inside an extended partition.part->part_list == NULLped_geometry_test_equal (&part->geom, &old_geom)metadatafreeextendedlogicalprimarybootbios_grubrootswaphiddenraidlvmlbahp-servicepaloprepmsftresatvrecvdiaglegacy_bootUnknown partition flag, %d. %-10s %02d (%d->%d) ped_disk_printped_partition_printped_disk_minimize_extended_partitionped_disk_get_max_partition_geometryped_disk_maximize_partitionped_disk_set_partition_geomped_disk_delete_allped_disk_delete_all_logicalped_disk_delete_partitionped_disk_remove_partitionped_disk_add_partition_check_partition_check_extended_partition_partition_check_basic_sanity_disk_check_part_overlaps_partition_get_overlap_constraint_disk_raw_add_disk_raw_remove_disk_raw_insert_after_disk_raw_insert_beforeped_disk_get_partition_by_sectorped_disk_get_partition_disk_check_sanityped_disk_next_partitionped_disk_extended_partitionped_partition_get_nameped_partition_set_nameped_partition_set_systemped_partition_is_flag_availableped_partition_get_flagped_J:partition_set_flagped_partition_is_activeped_partition_destroyped_partition_new_ped_partition_alloc_disk_pop_update_mode_disk_alloc_metadata_disk_remove_metadataped_disk_enumerate_partitions_partition_enumerate_partition_alignped_disk_is_flag_availableped_disk_get_flagped_disk_set_flagped_disk_get_max_primary_partition_countped_disk_get_max_supported_partition_countped_disk_get_last_partition_numped_disk_get_primary_partition_countped_disk_checkped_partition_get_pathped_partition_is_busyped_disk_commit_to_devped_disk_commit_to_osped_disk_destroyped_disk_new_freshped_disk_clobberped_disk_duplicateped_disk_newped_disk_probeped_disk_type_getped_disk_type_unregisterped_disk_type_registergeom != NULLcs/geom.cdev != NULLgeom->dev != NULLCan't have the end before the start! (start sector=%jd length=%jd)Can't have a partition outside the disk!a != NULLb != NULLbuffer != NULLoffset >= 0count >= 0Attempt to write sectors %ld-%ld outside of partition on %s.checking for bad blocksdst != NULLsrc != NULLped_geometry_mapped_geometry_checkped_geometry_writeped_geometry_sync_fastped_geometry_syncped_geometry_readped_geometry_test_sector_insideped_geometry_test_equalped_geometry_test_insideped_geometry_test_overlapped_geometry_setped_geometry_destroyped_geometry_duplicateped_geometry_newped_geometry_initconstraint != NULLcs/constraint.cstart_range != NULLend_range != NULLmin_size > 0max_size > 0min != NULLmax != NULLped_geometry_test_inside (max, min)geom != NULLconstraint->start_range->dev == geom->devped_constraint_is_solution (constraint, result)okped_constraint_exactped_constraint_is_solutionped_constraint_solve_nearestped_constraint_doneped_constraint_duplicateped_constraint_new_from_maxped_constraint_new_from_minped_constraint_new_from_min_maxped_constraint_inita >= 0cs/natmath.cb >= 0J: align != NULLped_alignment_align_nearestped_alignment_align_downped_alignment_align_up_closest_inside_geometryped_alignment_initped_greatest_common_divisorfs_info->cluster_sectors % frag_sectors == 0 && frag_sectors <= fs_info->cluster_sectorsfat.c0fat16fat32fat_set_frag_sectors"X#hfshfs+hfsxJFS1jfslinux-swap(v0)linux-swap(v1)swsuspSWAP-SPACEUnrecognised old style linux swap signature '%10s'.SWAPSPACE2Unrecognised new style linux swap signature '%10s'.S1SUSPENDUnrecognised swsusp linux swap signature '%9s'.< h  linux-swap(old)linux-swap(new)linux-swapext2ext3<hext4nilfs2NTFSntfsgeom != NULLprobe.cdev != NULLParted can't use HFS file systems on disks with a sector size not equal to %d bytes.hfsc_can_use_geom (geom)hfsx_probehfs_probehfsplus_probehfs_and_wrapper_probehfsc_can_use_geomgeom != NULLreiserfs.cReIsErFsReIsEr2FsReIsEr3Fs(reiserfsreiserfs_probe +-sun-ufshp-ufsped_file_system_ufs_init0xfsaixdev != NULLaix.cSupport for reading AIX disk labels is is not implemented yet.Support for writing AIX disk labels is is not implemented yet.Support for adding partitions to AIX disk labels is not implemented yet.Support for duplicating partitions in AIX disk labels is not implemented yet.part != NULLSupport for setting system type of partitions in AIX disk labels is not implemented yet.Support for setting flags in AIX disk labels is not implemented yet.err == 0566 7@7|777 8l888999 :909T9:`:aix_partition_max_lengthaix_partition_max_start_sectoraix_partition_alignaix_partition_destroyaix_probelinux-swapbsddev != NULLbsd.cdev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0disk != NULLdisk->dev != NULLpart != NULLpart->disk_specific != NULLpart->disk != NULLUnable to satisfy alJ : l constraints on the partition.Unable to allocate a bsd disklabel slot.err == 0<=CCCH(LMNpNO8PQRRHT0SXQ|QTTped_disk_bsd_initbsd_partition_max_lengthbsd_partition_max_start_sectorbsd_alloc_metadatabsd_partition_get_flagbsd_partition_set_flagbsd_partition_destroybsd_writebsd_allocbsd_probelinux-swapм؎|!8u u|tL|msdosdev != NULLdos.cpc98disk != NULLbios_geom != NULLchs != NULLraw_part != NULLpart != NULLpart->disk != NULLpart->disk_specific != NULLpart->disk->dev != NULLpart->disk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 00ext_part != NULLdisk->dev != NULLInvalid partition table on %s -- wrong signature %x.Invalid partition table - recursive partition on %s.geom != NULLgeom->dev != NULLped_disk_extended_partition (disk) != NULLlogical != NULLfatntfsfat16fat32hpfshfshfs+sun-ufsExtended partitions cannot be hidden on msdos disk labels.Parted can't resize partitions managed by Windows Dynamic Disk.Unable to satisfy all constraints on the partition.metadata_length > 0err == 0VdYZZ(~ZT[[($ИxԻ||ped_disk_msdos_initmsdos_partition_max_lengthmsdos_partition_max_start_sectormsdos_partition_enumeratemsdos_alloc_metadataadd_logical_part_metadataadd_metadata_partmsdos_partition_align_align_logical_log_meta_overlap_constraint_logical_constraintmsdos_partition_get_flagmsdos_partition_set_flagmsdos_partition_destroymsdos_writewrite_extended_partitionswrite_empty_tablewrite_ext_tablefill_ext_raw_part_geomfill_raw_partmsdos_readread_tableraw_part_parseraw_part_is_lbaraw_part_is_hiddenraw_part_is_extendedpartition_probe_bios_geometryprobe_partition_for_geomprobe_filesystem_for_geoJ:mdisk_check_bios_geometrypartition_check_bios_geometrylinear_endlinear_startlegacy_endlegacy_startsector_to_chschs_to_sectormsdos_freemsdos_allocmsdos_probedvhb != NULLdvh.cold_dvh_disk_data != NULL%s has no extended partition (volume header partition).dvh_disk_data != NULLChecksum is wrong, indicating the partition table is corrupt.PED_BE32_TO_CPU (vh.vh_magic) == VHMAGIC(part->type & PED_PARTITION_LOGICAL) == 0(part->type & PED_PARTITION_LOGICAL) != 0part->disk_specific != NULLxfsOnly primary partitions can be root partitions.Only primary partitions can be swap partitions.Only logical partitions can be a boot file.failed to set dvh partition name to %s: Only logical partitions (boot files) have a name.part != NULLUnable to satisfy all constraints on the partition.0Too many primary partitionsdisk != NULLerr == 0Ľ\4\T Lx DXped_disk_dvh_initdvh_partition_max_lengthdvh_partition_max_start_sectordvh_alloc_metadatadvh_partition_enumeratedvh_partition_aligndvh_partition_destroydvh_write_generate_boot_file_generate_partitiondvh_readdvh_duplicateread_sector0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,J:[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-gptpth_raw != NULLgpt.cpth->Reserved2 != NULLpth != NULLuuid != NULLdev != NULLmbr != NULL%s contains GPT signatures, indicating that it has a GPT table. However, it does not have a valid fake msdos partition table, as it should. Perhaps it was corrupted -- possibly by a program that doesn't understand GPT partition tables. Or perhaps you deleted the GPT table, and are now using an msdos partition table. Is this a GPT partition table?The format of the GPT partition table is version %x, which is newer than what Parted can recognise. Please report this!last_usable > first_usablelast_usable <= disk->dev->lengthlast_usable_if_grown > first_usablelast_usable_if_grown <= disk->dev->lengthNot all of the space available to %s appears to be used, you can fix the GPT to use all of the space (an extra %llu blocks) or continue with the current setting? gpt_disk_data->entry_count > 0gpt_disk_data->entry_count <= 8192The backup GPT table is not at the end of the disk, as it should be. This might mean that another operating system believes the disk is smaller. Fix, by moving the backup to the end (and removing the old backup)?Both the primary and backup GPT tables are corrupt. Try making a fresh table, and using Parted's rescue feature to recover partitions.The backup GPT table is corrupt, but the primary appears OK, so that will be used.The primary GPT table is corrupt, but the backup appears OK, so that will be used.primary partition table array CRC mismatchgpt_part_data != NULLdisk != NULLdisk->dev != NULLdisk->disk_specific != NULLpart->disk_specific != NULLfatntfshfsswap0part != NULLUnable to satisfy all constraints on the partition.err == 0,|J : x 0""l(t.//H03'44%|004t4gpt_partition_max_lengthgpt_partition_max_start_sectorgpt_partition_aligngpt_partition_get_flaggpt_partition_set_flaggpt_partition_enumerategpt_alloc_metadatagpt_partition_set_systemyD<#*=(;Mt?(s*K>;Hah!IdontNeedEFI(2{\ M}-@Mjy֬oceRev0eC쬢3Dh&SFH0eCmWC 3KOO3Dh&gpt_partition_destroy3Dh&add_metadata_partgpt_write_partition_generate_part_entry(s*K>;Hah!IdontNeedEFI;Mt?yD<#*=((2{\ M}-@Mjy֬oceRev0eC_parse_headergpt_probe_pmbr_is_validpth_crc32swap_uuid_and_efi_guidpth_get_rawpth_freepth_new_from_rawloopGNU Parted Loopback 0dev != NULLloop.cdisk != NULLUnable to satisfy all constraints on the partition.err == 05647l779$;; <@<t<<\=<=0>===>p>loop_partition_max_lengthloop_partition_max_start_sectorloop_readloop_freeloop_alloclinux-swapmacInvalid signature %x for Mac disk labels.dev != NULLmac.cPartition map has no partition map entry!AppleApple_partition_map%s is too small for a Mac disk label!partition_map != NULLpartition_map->type == PED_PARTITION_NORMALApple_BootstrapApple_BootApple_driverApple_UNIX_SVR2rootswapLinux_LVMLinux_RAIDApple_VoidApple_FreeExtraApple_ScratchApple_ExtraPartition %d has an invalid signature %x.Partition %d has an invalid length of 0 bytes!The data region doesn't start at the start of the partition.The partition's boot region doesn't occupy the entire partition.The partition's data region doesn't occupy the entire partition.Weird block size on device descriptor: %d bytes is not divisible by 512.The driver descriptor says the physical block size is %d bytes, but Linux says it is %d bytes.J: i <= disk->dev->sector_size / 512No valid partition map found.disk != NULLConflicting partition map entry sizes! Entry 1 says it is %d, but entry %d says it is %d!Weird! There are 2 partitions map entries!part->num > 0num > 0disk->disk_specific != NULLdisk->dev != NULL!disk->update_modeuntitledpart != NULLhfshfs+Apple_HFShfsxApple_HFSXpart->disk_specific != NULLChanging the name of a root or swap partition will prevent Linux from recognising it as such.Unable to satisfy all constraints on the partition.part->disk != NULLCan't add another partition -- the partition map is too small!disk->update_modeerr == 0ADEF`~,ЃD Tȓ`0@Ԕped_disk_mac_initmac_partition_max_lengthmac_partition_max_start_sectormac_alloc_metadataadd_metadata_part_disk_count_partitionsmac_partition_enumeratemac_partition_alignmac_partition_get_namemac_partition_set_namemac_partition_get_flagmac_partition_set_flagmac_partition_destroymac_write_generate_empty_part_generate_raw_freespace_part_generate_raw_partmac_read_disk_analyse_ghost_sizemac_duplicatemac_allocmac_probeIPL1pc98IPL1dev != NULLpc98.cdisk != NULLc != NULLh != NULLs != NULLraw_part != NULLdisk->dev != NULLInvalid partition table on %s.pc98_data != NULLPartition %d isn't aligned to cylinder boundaries. This is still unsupported.part != NULLpart->disk_specific != NULLname != NULLstrlen (name) <= 16fat16fat32ntfsufsUnable to satisfy all constraints on the partition.part->disk != NULLped_partition_is_active (part)Can't add another partition.err == 0dxܣ 0<dD84DLPX̷̲@ped_disk_pc98_initpc98_partition_max_lengthpc98_partition_max_start_sectorpc98_alloc_metadatapc98_partition_enumeratepc98_partition_aJ:lignpc98_partition_get_namepc98_partition_set_namepc98_partition_get_flagpc98_partition_set_flagpc98_partition_destroypc98_writefill_raw_partpc98_readread_tablelegacy_endlegacy_startsector_to_chschs_to_sectorpc98_freepc98_allocpc98_probebuflen <= disk->dev->sector_sizept-tools.cb != NULLdev->sector_size <= sizeof zeropartition length of %jd sectors exceeds the %s-partition-table-imposed maximum of %jdstarting sector number, %jd exceeds the %s-partition-table-imposed maximum of %jdsunloopgptmsdosdasdamigadvhmacbsdpc98 $$$$($$$$0$$$$4$$$$<$$$$D$$$$L$$$$P$$$$T$$$$X........................................................ ....................................... .. .... .........................................................................................................................................ptt_clear_sectorsptt_read_sectorsptt_write_sectorlinux-swapRDSKJ: BADBPARTFSHDLSEGBOOT%s : Bad checksum on block %llu of type %s.amigadev != NULLrdb.csizeof(*rdb) <= disk->dev->sector_sizedisk != NULLdisk->dev != NULLdisk->disk_specific != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0%s : Didn't find rdb block, should never happen.%s : Loop detected at block %d.%s : The %s list seems bad at block %s.%s : Failed to list bad blocks.%s : Failed to list partition blocks.%s : Failed to list file system blocks.%s : Failed to list boot blocks.part->disk_specific != NULLpart->geom.start % cylblocks == 0(part->geom.end + 1) % cylblocks == 0Failed to write partition block at %d.dhxpart != NULLpart->disk != NULLext2ext3fat16fat32hfsjfsntfsreiserfssun-ufshp-ufsxfsUnable to satisfy all constraints on the partition.Unable to allocate a partition number.err == 0LddtlX|HPptped_disk_amiga_initamiga_partition_max_lengthamiga_partition_max_start_sectoramiga_alloc_metadataamiga_partition_enumerateamiga_partition_alignamiga_partition_get_nameamiga_partition_set_nameamiga_partition_get_flagamiga_partition_set_flagamiga_partition_set_systemamiga_partition_destroyamiga_partition_duplicateamiga_partition_newamiga_writeamiga_write_amiga_find_free_blocks_amiga_find_free_blocksamiga_readamiga_readamiga_freeamiga_duplicateamiga_allocamiga_probe_amiga_read_blocklinux-swapsundev != NULLsun.cCorrupted Sun disk label detected.cyl_size != 0bios_geom->cylinders == (PedSector) (dev->length / cyl_size)GNU Parted Custom cyl %d alt %d hd %d sec %dThe disk CHS geometry (%d,%d,%d) reported by the operating system does not match the geometry stored on the disk label (%d,%d,%d).The disk label describes a disk bigger than %s.disk != NULLdisk->dev != NULLdisk->disk_specific != NULLThe disk hasJ: %d cylinders, which is greater than the maximum of 65536.part != NULLufspart->disk_specific != NULLped_partition_is_flag_available (part, flag)Unable to satisfy all constraints on the partition.The Whole Disk partition is the only available one left. Generally, it is not a good idea to overwrite this partition with a real one. Solaris may not be able to boot without it, and SILO (the sparc boot loader) appreciates it as well.Sun disk label is full.err == 0l ( $%|&&0(|*d+.p/H20++,22ped_disk_sun_initsun_partition_max_lengthsun_partition_max_start_sectorsun_alloc_metadatasun_partition_alignsun_partition_get_flagsun_partition_set_flagsun_partition_destroysun_writesun_readsun_allocsun_probeinvalid argument %s for %sambiguous argument %s for %sValid arguments are: - `%s', `%s'write error%s: %s%sPOSIXLY_CORRECT--%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument A NULL argv[0] was passed through an exec system call. /.libs/lt-literalshellshell-alwayscc-maybeescapelocaleclocale $"`'%s (%s) %s %s %s (C) License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Written by %s. Written by %s and %s. Written by %s, %s, and %s. Written by %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, %J:s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. Report bugs to: %s bug-parted@gnu.org%s home page: <%s> GNU partedhttp://www.gnu.org/software/parted/General help using GNU software: %smemory exhausted/proc/devicesBlock devices:virtblkdev != NULLarch/linux.c!dev->external_modeCould not stat device %s - %s.%u.%u.%udev->open_countCould not determine sector size for %s: %s. Using the default sector size (%lld).dev->open_count > 0dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0PARTED_TEST_DEVICE_LENGTHUnable to determine the size of %s (%s).S_ISBLK (dev_stat.st_mode)Could not get identity of device %s - %sGeneric IDE0Device %s has multiple (%d) logical sectors per physical sector. GNU Parted supports this EXPERIMENTALLY for some special disk label/file system combinations, e.g. GPT and ext2/3. Please consult the web site for up-to-date information./sys/block/%s/device/%srvendormodelError initialising SCSI device %s - %s%.8s %.16sGeneric SCSIPARTED_SECTOR_SIZEThe device %s is so small that it cannot possibly store a file system or partition table. Perhaps you selected the wrong device?Unable to determine geometry of file/device %s. You should not use Parted unless you REALLY know what you're doing!typename%s %s%sGeneric SD/MMC Storage Cardpath != NULLDAC960 RAID controllerPromise SX8 SATA DeviceATA over Ethernet DeviceIBM iSeries Virtual DASDCompaq Smart ArrayATARAID ControllerI2O ControllerUser-Mode Linux UBDLinux device-mapper (%s)Xen Virtual Block DeviceUnknownVirtio Block DeviceLinux Software RAID Arrayped_device_new() Unsupported device typeError fsyncing/closing %s: %sError opening %s: %sUnable to open %s read-write (%s). %s has been opened read-only.buffer != NUJ: LL%s during read on %s%s during seek for read on %send of file while reading %s%s during write on %sCan't write to %s, because it is opened read-only.%s during seek for write on %s/proc/partitions/dev/%d %d %d %255s/sys/block/dev/hda/dev/hdb/dev/hdc/dev/hdd/dev/hde/dev/hdf/dev/hdg/dev/hdh/dev/sda/dev/sdb/dev/sdc/dev/sdd/dev/sde/dev/sdf/disc%.*s/part%dp%s%s%d/proc/mounts/proc/swaps/etc/mtabdisk != NULLlooppart != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0Error informing the kernel about modifications to partition %s -- %s. This means Linux won't know about any changes you made to %s until you reboot -- so you shouldn't mount it or use it in any way before rebooting./sys/block/%s/range%ddisk->dev != NULLUnable to determine the size and length of %s.Failed to add partition %d (%s)%d, Partition(s) %s on %s have been written, but we have been unable to inform the kernel of the change, probably because it/they are in use. As a result, the old partition(s) will remain in use. You should reboot now before making further changes._have_blkpg ()x`linux_disk_commit_disk_sync_part_table_blkpg_add_partitionlinux_partition_is_busy_has_partitions...dm-ramlinux_sync_fastlinux_sync_do_fsynclinux_checklinux_write_write_lastoddsectorlinux_read_read_lastoddsector_device_seeklinux_newinit_genericinit_ide_device_probe_geometry_device_get_length_device_set_sector_size_device_statgeom != NULLaffs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu Pralloc = %d, Reserved = %d, blocksize = %d, root block at %llu %s : Couldn't read root block %llu $TDt4daffs0affs1affs2affs3affs4affs5affs6affs7amufsamufs0amufs1amufs2amufs3amufs4amufs5_genJ&:eric_affs_probe_generic_affs_probeRDSKBADBPARTFSHDLSEGBOOT%s : Failed to allocate id list element %s : Couldn't read block %llu %s : Bad checksum on block %llu of type %s %s : Couldn't write block %d geom!= NULLamiga.cgeom->dev!= NULL%s : Failed to allocate disk_specific rdb block %s : Didn't find rdb block, should never happen %s : Failed to read partition block %llu amiga_find_partamiga_find_part_amiga_read_block_amiga_add_idgeom != NULLapfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu %s : Couldn't read root block %llu apfs1apfs2_generic_apfs_probe_generic_apfs_probegeom != NULLasfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read root block %llu asfs_asfs_probe_asfs_probebs != NULLbootsector.cgeom != NULLFile system has an invalid signature for a FAT file system.File system has an invalid sector size for a FAT file system.File system has an invalid cluster size for a FAT file system.File system has an invalid number of reserved sectors for a FAT file system.File system has an invalid number of FATs.This file system has a logical sector size of %d. GNU Parted is known not to work properly with sector sizes other than 512 bytes.The file system's CHS geometry is (%d, %d, %d), which is invalid. The partition table's CHS geometry is (%d, %d, %d). If you select Ignore, the file system's CHS geometry will be left unchanged. If you select Fix, the file system's CHS geometry will be set to match the partition table's CHS geometry.FAT boot sector says logical sector size is 0. This is weird. FAT boot sector says there are no FAT tables. This is weird. FAT boot sector says clusters are 0 sectors. This is weird. File system is FAT12, which is unsupported.Xt~"tThis partition does not haJ3: ve an operating system loader installed on it. Press a key to reboot...MSWIN4.1NO NAME FAT32 FAT16 is != NULLThe information sector has the wrong signature (%x). Select cancel for now, and send in a bug report. If you're desperate, it's probably safe to ignore.fat_info_sector_writefat_info_sector_readfat_boot_sector_writefat_boot_sector_generatefat_boot_sector_set_boot_codefat_boot_sector_analysefat_boot_sector_readUnknown error (%d)Unknown error %dCopyright %s %d Free Software Foundation, Inc.0 <= strtol_base && strtol_base <= 36xstrtol.cxstrtoll/dev/urandom/dev/random/var/lib/libuuid/clock.txtr+clock: %04x tv: %lu %lu adj: %d clock: %04x tv: %016lu %08lu adj: %08d /dev/null/var/lib/libuuid/request/var/lib/libuuiduuidd-qT300/usr/sbin/uuiddRJ0: \X@XQ $ (g(L  |T(444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444̒hijj,j@jhjjjPklkkk\~l~~Pdh$X6Hx|Чl$PDTH\̓Lplt,X4\<`d|    ̪Ȫ (8 0P$XhT\P@X4lD3?<`,ط<`,ܼXLH048<ȖHLP4TXX|\`ėdhJ%:lp0tHx`|x\ A/aeabi%ARM926EJ-S ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.J?: 4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v1J*:00(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.J):9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.comment (($ LL@! ) TT(2 ||;$$644AȚ`G(g(M8g84Upl l `lx}ȒȒ DPp0J<: ԳJ: >stty9Y8Y8YbusyboxK>ip9Y8Y8YbusyboxL>rmdir9Y8Y8YbusyboxM>pppoe9Y9Y9YoN ELF(|4k4 (4448:*(!5A."3 @DF72)   -/4+ %=,ċЋ܋~T 2$YhTh0<<H[T`lxR hfhjEčp،Sq:Th|P  ,8CDwP\ht`hȍThԍK L$h6-h Th(4+@ hLXdpmemcpymallocabortmemsetfreelibc.so.0strlengeteuidsetsockoptfflushstderrfprinN:tfputsfopenvsnprintf__sysv_signalgetgidbind__errno_locationgetegidgetpwnamreadstrerrorseteuidsleepputcharrecvsetuidexitselectmemcmpsyslogsetegidsendsscanfsprintfioctlsetgid__uClibc_mainstrftimefputcgetpidstrncmpstrcmpoptarg__ctype_bstrtolsocketreadvstrncpylocaltimeopenlogstrcpygettimeofdaygetoptfclosewritev__data_startgetuidfwrite_edata__bss_start__bss_start____bss_end____end___endh h$h9$g(g,g0g4g8g  O +V9OO΍ ,*?OK2@ @ *$G0S `<\0 PPP0PS ̝P  > 1! 0΍"1 0`PB0Q  @  ( RH  0 >"0S (\4  P.  1 R , xP ><.ā| P @Al @$z  @  ;\q 0O ^g, 0P 0_$  0P 0W@P 4! , @ɾ@ @PL 0 @#dv | @, @UO-M M@P `VX D8 0@ $. ,xep@, hÎ0@ `@ ,00̍(05\*  @Fp@ A@3Q3Dd$PdОdddddddddddh\ddddddddddddddddddPd dd̠`\*  @p@PU @,XP@T$`C PU+@a\ЍۍL @P  @ \0P0 PxuDP cDm@P [@e4 @X$P R$8 0@0 @UPHP >HH T E @ d@adP  h' @ @VdB11͍0 @. 0jPˍ5( @@0 N:>l  @ 0LPcT,3?O@RĀ4 8,<1 S#< 㺂 3yP0  ,P ݍp @ =BOp @ Q 4 @`\ @\ @X( @T< @PH @L @ 8@-0@"Dt@Q 0S d @ O-@P M` R0S xp@ PYEeV00  @ HPU4P Vʼ @ N: 0PU$ 2P V@ 0ڴ  @P"UV @0 ʼ @`P\U| @ 0T VN 0P @Q =PU<V9\& 0 @J.+PU*V&P!U.0 Რ@ PUV0. ᾰ@PU.  P VX Ѝ  0@_.  @dR<#P8 0@2 ЍOO-PQM@q U`u M8=b0A4O4/<Kb, 0 @  0@g80@ Rs @ RR   @X0SQ S\ Sx SH  0@ SH ZeS( @ 0밡P 't@ w0*dv 1h  @0 p ` (,($p,`  1$#Ă| Qߍ @0S  0@H0  0@A  0@: @S S@  0@*8  0@#  0@$8@-0@@  @  @@A-LADMqp`Q] P@  0@$H@@@ @ 0@ ЍA= 0@Q@-@M 0@ 0ЍE-0p!Q:\>5"dv`V?V@$0P pP TuP V P0 p~PP V P 0@8/jV T  @ #"@|  @u0 N:  @nE-P0M  @n 1 x@ (4 P @ XP  0 0@@6 Hpr`  PV `@ R PE uP`U@ `0EsPPE uP @`U@H/p @X @t@$80sЍ0@-M0 !S> Ѝ01! S@*1#4sQ @Q0P Q0 Q   mP 1 0.\Q Q P0( S*Q Q0@)P%S ^" :t @Ѝ0@ 0 P@ P 0P@A-0@TJ@TO D5,Ą|\+\@p$P`0pP Tu0P\"P'P0T4uPs0U` \U `@0g S`@0 @@KT  @@C  #"@@5  @.@G-@QMpU 0S h`@  X<$,`/OĠḑ@4 ΍V?O "  PvPW _p *":?O/O(ĉ㽞pn  P0sp`Q 4#Ď|  ` 0SDHq4$#Ă|`Pv`(^ *v0#Ď|  a 0\'bS $,Pu`4BO&0n P?@P *  @ @@M  @ލ @&"j *oO[΍_>/OPP`w-0@-Mύ@PN : 0"02:ߍ0@ Ѝ/8@-P~@P 8 @8p@-P D@0Spep@D( @G@P P[PUpD@-@0SKP)P@ @:0 @5D@-@0S3PP@ @"0 @H8 0@  /R0-' @t @0SPB@ P@@@ $ U @0S@ @$@ $ P0@0SP PPP %@ @@@ $0/O-M M*@P HhP`@0S 0D@0R T+ S @DQ T# @DP0T S D0 @#\0S S@D#^0S#\0@T0 Ѝڍ0S0D> @}Rv ~Ri 0S} 0 " 0PS) ~S.  RC 0#0Z 0pPS0@J}S. ~S!  UR3 0#00PS0@D}S  R3 B  R- B   @@ R B d @Z @U @0.@F t@y@@p@-0M`@P  `0`P V  FЍp Q @L@,@ @@y@- PQM@ Ѝ 730PE-M PM@U $pp@PPS `u  p8 0@N :<$/O@4?OĠ ΍ "  P,\BO&0n P@P *  @@ Y@ߍۍ.b */=/O Q":?O_+ & `v` !  x`80@ V<$/O @4?OĠ ΍ "  " @  `8<$0@/O@pOĠ  "  P $'t PZq  yprO-@ MMP p5PuPU p p{ [   `V@<$/O @4?O Q,Ď  Ჰ  9,0SKP .$r0 j ^OH&$ 4s ` pvP(f^ *f0$#p j Z5b !Ā`PuP$BO%0^ `@P *  @@ ^@ߍۍ j5 *Q/O":?O_+  @5 PpuPpPfp@-@MP` PP ,0SЍp4 @ KO-jM M$0ォ Li~PO@ p`^  \&f660PP0P0PSj㜖 ⠶2"  0pP: R @@]j΍ QjƝ !4s  P  @Qߍۍ@P 4!  @ @@ZwP '0S H@`  @&R P D0QD &R  0P 00|N : @h@d@ 0 @O-iM MP㖩L}`O @ p 0 00PPP0PSi> ㌖␶1  0pP_=Q @i i΍Ɲ$!4s  P! @ Ri O0X@1$#~ 0 ,p R0t@ߍۍ@P 4!  @# @@ 0P 0P 0 +eQ <@ <S00R40A-@ \S 8P%xp@ b4pW@`@p0 RP0S"`V\ `@ \< Q@XD^ @R \@@`ppPP`V0S $ \@`W$@P@- M@Pp`d 2P; \" 2\= Ѝ1P@ AP \00SQx `V OU P  00S @ Ѝ@0PDĠ$$L%4 4 Ѝ@0Pt @ Ѝ@00Sl @ Ѝ@ 0\ $`V U P0P.$bΆ%$(*6  Ѝ@zH@e@U@@_T @@@WUTQU =d@H@U@@BT @@@:UTQU @+@' @ 0@Pp@-M@`P 1P Ѝp@AP4 @0P~ ,$b΃N : (6!*6  Ѝp@ @0Ѝp@] -LRP-PPPoE: Session %d: %.256sReceived signal %d on session %d.RP-PPPoE: Received signal %d%.256s: %.256s%.256s: Session %d: %.256sRP-PPPoE: System call error: %sBogus PPPoE length field (%u)RCVDUnexpected packet code %dUnexpected packet version %dUnexpected packet type %dBogus length field in session packet %d (%d)incomingsyncReadFromEth: writeasyncReadFromEth: writeUsage: %s [options] Options: -I if_name -- Specify interface (default %s.) eth0 -D filename -- Log debugging information in filename. -T timeout -- Specify inactivity timeout in seconds. -t timeout -- Initial timeout for discovery packets in seconds -V -- Print version and exit. -A -- Print access concentrator names and exit. -S name -- Set desired service name. -C name -- Set desired access concentrator name. -U -- Use Host-Unique to allow multiple PPPoE sessions. -s -- Use synchronous PPP encapsulation. -m MSS -- Clamp incoming and outgoing MSS options. -p pidfile -- Write process-ID to pidfile. -e sess:mac -- Skip discovery phase; use existing session. -n -- Do not open discovery socket. -k -- Kill a session with PADT (requires -e) -d -- Perform discovery, print session info and exit. -f disc:sess -- Set Ethernet frame types (hex). -h -- Print usage information. PPPoE Version %s, Copyright (C) 2001-2006 Roaring Penguin Software Inc. PPPoE comes with ABSOLUTELY NO WARRANTY. This is free software, and you are welcome to redistribute it under the terms of the GNU General Public License, version 2 or any later version. http://www.roaringpenguin.com 3.8Inactivity timeout... something wicked happened on session %dRP-PPPoE: Inactivity timeoutSession %d terminated -- received PADT from peerN :Received PADT from peerselect (session)pppoe%dIllegal argument to -t: Should be -t timeout Illegal argument to -F: Should be -F numFloods WARNING: DISCOVERY FLOOD IS MEANT FOR STRESS-TESTING A PPPOE SERVER WHICH YOU OWN. DO NOT USE IT AGAINST A REAL ISP. YOU HAVE 5 SECONDS TO ABORT. %x:%xIllegal argument to -f: Should be disc:sess in hex %u:%2x:%2x:%2x:%2x:%2x:%2xIllegal argument to -e: Should be sess:xx:yy:zz:aa:bb:cc w%lu Could not open %s: %s rp-pppoe-%s -m: %d is too low (min 536) -m: %d is too high (max 1452) Roaring Penguin PPPoE Version %s I:VAT:D:hS:C:Usm:np:e:kdf:F:t:Sending discovery flood %d %u:%02x:%02x:%02x:%02x:%02x:%02x outgoingSENTrecv (receivePacket)send (sendPacket)Cannot create raw socket -- pppoe must be run as root.socketsetsockoptioctl(SIOCGIFHWADDR)Interface %.16s is not EthernetInterface %.16s has broadcast/multicast MAC address??ioctl(SIOCGIFMTU)Interface %.16s has MTU of %d -- should be %d. You may have serious connection problems.ioctl(SIOCFIGINDEX): Could not get interface indexbindInvalid ether type 0x%x (PAP Authentication Frame -- Contents not dumped) %02x %H:%M:%S%s.%03d %s PPPoE Discovery (%x) Session (%x) Unknown (%x) PADI PADO PADR PADS PADT PADM PADN SESS sess-id %d length %d SourceAddr %02x:%02x:%02x:%02x:%02x:%02x DestAddr %02x:%02x:%02x:%02x:%02x:%02x Pdpppoe: %s %sGeneric-Error%s: %s: %.*sPADTInvalid PPPoE version (%d)Invalid PPPoE type (%d)Invalid PPPoE packet length (%u)Invalid PPPoE tag length (%u)Bad TCP checksum %xBogus length for MSS option (%u) from %u.%u.%u.%uBogus TCP option length (%u) from %u.%u.%u.%uWould create too-long packetSent PADTstrdup failednobodysetgid failedseteuid failedService-Name-ErrorSystem-Error#2$FW6etHZӾl~3"V,Gu>dɜ@ۿRdv!0&gv4DUJüXџn|ك1 w.fT@R+:dN_vm|$ÿ6H ;Z*^lO}~l .ǟ䩐 2ZLKy^hh ?z.ĕ*8FkzTHYb-makemime9Y8Y8YbusyboxO>linux329Y8Y8YbusyboxP<>msh9Y8Y8YbusyboxQ)>pppd9Y9Y9YR*ELF((4, 4 (444%`   Qtd/lib/ld-uClibc.so.0(cD` q|7\ ^1F L-O>SRJ\eV/xC%gz!;Wk.+eS2$F#NzK> bE-l 5 u[)4wPX|2T^tWBr8dY~),*NORQXZ@7&/$ Cy]K+93coIbDP4r!1 AlR%:{5[B0V xM8<giwndLsm #fGHUJ`'vh.p63':@,_}:?]9khGE%"ZY0(~AT{vjUp"M *&Hju Io}ny=<?mia=;f_qtsa6Q4  ,^l LsT   -<$( 4 d"H>* 5P$ C gNT$gkj]gЮu08rgԮ@ [4 x X}(hX4M` 6܅0@h|  H  08hL`$ .(gR&:m-D;sh M< PX_p$ n D xԛX  dP \!  `P@ %  mpX  <0/\ 8` |Kl d|@, 2{J . =2 KP[(H gth ġ\ VT  A> |; jmL TA d( ̄D h ' $ .m:#@ [A*, OH b=_H n ulP X- m 4 X>$08+ 8 ȮD <H @  L  & \ jr1 4 T8 ? %u`J 8>P I>W  li d}T xv خ ܮ } lt < X  \  g g  C (4 s 04 GR3: L 7  -# s/ ` h O= D>H 0, S8sT |D` (* h  v t p$< tT DY : D h, P> , D8iD d| , PU\ X0`  h-! hBp =h)  t3 gotH , ?  O TD[  m < `s t 4@ f( v@ 8I(P ^ t! Ԇ0 t 4 3   - =d  4 " $  $ , -< $! H \ %(U t 4c L p \ @| ,L  1 l X d( 8 T>X L d=p Fx  0 D 8| .; pG s l0 &" ( h 5 g@  L ^  p 'y $ ,R): 4H- ,  X  &t  \ ć P  .  HЇ DD   D((b\ $4l E0? F%Pxa,sTDF, <,`H5T f8 H `Xk E  t  +lx4, "e|  .DP &G(@ 43T \#PL /-;d$  NfV Z g.sTq $S,`k L   cp4 \T ]|X ̏ D  hP 4 :X! .0-9- ElQ Wp`l qd` \< [ g< p ,g8yD8  `8 0\ T, &tT 348 F(M gV _tixqX yg{,f,R<: H 8܇ <>pX89\ H. t  0 D bP V *8 2\;|JL>h4tR-_ē\ |i@>rW  \/   C `<X ̮<4 \ p X +  ( Nf/d-':ADN: \ j{%`-x1., 9 libcrypt.so.0strcpymemcpystrncmpstrncpymemsetstrlenencrypt__data_startsetkeylibdl.so.0mallocfprintfstderrfreedlclosedlsymdlerrordlopenabortcallocrealloc_Jv_RegisterClassesraiselibc.so.0strncasecmpcfsetispeedgeteuidgetspnamfflushcfsetospeeddrand48srand48strdupfgetcfopenfgetsforkstrlcpygetgroupsutmpnamefcntllstatexecvegetgidgetlogin__errno_location__fgetc_unlockedgetegidgetutentsigaddsetgetpwnamfchmodpipe_exitread__ctype_toupperstrerrorseteuidsetsidgetnetbynamesleepsigemptysetstrncattcsetattrsigprocmaskisattytcgetattrsetuidctimegetmntentgethostbynamesigactionungetcmmaplseekselectmemcmpsyslogendutentendspentsscanfunamewaitpidgetgrnamstrchrdup2fstatioctlsetgidstrcasecmpstrlcat__uClibc_mainfchownferrorcloselogttynamesignalfputcgetpid__sigsetjmppututlinesetlogmaskmunmapchdirftruncateunlinkcfgetospeedstrcmpendpwent__ctype_bsetuR?: tentstrtoulstrtokstrtolfileno__fputc_unlockedupdwtmptcflushexeclopenlogkillgettimeofdaywarngetpwuidstrstrumaskfclosemrand48inet_addrgethostnamestrrchrgetuidatoifwritesiglongjmp_edata__bss_start__bss_start____bss_end____end___endinfolink_terminatedsys_closeupap_authpeerrelockauth_requiredremove_fdtty_process_extra_optionsreq_unitpersisttdb_updatescript_setenvgot_sighupmodemprognameprotocolscharshunt_pidipxcp_fsmnottybaud_ratetty_disestablish_pppipxcp_hisoptionsppp_availableipcp_allowoptionstdb_existstdb_nextkeyipcp_gotoptionslcp_fsmreopen_logpap_logout_hookoutpacket_bufipxcp_protentupap_authwithpeertty_establish_pppfsm_protrejectfsm_inputtdb_openframemaxdisconnect_ttylinknametdb_unlockchainsys_check_optionsunsuccessdomaindevice_scriptget_secretipcp_wantoptionsccp_testccp_flags_setlogwtmpcifdefaultroutemp_join_bundleget_if_hwaddroption_prioritybad_ip_adrsdump_optionsloop_charstdb_deleteread_packetMD4Finalupdetachlink_downcfg_bundleremove_notifiersys_initholdoff_specifiedcifaddrlcp_wantoptionstdb_fetchnew_phase_hookepdisc_to_strdryrunthe_channeladd_fdlcp_lowerdownscript_unsetenvauth_withpeer_successtty_close_fdsip_down_hookframeleninpacket_buftdb_closenoticeprivileged_optionbundle_namesifupfsm_initbundle_idtty_initpend_qtailtdb_traverselog_defaultloop_frameauth_resetdbglogspeedsexitnotifydebugdemandtty_check_optionsChapAuthPeermax_data_ratexmit_accmMD5Finalprotocol_namewait_inputfsm_opencheck_passwdinitializerwelcomeroptions_from_listhungupsetdtrstr_to_epdiscsifvjcomppap_passwd_hookdo_callbackconnect_delaymaxconnectnp_finishedlcp_protentsifdownfsm_lowerdownprivopenget_host_seedsifdefaultrouteset_up_ttybundle_attachparse_argsidle_time_limitlcp_echo_failsipcp_protentauth_check_optionsend_pr_logtty_set_xaccmnetmaskget_ptyfsm_sdatasync_serialtdb_writeunlockpap_protentoptions_from_userfatalneed_holdofftdb_lockchainusing_ptyChapAuthWithPeerno_ppp_R*:msgtty_optionsgot_sigtermupapppp_devnamGetMasktdb_storerefuse_paptune_kernelint_optionauth_peer_failoption_errorexplicit_remotelcp_lowerupdemand_blocktdb_writelocklcp_sprotrejdemand_conftty_channelescape_flagcipxfaddrdemand_unblockfsm_closeccp_fsmmultilinkdemand_rexmitrestore_ttyadd_optionspap_auth_hooksifaddripcp_hisoptionsholdoff_hookpppdbrecord_childptycommandcleanup_ttylink_connect_timeoptions_from_filelax_recvtdb_firstkeyauth_optionslink_establishedipxcp_allowoptionscurrent_optionsifnpmodeccp_allowoptionsChapMSoption_sourcelog_to_fdccp_wantoptionslcp_gotoptionsour_namesifproxyarpset_ifunitifnamepidchangelcp_loopbackfaillcp_echo_intervallcp_hisoptionsip_ntoanoendpointdb_keydieopen_ccp_flagparse_dotted_ipvslprintfcifproxyarp_finicryptpaplcp_allowoptionsupdate_link_statsMD5Initsipxfaddrprivilegedinit_pr_logrefuse_chapget_first_ethernetcrtsctsfcsdevnam_fixedusehostnamedefault_devicedisable_defaultipdemand_discardauth_withpeer_failgeneral_optionsuntimeoutMD5Updateopen_ppp_loopbacks_env_nallocfsm_lowerupMD4Updateipxcp_wantoptionsidle_time_hookuseloginsys_cleanuplisten_timemagicdetachedremote_namenovmcallback_scriptoverride_valuenew_phasemagic_initmp_check_optionsip_choose_hookpty_socketphasechangeipcp_fsmccp_protentprint_stringccp_fatal_errorMD4Initoptions_for_ttyadd_notifiertty_do_send_configpend_qlockflagMD4Printkill_linkngroupsdevstatrecord_fileinspeedflush_flaggetwordccp_hisoptionskdebugflagipxcp_gotoptionspeer_authnamelcp_openget_ppp_statsclean_checkauth_peer_successlink_requiredhave_route_tonp_downpeer_mrudoing_callbackipparamallow_any_iptdb_errornodetachget_loop_outputrun_programtty_recv_configccp_gotoptionsstart_networksmake_new_bundleendpoint_specifiedmaxfailauth_ip_addrlcp_closescript_envprotocol_listnp_updisconnect_scriptip_up_hookstatuschap_protentnetif_set_mtuprint_optionslink_stats_validsigreceivedroute_fdpap_check_hooktty_modeget_idleR*:_timetty_send_configgot_sigusr27s   !$#(',,044;8B<J@KDMHNLYP[TfXj\m`pdqhsltpxtx|  $(, 048<@DHLP!T$X%\&`+d/h2l=pCtExG|NQRV[\^_`cfgu|  -L-@Ə1ʌ@Ə1ʌ8Ə1ʌ0Ə1ʌ(Ə1ʌ Ə1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌxƏ1ʌpƏ1ʌhƏ1ʌ`Ə1ʌXƏ1ʌPƏ1ʌHƏ1ʌ@Ə1ʌ8Ə1ʌ0Ə1ʌ(Ə1ʌ Ə1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌxƏ1ʌpƏ1ʌhƏ1ʌ`Ə1ʌXƏ1ʌPƏ1ʌHƏ1ʌ@Ə1ʌ8Ə1ʌ0Ə1ʌ(Ə1ʌ Ə1ʌƏ1ʌR ?: Ə1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌxƏ1ʌpƏ1ʌhƏ1ʌ`Ə1ʌXƏ1ʌPƏ1ʌHƏ1ʌ@Ə1ʌ8Ə1ʌ0Ə1ʌ(Ə1ʌ Ə1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌxƏ1ʌpƏ1ʌhƏ1ʌ`Ə1ʌXƏ1ʌPƏ1ʌHƏ1ʌ@Ə1ʌ8Ə1ʌ0Ə1ʌ(Ə1ʌ Ə1ʌƏ1ʌƏ1ʌƏ1ʌƏ1ʌ  --- 0[|GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/(30@ R R R//8@-0PP8@03/T08p@-E@@40@P R 2/p@0P/0P \\ /50@\/00\ R R p/- MG4 0@ Ѝu0@-8TMP@D@@6P2 0P vPЍ0wq @Ѝ0@T @%TE-d`@M@T4 0S;  0 S P1 @00S pP)d @}T@0PS8D@@@ 0  lvPЍ-q @ЍES @@@SG-逤@p`W@T P P0=S PATd`@ RGTpDPd`@0 \R <: P!Q^ Rd`@Q =O-PM @``XPE ) @ 0P0@0 0S X, `Va P p  pP0=\$ `PV0hD@@Q4q  @0 S Q#ЍO @0P)ЍV@F^ 40@ R H Q $ @^ PP  qPhp@ppp0@-@ Pp`P 0` @@R0`A-E@@P` p P 0`0p  @ARA-UP@M 0S^ 8ppp3@ ` Rp + PP @T P/R- @T 0 Q.T7 0 @RT 0S 3/ &p }0 S& S @R 0C 0 Q^ T d  0@9R@Ѝ@G-E@@`MP PpP} Ym P P 4 R @LR P PLЍ0PSIH}p@P @PEp9@64b(0S 3/s(#WM@@PP @QA0 8<+0@ @@``@ @Qc 0 A@-p @00QE-@`PpP2 @` @X?2 0@ZP  > 3D@B n@㜠jP 0S  QX0SR ): RR\0p\ @Q@-`D@@,MwUP,Ѝ P `@ 0@pD,@`cp0 @  ` PQx  @ D,0  @ Q  @ D,  @0 Q  @ @- M`U(@1SF]EP@@@ (1/p$0S 3/,PUHUP@,OUT4@EpW 8D@@@ q P ppP 0PS pP4m@]EP@@@`cP0S <@P0VP\  @Pp@-E@@P80S   @8 P<6p@{ @- @ @E-\M@p`00 P0* R VP @PP\ЍPI pP P 8@\ x04 @ LP @{P?d @1^`]P@(0S 3/( @aPP  -u(%뀤@ V`V  @:8>0@ p 3R  0@-E@@P,\< M@ @0@,Ph,@PP p @K Ѝ0@l ,@P,P Ѝ00@-I@@ M0S Ѝ0 @ u,\< @0@@E{Pht@@@PP p @$ @P <@ Ѝ0@l  @O_D0@-pD@@M0S Ѝ0LPP:>d @L@P% @,0S@QPpD,0 @ @*P  @ %HR 3:  @@,0@@S b@QP @O=% @@r0@-S@P@  M@@ NO,< @0@ @O @@ T Ѝ0/ Ѝ0@Q@-@40@D RH8@-@D0XSH.p@-P @EO $@@ @`<`D0SpH8@-P E@@@O ' @P<PD0S8HX4t$0@ @A-M, P\ UpP@@@DpT ,`@ QP 3/@T PN 70@@T $t @@P 00 40@ R tH@@@ @ @E@@X1S(40@^ X$ @Ѝ  @ @P tp@PU 40@^50@XaV  X@U P@ D@P "p  bR0l0 S]c00 0]]=0C ]0 P%O-M@( @aPPPP4p0@RpP@Pp]\dhP@`@D,p30( @Nh  @ @ @ x@i1S }03/0S7t$gpt `@@q3 0plEPL FPI JEPD  , @ @0S 3/8~p@\PYP  <@OP# `;j`1S PO80S 3/0S0S 3/ @0SI @@P|V  @B0iO@@m@ P` @@ k z-08 @ @4N@@`VA@Q7 F@P ,L.@R &: @0IT@  @PU3QD,0 @x` N  @@*{xur o! @`, $ XP$PQP@ TPP% TPP(10@ T0Pi| @ TP[P P@ TPPM [ P@ TPP? TPP3 TPP' TPP  TPP TPP  TPP TPP TPP TP}P TPvP TPoP TPhP TPaP TPZPu%I 4 4@@D4@TLl@@tTDXdH@ =|$H㫊 P@@@@`@@,@0@ @@㪊B 0D 0L( 0(,0 P H((D000  R 嘅@@ 2/P(@0 cj (@ 1/0PY@\@刄$ j$@ @@$L$0x @ 唔0@@$0g @8b  !@< @ Z 08@8M<  @<  000S  @ZP PX ! H$R 0 S R0S0S$ RL0^,Qj,QM|P0 (2/ 01PN \F F0 2/$0S 3/^ ,P,0\4 \- @0S S+0X,X X @4 `1S 3/R%:X  @ 0 ^lQ  ^ 00SU`P@P QP p@:K@T  @2K@TP Ѝ0CQC8< 03/0YI @@G@<GZw t @_@^ ! % R R # #2 RR01S3 pğR 0S+ R(^ 4Jh@9Jh@4JNh@/JBh@*J6h@%J*h@ Jh@Jh @Jmh@ Jh @Jh@Jh@Ih@Ih@Ih @Ih @Ih@IP @T0 N@@- @v<@@o<L @h<o@-M O0K0@!@$q$;Ѝ 0  40 ( 0 0R0: 0/A-@@r`Pqp !BQPBU hS  S(70@ P E LĠp`PArT0g@-@0@S$Hdddd,0 0S 3/,  $0S3/ 00@@ 0@-@M0@S&xDh4444, 0S 3/ 004|   @ 0J  AЍ @,00(0S 3/ @,  (0S0@-PM@0AS7, U0s0S1  R. 3/40@ 1C PC ,0S  3/  d0'  @0LЍ0, 0S 3/, $  0g0@-@S00S    0@-@ S \h`\\\\h @  ,  $0S3/r00 @-@M0BSDDDP,R   (0S 3/ЍP$,00S 3/GP4 00|   0@ [0C, @8H 00,(0SRE-`M@Ep0P0TU;R9 R6AEP񟗨xX, 0S 3/,\# $ (@ ^00A?;BY 00SUN 0SUd^2 $ QU0S ( RUQ ,\U R, U00\Uv R 0S 0 ^UQ  ZUP  R; - U7P |Ѝ^0S  0(( 4R0PE`0S^U R^ # PPE` $0`U R D ;7<=08 @A:$B`9(>,?P 0YR0 ^PE`GPY%0  ^4(QPE`(E PI^y0PE`,0B R^ ^kPE`UPIPE`0F^RPE`OR: ^U,O bP@PHR3 .PA@ R%`/P/ 0 `/ Y!/0S R0 0`F R #2 PPPE `$Q0  4\PE`^?PE`U008@-P@^ @4/88@-@8@]PP 4 0@ 8@58@-D@ @ @QO-$M@T Pp`dVV000D0G SD @ 4/ @4/ W`FPCwp0w ``7: V8pVW3 0`p$@ f4/ JRulD$LX$Ѝ@@!4/V 0S VppW p @p4/VWQ PVi`g@P4/iVp P0@`Fć t$4/V@@4/# 0P$R #b R{|@4/Z*0S SP@P4/Z` @ P4/ZPU  P @4/ `@4/Z P@4/Y ` VV0N `xV 0Fs0PS 0 ` ` P \ @4/V@P4/V@P$4/V h@4/ PR] @4/V@P4/VX@4/ % P$ Rd@4/tVr0 0@ $0dP$4/dVbR:`(@P$4/XVV@P4/PVN|0 @~S@4/ 0P<iS}  vt@4/0@@4/+H@P4/%5-0@ b1P `V `@@@PETPP`V PPPP@=`#``@@P `V `P`%pP@?`pP+p@pb`(P%TP(@@ P `@ @@@`V PpPp`#pP@p d` `V @@@@ `V @@@@ `V `@@@PETP `V @@@@`V3 `0aQJ @@Pv `vs PpPp`pP@p d``VaPo @P@#`P@?PP`c ```-@@@,@@-P @.P `@PL-PU0aQ/@-@Ad@o@40@@*  /, `40@@-AM 0    Ѝ@;A-2`@QAd<% @! `@`, Du@p@ Pp  @@@p@@9@0p@@@@@@ @`40@- B M0  r p Ѝ@-A M@ PQ@ QA  ЍU6%@ @!0S Č 0 $Ā\L 60@U0  S@0S4 0S/ P(\ 2/D@?p@P` rq#PPPRQRP Œ ,Ġ Œ R : @?p@?-&p@-F@@P0S`$M@@/0\ 0 0@g. 0$ ` p`@ Q  T$ T0YY p@i ` KR'&H&%$"$`$""""""""$##X@4 X' X* <Ѝ\YYI0 $0,-u P Y0|030p  R Y r3  0  Y p 300 0Y0|030\ Yx0 ,00( ,0\0 $(00$4  P0 ̠  ,(  Ġ04,(04(0 Y | 3 =%0  P> 0p? p %00 +p0(pp((0' (mY$\ # 04S #" S 0  Y  =#0H Yr3 p 0p Ă 4pV  p(pppp   (  $  0(0 Yr3 04S10p pp ppR:0S[X  l @` @@q g P R  0 0 p 0 YRw0S3 =0#p  0pp ?#000Y\R R0?p #pp0C0SS  =#p0  pp00z0('A-pDe@@`@RQN@` D $T>0@0S0 0 0& @Q 50@P$ @A&`40@ 0   /j@-D@@`4 0@MAR\ Ѝ@C  Ѝ@- 5@-F@@MP%R 0R Q Ѝ Q1 Q`%@ 0pu`q`r f `@,,|,Ġ p  Q0S @%0@g<@H<@R<@4 0@ 60@ R/G-UP@TE@@rqP@0S 00S 00SCܥT. @Q `V>m@`@0Z C\9  R+ 0  pHL =D0X` [ , Z [ Y Y p4$ (,0 Q  R! 0` P 0S Z20 ZPJp` Qq Q8 R0C0P RJPQ[mQSS|RmP U 9`P` (,8pP@D @> =T@ @4p$Hp0LX\XQ QQi SQM`pp` !* Z@p`p!xl' ` V pi`QhSQ` ` !l( X @p`hqTpPЍ/ [ ;, [ [2,[ k P$ $ ) $ +$ l, $h ($Y[ @([,   ZXY i$Pm$ ,p ,7X-X:4$ ( ZQ 0J`Pr044#, O-DMPl@< @ VP@`@ppܵ"`pTP@         (PP 0$ `T0 SS@cpP] P7 P P 0tp@0S00 Z P`Q  `TA P; k*P(,0S00p3 0 0 , ,p 0$t$"̠x ,'Ă0p$W= 0p0 0p,,  p,$ $"̠""CC  0Si 0Z & 2S"$p Q \ R P  ppp$@@`<!(4###0Pe `PDЍP 0y0S0p3l0 p$0 pp 04#̠|< ătW W $0SP 0ppRXSG0SZQ ZI`F 0S0p30 0 ,p00$0p,p  04  ć0p 444#| ,px,<'ă 0tWp{ W $p0S}\ 0 p0  8 0  8  , $  4 $ ,p$$"| , p'$4p $R pW $ R0S 0p  p0S R: 0W0WW $-R 7R 07 0  Z 0bP $0S0 000p03 0 0W$ p0pp R$0 p 0 Z 08 Z 0p8``0" @ 4/ @4/Y`pJ= 7:Y5Wa  W`ʸG@  4/ZY @ 4/GPڸ @4/0@ 4/jQ hvp@@!4/W `W&  W  0W$ pJ@pc4/0  0',@4/P@0S   0!' @p4/  0 '8@R: 4/@@-B0S  R 000,\ڄ@"000t@0@-@S# p@-@P@R0S Q p@x@]+# jD@V+# Np@-(GP@@`@4  ?#0P  p@96A-(g@`@P ?0#p 00pCP p|  0     6t0@ 8$P0$00@-@S$ (R@@*# @60@@-B0S0S S, R؄@0@S  & @0SS00 , R/ф@/p@-VP@BP P0 $ SSpp@cRO-M0P@04S R `F\@@ rC \U \ Ѝ\P Q 0CS @E*# 0SSO SV P ??Oh0J S 0  Bc   C P 0  P6  #  A,Qڄ@\P Q CP @) @ *# \6 0@\6 0@ 0# @0 SS   //QO-` MPp$ @DTT000BX @5/ @5/DXXwwww@ Ѝ8@@!5/@5/  0%Y  Y$@R:5/Z&    @`5/ X V  @5/ X  @5/0@ 5/ X H@5/ jL 0$Y I @`5/Y Y  @5/X`  @5/` H@5/X`70@@-A0SS S  R  @ R @,Q @E-@`(WP@ pp0=# GĠ@ 0 0p0`  3 @00 <0<00S/E-@$`(WP@( pp0=# GĠ  0 %0p0` ( 3 0@0 8080@-@0 0D `^0 00D/]L_'pP 8 $pp0%0'0؀0 o0D@ ^;_PGWPU r0 o0D@]-_Wh0 o0DP]#_@_0 o0D]_W0@-@S70@@-A0S 0S SnS0  S@@-A0(& SSO  0@-@SS8 4R@@T@(# @(p@-R@@Q0S# P# p@A-@M`LP0S.P*JX* p  /@0 |"AS"@^ C?ύ P"0P? 0SB 0`<S S ߍ  X @,$ C? [C,VꃏoY C" R :@@2' @+@-rWP@`A %0  a400 0QA-`MP" (  @ @'(w p@h 0=#HĠ 0`%00$ U2܍(2 @0@  @'O-M@A\%\ ߍQ} Q~ S`PPJ @U1 PC㢟@70@ ( Q|L0WPL &P ,  C@&  #  V❯ %C"?$  ;    ZP,|\00Q 0# v, R @0@ C@&@&>z;wR@- M0p@0p4SR RG@@ Ap0CaRꔄĄ  ЍP @0*0S @ \&l @&# Ѝ@v @ Ѝ@i& Ѝ@k Ѝ@# R R @00S @ 1&#  Ѝ@3vE7F+  02A0/NI 00/-x 0jMV 8M pNP@  ` @`L 4, b*p tB0 p (ǂ,n aL p  `$ (jp寿|O `  p$@p* 茊D @` p ` fj0J p  p  $džFO p  x k(yF p  p'霋D+H ){H, ` O`G 0pj ' ` p pp\)H pw 4"` F `fe8!  ̆<-O   R!:  ayJ !p ഹD  4'befOp`  k@ @L pp荋Q^B  p `᪗  ඙N ` $ ]pb)/vM`  kƂSD@p `  `뽌㡈Mp` `(kᛋ  gN p  b  B `p   `f 7L p`, }  O `  kZD  aɆ J 0ap# ,O   `-ْoF  p ` k|*}Hp pB$plɆO   ap,qH 'p !g~"!*-F `'j (  OlȆ &  "4 D*$J, *(p/ g~+D ! ( ``檇໖O `' & pl b(nK*`( ƎᔂB "` p!ghjN)p, `,`zM (`,  mb(d@' `,9 Md" )  lΆۖN&  *pzࢯA, (0 ea଄L ' *`D$)O P`( lP*D @`(pPg{ৃ@ᔋJ` @*$`9P  \O @$P %i[eF@ ` P&,l @ HP `%` p}Dg{POO@`*4PѝᄕH @ `$` O^%_F @`P*l͂@,OP %` @ pg{J P `)@ࡁ PD@*`( ^%SWO @ `$ 5h͂P:K@ R `p$i{0ZB @`P $c  @kNP`@% P `@5Pp p08Ѝ/0O-PdM@!Sn R": 1```PEU p 0@S" &*.0 2p( Ƞx # ̌'0p,+/p30    |0  pp  !$0% (0p)4, -0p 1 ( t4,0$08p>BF6 J0:Np(7 Ƞ;x ? ̌C0pGKpO<4 05<  080 | p9p<@0=A 0D H4pI EM LpČ< H0pL@DPTRV SpW 8PTQ |U0  Ď4X\00/dЍ!0O-\M@ !7R8 bl@P0T*.p&`2 X0 ("h ȠP ,#8'p <+P /|`3\`PP ̆0$` T!%4 `(p) - , d0 1pPP 0 ,$$`(0 FJp6B`N X7:0 (>h; ȠP ,?8Cp <GP K|`O4\`5P 8P ̆90A T@`=4<`DH dp E I LMp4P T80 <$@`DHPL  X0P,d,.| `#`3bYZp[]^ p_papbpcpf`epXP\g`d0\Ѝx b,70@!\0PQ S0/70@p- @T@ 1SF R\0S0 p/R@`TPPVPU`Pbx`FU`V RO T@ `R#:V R`V`V`UPU@ B0 0\ R@Q00*0S0S RP\ R@00Qr3R\0S R@Q00 O-g`@$M@ pሠ Q T 0 XT X ^:  !RT^R T  ^T RZ  ^`T Q   0`$Ѝ^ R/ \ xLX\^; @DpQT\6 Q  P 0Qp@D0P@D`P@DpT  @^  p@D^XXp@DA-M@ p  P`UL 0,SM  P@S4U2 0FVS&DTP"VT00 (VB @ `T670@@D,0@ @V 0@  @ Ѝ @  @\`S@) 0 @P C @0' @@-A-M` p + @PT: 0,S;  @S,T* EUR L\PU870@P\, @ D,0@ @\ 0l Ѝd  @ 8 @0 @  070@@0-- M0S R 0C\ <H                  T R$:   @ Ѝ, @@ @ @Q! 0\ + @@ Q \ \@@+S00 @d@P+ 0 @8@,\@@+S00 @-0p@-PM S M@@1 T @TЍpM@@1 T  ` 0`8 0@ ]0ATTQO- M@P) `XX000pBW`@1S  @4/ @4/H`W dddd ЍX' 0SpX"J@ 4/W0pJS @ 4/ZpJ @4/p J@4/ZpZ`iX XZڰ\@@@$@j4/0K pS#ꔥ|LLLLLLLLLLLLLLLLLL$LLLZ  <@`0"4/V* `@`4/ WV   ` @4/ @4/ W`@4/XwZ  Zpp0 lZ0 @. [ 04/ R $@4/ R`T@`4/H@`4/ @4/)~S? 0`i00@`4/p@-P@ Ad$70@p@A-GQ`@@Map0 S Ѝ$P !}p@!T0 0T0` @@ЍA0 r G8 @0  qTTA-`pWP@@ Mp@ = 0@Q2 R 0SKQ80S P0SЍ0P  0!PR%:   0!P )0!PP 0P!PPP 0P!PPp@-Q`@@Q0 S  #@v70@!P \^0S  p@O-@pPአ A0S:` P V 00# `0S V  f `P V  S `VG0Pe0P] ^ Nr0X 0 0!P`0`` `S xA % \Lq0 0x@ 0 P`P 0S  V `?Pe0P ` 0 P?0 P  `70@-@- @Ad&#70@@"`70@A-7Q`0@@Qp`m V V R7 0@\^0SP@AIP Q @AAG-1`G@@p!@@,W'0 @@P@1Wp`P@1000000100000000 `00000000000000000100 @00000000000O-G@@$M0`p ㈀ 0Q00 0就RV ^P PV@T @ R   0就@$ЍQ^* @Q^ 0`F^ PVQR&:^`F  ^Qq@Q@Q-0 M Q Ѝ0 S - @!T  P8 @T 0p@-PM@@T0 8 @0 T0p@!@-pg`@DM WP@@A!0pSQ R \'  @c@  }\ @ DЍQQ @P0S C8 @< @O-$M@P@ '  @0@T  0PPPP PPP Pp㺀T$ XX0 CR\ȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳȳ`0V0W  p0jSP@`X`q3 ZS ` RS 0#2⸀P Q``x @  U `X`0s30``ⶀ 墢Zt Zl`` Ut  RVP ]X0s30 U 0UP` X0s30y U 0D S{W W k 0$Ѝ`aWV  U  0jp] `P @ k0 SP@ 0`<0SX`P@ @Pp XH?` 0;W90  0PP p@m R=`VX8`B0CPsP@ R`/"P0 0  R' :  P@D j0t@@P@P p@`  00@P `Ƞx0L0V 0j T/@-pl` FPP` M@@0 0+P@98@-PF@P# x40@\@ R  0 S \@8^ ^ 0 S 8@ 8@-XM@ QP0? 0@ XЍ@5 0@p@- M@Po @PU^ l@ @P4  P. P@\P Q5 P@< "P R2 P]P@@  P@ P܍p ,@@a ,@ @ P @ P@x@D h@u (<"  <S P P//8@-P@P@Q0S 0 QP8 =0@^  0S\@\ 88=&p38P@-@rTO-MMP H,0PR 00L P L̝nN ` 0 P p| PU X9 P4 *P PU  0 P}<SLT .`PP@T` <@Pp@pL<S @H̝\ <0$Ѝۍx*WJ p  0z P \U(*RL R Pp0W  0a P \UPU @PK +^p<pP 0 D P |W zpPR( : $@z\pA@\hQqp^  pP ) R +\U0 pK  /Q +AA@PP A6΍ A> PA@C\) P` ^TW Tp3=@-0@AMMP0S @3/PЍۍ@@@@@`P! p' @ @0 ^ @@T U ,e+@-}p@MP0S 3/PЍ@@@@@`P3 @ + 0 ^  @@@TP 00-S !S0 -R !R 0SU @P g@E-X@`@@MP@FpPB U1 0S.P 0X@FP@4 Q 0-S !S0 -R !R0SZ 0P0V 0S`Q @Ѝ Pp@-M@@5 0@aR* @P" UP@=\0@%  P P1 0Sp@  @ \0{PppPUP@=\0@,  @ R  @ 0@^[P  PO-؝@,M 0 @P  P 0 0@S 0 S0S 0S ,Ѝp᳿pP 0S   0S =0@PU @@@I/`P`  $ ǿ @Rq$ 0+S Sw `0gP  RR):y P 0Sv ϿV /p R6  )<y  ,40q3C PU; @p@'Pk t@!P 0`!V@/c`P` RH* < ,0Ď ) ̎! x @*PU7ꈰ  @0$00x 0V ,, !$ <("ā?J{@ @ 0^ p <@@BQ X  1  NP ^ \6PPPPPpPO'O-AM MpDY @0SBX@@@P@TP>`PB sA΍ 0A΍@C@2T.Y'P 0P ,~ P@ P D+@@ЍۍD @f,@+ $V @T@-@@AM@@ M0p@4PP0 `A΍\ + @A΍ @0@PQ +ϾP @P ǾЍۍ+㽾$@@@=0@  @R /d@+@-@@$0S  @,㜾@ @ @-@4 0@ O-M Mm!0 @p7@Ǎ}DǍMtW@@X!0 @Q(\60@0\ m 00@^ @PP@P8o@PP@ A-hMP% @T"  HP@D,0 @ th T: @0@p@`@  p`@P Z=0@LhЍ(PD,0 @ @=0@P LRT R/P @R/T R/P @A-gT@0S#UP@@T- }o p@0S (P 0S 3/Q @ @@T Pd@AJ,P A. @Q@@\A}p@@-€E@@ !0SM@@M@@P wI00@M0@@PT0PLQP0@L# p@-QP # Q M@@@AnX QXpp@M @@AX QXpM@@$0S AX QXp ,@ A-#@ Q@ # Q 0@A;pXS`1`#P@ X @篼@1X pWXpAzpA-UP@re0q`@@`S ! R (P 0S 3/0S]P@ 0S Q^?  x00S*`V.T@p^\  @ R9  , A@ @`+X`QVX`A$ A @`X`   @``40@ R Q d@@$  @0$0mP@OPG-}p@ R,:`P0T S) UP@@T ! (P 0S  R 2/0 S@0S 3/@T @@  Q GL@TP@@&O-@p`( R) 2S Rup eP 0St\ R @ 7/(@ (@] 00 @7/ @7/  |@ 7/ZJ ? @ 7/ Y 0 ` Y jj @ 7/ PʵS @ 7/QQ  @7/ ,   @7/ @7/90@t @ 07/  07/@ 7/@Zs0 3/m@7/h @7/b` @ 07/[p@-`P@5/|@ +4@ &4>0@@T  @T @ @E@@0Sp4 0Sp8@-PD@P 4>P0@  @8 @=@-0QQ Qp30 3/O-|44%p@@@@P M @ 0S |G@@(0S  `P  ЍP 4D@@(Q  `P @T@ @`V (^  `P 0 R @P (`V  `P 0S E@@@4@T R (^  `uP 0SPU`8@-@PzP(@0 2SB P88|70@P/5P/@-@0S R-: \$@@@L. @0·}@-@0S $@L.@ @㰷k8@-B@@PF00S .S k,`@@c @ @\,`@8-@-MMA@ 0$č @0S @ Ѝۍ@Ѝ/%$ @@8@ 0aA-/@3P= P㋷`P$ @㳷P- @㭷pPD L@̷P$ @ 8/ L.@ @ U  葶P @h @U @pῶP`P T @7 d @^  Z @ @ @㩸A-I @@`0S' i/㾷PP)pP U|G@@* PŷUUUU8 @EpJi/㔷PP|pX㊷P8.0@- MP@iQ  Ѝ0; T 0@@ @-M@ P 00ЍO-u M `P@p@ H0S& 0 S>*0 Y6 V[@\Y< #Y 0 'Y"YgHpWI 0 SK* `0+H0`SypoP 0S8  @̺W]a[  ` ㈕p@[# P a@QVH[y 0 S*0V0 P \Px WH pRd 0 Qi*V00#P  2 aSWu  Ѝ0W0[pC p}00@\YH R.: 0R  R* 0@[H1Q  R* 0 @R H1[o   R{*  0 0 0 0 04HP 0 S:gH[ 0S *0QUQxP 0  @ pH0SR 0 ST*0 ᱰ0 .0@ [7@H^B 0PD00@ 00@ S70@H 2R0ٵ0Y0Ե0n0ϵ0w00I00^00gỵp `᯵ᬵ 0$ `G-D\F@@@0PX |@Mpe  @ RJ @(@D  "RVE ЍdV R; 0@@0  0 @P'  )  @ZL  @P R$XZl @  d` @ dR @ 00+  @S 00C\!\d Qb 4(QRD @ 000P  +  @0 @0@@q 0I@ .QQ/Q@@Ѝp0@㱳9 0@0 * 4p@-@M@ & @@P@0S @nP@Ѝp᫲`ᅱPP% .> @0@@$ RR03: 0. 0R /R 0R|0@ @ᥲ@_p@-MS9P PU 0SPЍpj`D@P /@0 @\|@@ 0Pr@,A-( @`p@`TV @`U@ P4S 1@OU V@`P@` @@Qp@-P`@0D @0S R T 0Sp(P @0S 3/P а@P  ⹰(-  @Q = 0@@@p= @0@0QO-pM P$M < P~R,] m  C@@@@P@`@@ @@ @T C@P=\  ~R  P @d\1 ~RT Q \b "Qa@ ~R Q\K "Q] @  " A$,d\ Ѝ\I R @Q -  @ P? A  0@ >0P000. R2  @@}R }R  " A"y  @@m\P @Q -  @ P A  0@ 0P000Qu}R @Pv @ @" @@$! *\h}R Ph   " @$,  -   @@   @@wQV@TS @QP PLA 0P000?\C RO @QPR1&: -  @ P9 A  0@ o0P000(@ "@@P "P @H -  @  @/   @@ -   @@ @  @-E@@0S( R < Q 8A0S8@-E@@0S ( R < Q P8+0S(] P@qP @2T , = @@0@@ 8@-E@@0S ( R < Q 80S@C %@A- 廮$= P0@F U P@( - ,= @@@ @0@ } e]Q@p@P@@@@ \ 0 0@/R/`N@-@`pR2%:TP P: D@00Dp@-P8PTN@@`_ ,znp`N@-P`ppP@* ` O-pAWlM, ڈEL@@@$@< ,@4 R%R 0%SSP *P`UPpe  @R  0 0S *S  $`@@ @0`C0A@.S `BC6Q񟗜L<88 <( P<[PP 0pF` U`K60PE p p26[p tڨ6PI  I&6VP0p(0S SExEPL0L< `e dP DЬPᑭVP`TT@f@fT0SDpd p R 0S 0 SW`` 8 pfW@,0,c,00lЍP @ 0p`qS@@᩟PV0[PW \M`-0$S pW` pG0CCS \ T W pGCQ1$ P4 P<P( [PP8UX 5P `F<0 PZ0m5V&P$Fp\`p0U\`@ 0V`@\pDw0P|)< @ #̠ PP<.4 ă\\,< DP5V ]0F S0 WpW#B@ 0pG0SI Q  Q WpW!B@ pG0S5 R30: W BpW@ @pG \0 W BpW@ @pG0S \WpG%pG%S\ P Y<  ( 0 = L 0WpPPQ , @ p@>L p=pPd-@ M0S #R5?:  @Ph@@D &P Ѝy0S P @A-\_P@w80@xMX`Phm`@Xp@0@@ @h@X@\@l@p@t@  P0TxЍ@T Xh80@@P ` `H`a# hm `@  ԦP*@Q tP Q h @.Q @%hm `@(4" ,0  嬦P\?p@-0@ MP/R  BRP/ Ѝp@0h]@@@ @P@@ @ `@@@P  ღP1 yPϧQ @ƧQ @p@- M@0h]@@@ @P@@ @ `@@@  KP BP\@P? P/ Ѝp萧Q @ꅧQ @\?p@-0@HMPL/RHЍp@`D Lo 0 X 40$Ph= 0@S PYQ @W`@-\O\MP@@`pT 8_X/h80@Rh@ pڥP\Ѝ-@P wP Q @1(P,P0P4P@-\O@@P?S8/RL/\?0@R4@L/\?0@RP0@-tM@l P㥦  @Yh= 0@ 劥P<(  tЍ0( @@-h= 0@?Ht-h M@M D 0ePЍ並0iS0@- MP Ѝ0hMP@@RD IPd@0S # @QR D8PTD 1R6<: PQ @Q H @d @@-@Ph=O0@ D PeQQ @@`- M 0Q 0" Ѝ@-MPЍh=Z0@H P4S SN@@S SN@@M@@,@,T@(M@@@-$M `P!@p @ @ P@@@@@@@pw0 1@奤P@)$ЍQ@`@@Q x@@-p$M@ ߤ`P0 0 P000?' r@T 㢤$Ѝ@G- MP 㹤P-@` @ @@ p@@@@@@`  }%,<  @!TT01P3Pḥ Ѝ脥Q`@XyQ Q@K@m ,8O-|M# MtwJh hm@`@02 .܍PnL\PT;*2۲Qj @U1[ !R @U)!R* @P , , I@0S$ @^ \?0@QT?S Z T@P e@P P @㊟P p@Vs . 0T? <Q9 Q @EЍ^Xh@0  \000 0Pp!"(0,0$0%  㺞PQ ,@Q @@Q @00# <04 808A-@hM@@`0PpS)Ud/ @Q @PE0\4S Sp PßiQ Q Q Q Q @A@U@AA-Mp`|@@؞렞PPF 0T -u(P6  , P  nUoOC ͍@R@(@T l60@PRQL @Sמ @たݍ0\1,Lܞ ( ֞ž -@-M P`@ pD 0  S  .P Ѝ0 01 0 S .^ ! $E-8eDM@@`@ M@ PJC `P"0C΍@\O@@0T4T塞4$Ϡ@20@@8ĝ##0$0X?P XD @\QR LЍۍd/` @0`_`h?d P{ p@ D wP4' qP; P ptdPF\_P@!>Ec}CL 0@-[dhDt\9lҞZ5l@͍ B>  0P@R:?: ,# -P&,岞(尞  @ Pl@' @ {᚞lP'` @dh?PPl\L@i,冞(儞a`a__xb@-\O4M@@T P5 D\/P @;S`5 D p@+1`Rڸ廝0P04Ѝ<;0 0 08 1004 10(00 10,+000DA-M\O@@@P@㧝P \z 0,8;0P5 D04@;<[応P< 5 D,k@ P@[`pP`P- @SP,k@Q@[P U L`EKpP @@P (@:P L@T%\_@P@T Xh@0 \00000 0$0h=0@ pƛP 8XЍ2(0,00040Q |@0@-\MPP @P@ 3 HP ,  R@\Ѝ0@@E-dO@@`0Sh]^~P@P >P10SXh] P@u`PS # @\ P0P S S S @QꟜ0 S S S @0S 08@-d?0@@TR;*:h]P@P@,P z Q @8@eP@ @P @8@` Q4d@-d_CMP@p@ `0 ,0 @LPCߍ@Q @XA-@M`p@Pz\_P@ ?S `Ÿ W p00.K. ;  "& @ 0s> SZ s;0vp@Q h- @ 0S QQ QN 0S @ᗚpPN   P5W  @  @Ѝ@^ & @0s ! h=0@ R $W 0 0 W  R걛Q @ p ꥛0S @ pW Ț,  @@T`IA-@`0S*d_hMP@@@# @0S9 `h]`P@P壛\?`0@,Q # @^<D PYT@\Ad_\OP@@@ ,R/hM@@ P #$!0Q00(P8# P&  ڙP r RP(`V @&hM@@pybQ @\ p @ @\ @8`d@-@0ShM@@ P#PP@_hM@@O-MMh}p@.2=P  <\{P L``VP2RQ @VsU P @Vj @P\C @Vb\ P  JP+9#  ?PP)TB* ( R<0: :㦚P @@ @@i ' LLLLPk  P"   P.  P̝ ) 00 OQЍۍ@V0 0  Ps  n  ՘Ph 0) a P  ØP^,Y  ḘPS,P)00x M  @`A-\O@@HMpL_U HЍ`D ᤙP P0P$ 0pP2  4Nh @U P P@4L_P t @kP ܙ@PP @P @귙Q \ @, @`A-4F@@MP`0S@5/P p@ 0`@`P5/Ѝ8@ 0p@ 5/06A-= PA0@`P0 ` `D"0SF p@_S+.51@  0S% _0S0!5 !p_0S0(5`0S  _S{!u /V 00`0S  @ @`<O- M50@  ! p + @P@r{ bx wpv`%Rz,‡$B!b P@`p0L P7Lp:Q+ pQ"P]4FP@@@`^ 0P@ V 㭗`W 460@V`0Ѝ0D @t0p, @ P @  r{ bx wpv`%Ry,‡$B!b P @ `p0L P7LR=%:  ppQO- MP@&` XX000pBW @5/ @5/H`Wjjjjii Ѝ@@!5/X$ڸpH@ 5/WpZ  @5/ HpRڸ @5/0p@ 5/gP`iX 0S~S@5/ 0`iXp XZ$@j5/0G pS`jlmlk|kZT% @0@` Ď Ċ 4zp@\#5/W @`5/ W`V   ` @5/ @5/ W`@5/XopZ  Z0 fZ@`5/Z `@5/W 00 B^\d0@5/0 WoS  B^^x@5/ Wcd@ L ^^ @5/@ 0L ^Sd @5/Z @`$5/yZw|`@5/W0 @0 5/0WZ    @05/0 0@5/0Wk N`iZF0@` $5/<k A`@5/40@5/0~d@5/&: R p @X aPUJ@Q  @ @ 4Ă Rq \ЍPUJ@\ @^0@Q@ P @!^0@"Q@# P@$PEOPUJ0\P@=0$ R@ %0 ^ @ % Z@%0Z0PS{PUJ @R500SS m0@0W0A-pN @@M0S  RJ0SP ЍP`0P444Pp> 0@\&  RJQPPP P!P"P#0Pp^ P@\& $ 寕 A RJ`0p^V``P$\3%0`P^+0SRp> 0@P R QP RJ 4 S{Sy r3w%0PXq%Xl0P`pA-pN @@P0S 0  ` P`(d`p> 0@X  pp`pPp  !``"#0pn `@Sp> 0@P%0$P p$0S Q $0S $P0SP $p> 0@Pp@-pN @@P`UPV`P $ה Pp> 0@Rp5ppO-KM 到Bp~ ㈓D,0 @  p@B D,@ @0  :0 h S T0a h`@ hM @@P㡔JύHPPJR?3: X T0C HP@ @㎔0JT%p@J @@|耍 p Ƞ+  @T1+  @@1 L>0@ @@ 0<   p$(,`0P48@D@@噘KߍHPH@Th`hQh`@ T0HP@ T0@ @ 0@\ `TA @ 0S00 p 0@R0 S 8@P AS* P8. @^ @@Axx460@P HP8@P  @k+$@Aꎮ|06O-p~ M`X Pp@` X (Vx@0`VBJ P@0CS.~\},~8~,~,~ R0 `T^,`P0S Q R^P 0S  埒P V:@D 0@P`VJPЍQT 4S p0R \00\P bTQ0b 0$ Q   \@T \\ 00 \ p @X 㚑R  \ ꀭ@-@0 | h T p`PO-h @$M@ X 0JT/   p. ` P@@ @R@:  T \\@l 0 pA^tD؂Ătp@0Z0S `U  B`T PZ+ R(> 0@Q\P Z | R0S ^ \Q R00`9`i `$Ѝ\0- 0S0\P^ R\|" \~3 0Č ĞfX CC   Q00Z~ Zt S00m\i\d L0\`0 0}0 lᣐ 0 0ZXP Q\F0^ $ 0@0TR-T0S3 0TT00R< 00A  0 S. P(#<0AA.$ A00AT0"r /S00 ` ` ` \:  0S 0  t0ՐP0\ L0ʐP0 P'  u}0 6D0p@-N @@0SV]  P@0 SK> 0@P`` `0n `@S\^  R Q0SG\^ R Q0S\0T= 0@^T T0T0p  @X @寏pQ] P@ R 0p@-`M@Pΐ@ @ϏP 8@Ð8@ @ďP P@㸐P@ @㹏P @㭐@ @㮏P @㢐@ @㣏RA : P @㗐@ @㘏PU  㡏@U< 0SE :S.S5P@R Pg @0Q= T : " 0  dR `Q@WAq P`UWPE@.Q:Q\Q Ѝp@Q7A@U7PE0A00PE@0S\P lP 0S..(.Ġ @P00@@|@yG-`0S- RM .pV|P@@/1 @CtP R P:@*0 @@ 0eaP\00T0S@S S!Q:pP@.@0 @DDă,L 8 ̄#445@@SP.ppSvD,p@ @C.Ppfp@-MP`ݎ@P ኏@ 㛎0S 0;SSЍpO-UP@dM 0STET5@@0@ R"UEI@@@@UPT  0:dЍTE@@ P @1 T50@R P@B`q VX@P 70~ Pp@` .8 @0@H `Rv /Q0S / @ f`I.@ @T50@QZt@H\P0H`cP0T` H[ `@ @`V \ @N@X IPl\ \PPO 0 EF  @6L@@_ 0,-SP /Q -厠 ^RB: 0xf/0  @0`r 0 j@ (0 @<8@@H X墍P V R L(/  @\0 88X<0 o040 Zr \ nm@(` ἍP `aꀅTp@-@0SpD@@ QP P50@`TP `P@p, @QpP . P-,`p@ҍP( P`PqP!%(<"T4 P # `lJʠ\ # L^ # ##Ġ10`.0,`-0`/0`-`BV$ PV0FJ JJ 0\  V 0(r燠p,  ⊡Cp V@ 0kD:9/ P d?0@P Q/ R/ P@/@/@-@MpЍQR 000 0 ᏍP   s0qp@-@MЍp@0Q Pa1 S S 0C0 P1 @-@PM  a@.ЍP /qp@-@MЍp@0Q Pa1 S 00 0P1 @-@PM  (@ЍP /@-@P P p P P 0s 嘋D ၌ 00@-@dMPS*p 40SP x40  P 0^  0P嶋dЍ0E-@PpP`V RC: f  ᎋP P008@-0P@p  96BR 8P88@-`PpB@P 0 p 00@xA-@Q Mp$ @PPQ ` Q$@P1@Q*  0p@& @ ЍQ  p 0  `@@O-PP 0@ /E-p@ Mn P`@0S  Ѕ T& ^P00?P@!0 S,S @S 5@0@RF: Ѝ0 S,S @pp@<<@p60@- MP @ᘅ0S  | 30P00U Ѝ0D,@ @ 0p@-AM0M@PS 4@ Pj2P*  Q" UXЍڍp4*@ j* @PU!P@U *@~ @X T=0@@A-@ p`P@ 0A@-F@@PP F@@P0 0p@-F@@ PT=0@Q QP@a`@q 唄P N @@QppQP@ R S㩄 @̈́ օ @-F@@$P@0S 0SX$(0 =P@@q@@Ip@-@XM0S2 60@, R 0@& @T6 T @Q 8Q 4 R< 60@R^ Qy4@TvHM@@! @@P ᔄP  P% XЍp60@,QI @@ RX@  {P: S THM@@@Q @>0@? 0@"QP? 0@"QPT]`P@`4p Q HM@@4@@ Q+ HM@@P@HM$@@ @`@4P0a,`@@8@Uׄd@҄HM@@u @-@@ ֆ > @0@" G-M@` (p P^5 4A/`6b  a0刀X4X^H^ 0S*  0HP 0 S*HRG: 0H0S 0S*H( 0HP 0 S*H0HP@ 0 Sg*0H^> 0SH*`0W H0S7 0 SA*I0H\3 0SC*0  0>OᡃPЍH0S8 0S(*  H0P@;IH\  SIOKzG C?HPgH H0SkH݃HPoH׃rH !ZHjH\O-cML@H;852 / ,)&#    T @DP @ 尃p +㩃p L㤃p +L垃p H0L@S 㕃p +H參p`@g^o~ p@ `@p @PPe H Z [8?  HP` 0 SX*@@0 HQi 0PSj*xpp`0HZW 0 Sk*0HQF 0PSZ*qGd`0H0S6 0 SJ*0ㄱHbOLPpHL"p2 `QDd d @E``$@ p `Ph@ B<4(,0 00 0R0SV{  [΍Wg  [΍8 0tpʁPj@ ؾ @0S4<0  ⠲ 1b 0S00DS1  X H(ہP(p`( bύ" Q8 RH:  0X ,ÁP, ``,$00wL 8>@0@@R@n$X b  2ᠰ0S U\ @m4 <s0` 00s 0b ⮂1  bZ xh l{ |1lcv 4 .1DD 0 0 0? P  P0y <40L L@^.f`P| b ̆R@ 21   -0͍ @&0P 堲- @ 1b,  0S( (^.@8pP?x 0 `Q 00 (' @0P 0 (@(0 ( jHP0S SS @* i,݀P0Su SS @ ` `|ꋁpW5 W Wpp0(@(0|`V V V``  @ 嫀`Vf`@_ 00P? 0`0@, 1H倁pWQ 0P1 d(70@(0p 1`$00(@(0@,y(@(} $ p`m`@00,`  ` 1b(g`@dp(`` 1p$^ @, `1 K`('d @( `p 1$`I  dPd@f ΀@MȀꀁHÀLᾀꃑy湀1s@,@<@@3@-@`:pP P @ FP@@@ @㨂ĀH8/ @ @(0RI:@V}P@p@嬀夀e0P @@@PH @ D eO-j `@F*@@M@0 0 00R0DP VP@@$0 @RP @TP@ ^ @P |ttp@@ 0@R00, 0Sn ! @@H @@p#c^&  @(`(0| @@SV`  `V`0r030` @V 0(S| `@@( 0`pp̆ @b (+P\( P60@Y((~PS(@ (RB Q? u80̆ @S D R% ~PR~PN80 HPQ Ѝ @ d :0PR  ~PKYZ00E 0 ~p0 :   k~PZ[t0 x0 嶷~PBP@i80 PP mkig Q \H^$ ̆@p T=0@Q@ RH60@P Qp 0S R p P# ^ > P0@D,0 @,@ ぀L60@P ^W P `=l0@@(W@ R& Q# H~p@ @~P~0` @@S Ps ^p Rm\ + <Z,4P{D Ru (Pp(0 RP~PX@(0 DP4@(0  RJ:9P^0Q?@jm0 *P'(~9H0S3@m @@g8 Rq( @&P p@p K} ,\@Z40@Pn~ P5 ~P  P @;@6@/00P @':0 0 @<~|t@w> 0@P/QF}6@-0@4 R 08P<@TT0@@0S |P }P *@L  @@}PP}x @@L@} @0S/b3 E7F, v0N0(I2A 000000000/-MP@ `x t0`p  |0 0p p ` `px`Π l t``Pp ` P Pp ` P @@p P@xJlP t4``4P`| $p$` P p ̊.x(t(`0P0p0<,p p,`P @@J\ 8Pp 8`P lX0` 0p T `P .|F ` 0P@ $  @p H`P   @ T @ ., $ P , `< (p 0p(蹠L!4 Dp8P+ !  ` @0 `)!P$Z ` %,@!P % P[@!` 0 %!` P (@%pP^!@ % @!` @&`! PpX&`% &P `@`P%!@ p  (80Ѝ/RA-P@M0S @Ѝ0S[ İ0 Rr lap@@V@pd0:P 0V:0V*?Q:? 0 Sp \ S S @b0x@S7Vw`n @ C%0 p`@ ?089p:`;@<=> B00d @yp@gpΠ@ W|0c@G ,0`08S @wy}zp@-P@ k 0!̠!d!`  ""Ġ"(   ""Ġ"(  ,,,,80 pp@-I@@PAy>y;yRL:8y5y2y/y,y)y &y #y  y y yyp@y ?A  1>  c0l1/O-EM, d        #  *  1 !0aP\A s@RA @VPC@B@PB @Aà4pVq$@PAŰ֒VR|PPց(@`SB0аpSrRƐǠ Ȁӑ`Shp`l@  $ 4p `@PP1 (0p !̠宣txps``PS@01QQҒ(ґ8ӒHSLӑPST@0à^ p^rނڰѱRېݠހ $R@`a P^QX@@4QRD<ܐpS` P0@`Pp @(48`$<`P@PDpHLp@P@` Pp@TX\`hl p`tPx|0 aQ"x,0P`pUC祓(p@@0s֑ V,ՒUՑU礣 $TԲ48TԱ0VC S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \RO:JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{ & * Z>>*S 51:3`//// *& *Z>>*SJ51:3////@-_t -Ltdb_store key failed: %sVirtual memory exhausted allocating %s database entry%s;tdb_store failed: %s%s=%snotifier structlosing track of %s processChild process %s (pid %d) terminated with signal %dScript %s finished (pid %d), status = 0x%xError waiting for child process: %mFailed to create child process: %merror waiting for (dis)connection process: %m/etc/ppp/connect-errorssetuid failed/bin/shsh-ccould not exec /bin/sh: %mOut of memory in timeout()!CONNECT_TIMEBYTES_SENTBYTES_RCVDunable to delete pid file %s: %mExit.Fatal signal %dpppdCan't execute %s: %mFailed to create child process for %s: %m/dev/nullScript %s started (pid %d)%s%s.pid/var/run/wFailed to create pid file %s: %mLINKNAME%sppp-%s.pidCouldn't detach (fork failed: %m)PPPD_PIDUsing interface %s%dpppIFNAMETerminating on signal %d.Hangup (SIGHUP)Failed to get time of day: %mCouldn't get hostname: %mORIG_UID/etc/ppp/optionsmust be root to run %s, since it is not setuid-root/var/run/pppd.tdbpppd%dWarning: couldn't open ppp database %sWarning: disabling multilink(unknown)pppd %s started by %s, uid %d2.4.1PPPLOGNAMEDEVICECouldn't establish signal handler (%d): %mStarting linkConnect: %s <--> %sModem hanguprcvd %PUnsupported protocol '%s' (0x%x) receivedUnsupported protocol 0x%x receivedUser requestConnect time %d.%d minutes.Sent %u bytes, received %u bytes.Waiting for %d child processes... script %s, pid %dSorry - this system lacks PPP kernel support OSI Network LayerXerox NS IDPDECnRP<: et Phase IVAppletalkNovell IPXVJ compressed TCP/IPVJ uncompressed TCP/IPBridging PDUStream Protocol ST-IIBanyan VinesAppleTalk EDDPAppleTalk SmartBufferedMulti-LinkNETBIOS FramingCisco SystemsAscom TimeplexFujitsu Link Backup and Load Balancing (LBLB)DCA Remote LanSerial Data Transport Protocol (PPP-SDTP)SNA over 802.2SNAIP6 Header CompressionStampede Bridgingsingle-link compression1st choice compression802.1d Hello PacketsIBM Source Routing BPDUDEC LANBridge100 Spanning TreeLuxcomSigma Network SystemsInternet Protocol Control ProtocolOSI Network Layer Control ProtocolXerox NS IDP Control ProtocolDECnet Phase IV Control ProtocolAppletalk Control ProtocolNovell IPX Control ProtocolBridging NCPStream Protocol Control ProtocolBanyan Vines Control ProtocolMulti-Link Control ProtocolNETBIOS Framing Control ProtocolCisco Systems Control ProtocolFujitsu LBLB Control ProtocolDCA Remote Lan Network Control Protocol (RLNCP)Serial Data Control Protocol (PPP-SDCP)SNA over 802.2 Control ProtocolSNA Control ProtocolIP6 Header Compression Control ProtocolStampede Bridging Control ProtocolSingle Link Compression Control ProtocolLink Control ProtocolPassword Authentication ProtocolLink Quality ReportShiva Password Authentication ProtocolCallBack Control Protocol (CBCP)Container Control ProtocolChallenge Handshake Authentication ProtocolProprietary Authentication Protocol%s: timeout sending Config-Requests Received bad configure-ack: %PReceived bad configure-nak/rej: %P%s terminated by peer (%0.*v)%s terminated by peer%s: Rcvd Code-Reject for code %d, id %dX ` h p x       Can't parse '%s' as an endpoint discriminator code=0x%x id=0x%x <mru %dasyncmap 0x%xauth MD5 m$oftquality lqrcallback CBCPmagic 0x%xpcompaccompmrru %dssnhfendpoint [%s] %.2x> magic=0x%xBug in lcp_addci: wrong lengthReceived ProtocoRQ):l-Reject for LCP!Protocol-Reject for unsupported protocol 0x%xlcp: received short Echo-Reply, length %dappear to have received our own echo-reply!No response to %d echo-requestsSerial link appears to be disconnected.Peer not respondingassertion lcp_echo_timer_running==0 failedSerial line is looped back.Loopback detectedLCPConfReqConfAckConfNakConfRejTermReqTermAckCodeRejProtRejEchoReqEchoRepDiscReq-allDon't request/allow any LCP optionsnoaccompDisable address/control compression-acSet asyncmap (for received packets)-asdefault-asyncmapDisable asyncmap negotiation-amnomagicDisable magic number negotiation (looped-back line detection)-mnSet MRU (maximum received packet size) for negotiationdefault-mruDisable MRU negotiation (use default 1500)-mrumtuSet our MTUnopcompDisable protocol field compression-pcpassiveSet passive mode-psilentSet silent modelcp-echo-failureSet number of consecutive echo failures to indicate link failurelcp-echo-intervalSet time in seconds between LCP echo requestslcp-restartSet time in seconds between LCP retransmissionslcp-max-terminateSet maximum number of LCP terminate-request transmissionslcp-max-configureSet maximum number of LCP configure-request transmissionslcp-max-failureSet limit on number of LCP configure-naksreceive-allAccept all received control charactersmrruMaximum received packet size for multilink bundlempshortseqUse short sequence numbers in multilink headersnompshortseqDon't use short sequence numbers in multilink headersendpointEndpoint discriminator for multilinknoendpointDon't send or accept multilink endpoint discriminatorX ` h p x   :invalid address parameter '%s' for ms-wins optioninvalid address parameter '%s' for ms-dns optionunknown host: %sbad local IP address %sbad remote IP address %svj-max-slots value must be between 2 and 16local IP address %Iremote IP address %Iaddrs %IRR*:compress old-VJaddr %Ims-dns%d %Ims-wins %I/etc/ppp/ip-down/etc/ppp/ip-upCould not determine local IP addressCould not determine remote IP address: defaulting to %IIPLOCALIPREMOTEUSEPEERDNSDNS1DNS2/etc/ppp/resolv.confFailed to create %s: %mnameserver %s Write failed to %s: %mPeer is not authorized to use remote address %IUnauthorized remote IP addressLocal IP address changed to %IOLDIPLOCALRemote IP address changed to %IOLDIPREMOTEInterface configuration failedInterface failed to come upprimary DNS address %Isecondary DNS address %Iinvalid netmask value '%s'noipDisable IP and IPCP-ipnovjDisable VJ compression-vjnovjccompDisable VJ connection-ID compression-vjccompvj-max-slotsSet maximum VJ header slotsipcp-accept-localAccept peer's address for usipcp-accept-remoteAccept peer's address for itipparamSet ip script parameternoipdefaultDon't use name for default IP adrsms-dnsDNS address for the peer's usems-winsNameserver for SMB over TCP/IP for peeripcp-restartSet timeout for IPCPipcp-max-terminateSet max #xmits for term-reqsipcp-max-configureSet max #xmits for conf-reqsipcp-max-failureSet max #conf-naks for IPCPdefaultrouteAdd default routenodefaultroutedisable defaultroute option-defaultrouteproxyarpAdd proxy ARP entrynoproxyarpdisable proxyarp option-proxyarpusepeerdnsAsk peer for DNS address(es)set netmaskIP addressesset local and remote IP addresses  user= password=PAP authentication failed due to protocol-rejectPAP authentication of peer failed (protocol-reject)No response to PAP authenticate-requestsRemote message: %0.*vPAP authentication failedPAPAuthReqAuthAckAuthNakhide-passwordDon't output passwords to logshow-passwordShow password string in debug log messagespap-restartSet retransmit timeout for PAPpap-max-authreqSet max number of transmissions for auth-reqsRS?: pap-timeoutSet time limit for peer PAP authentication>, name = Peer failed to respond to CHAP challengeNo CHAP secret found for authenticating us to %qWelcome to %s.I don't like you. Go 'way.No CHAP secret found for authenticating %qCHAP peer authentication failed for remote host %qCHAP peer authentication succeeded for %qCHAP authentication failedUnknown CHAP code (%d) received.ChallengeResponseSuccessFailurechap-restartSet timeout for CHAPchap-max-challengeSet max #xmits for challengechap-intervalSet interval for rechallengeX ` h p x   htinvalid parameter '%s' for deflate optiondeflate option values must be 0 or %d .. %ddeflate option value of %d changed to %d to avoid zlib bug%d,%dinvalid parameter '%s' for bsdcomp optionbsdcomp option values must be 0 or %d .. %d(none)Predictor 2Predictor 1(old#)Deflate%s (%d/%d)Deflate%s (%d)BSD-Compress (%d/%d)BSD-Compress (%d)Method %ddeflate%s %d method %d check %dbsd v%d %dpredictor 1predictor 2Lost compression sync: disabling compressionLost compression syncCompression disabled by peer.No compression negotiated%s compression enabled%s / %s compression enabled%s receive compression enabled%s transmit compression enabledCCPCompressedResetReqResetAcknoccpDisable CCP negotiation-ccpbsdcompRequest BSD-Compress packet compressionnobsdcompdon't allow BSD-Compress-bsdcompdeflaterequest Deflate compressionnodeflatedon't allow Deflate compression-deflatenodeflatedraftdon't use draft deflate #predictor1request Predictor-1nopredictor1don't allow Predictor-1-predictor1allow-ip argumentgroup %s is unknowncannot stat secret file %s: %mWarning - secret file %s has world and/or group access+ua file nameunable to open user login data file %sunable to read user login data file %suserpasswdcan't open indirect secret file %sno sRT%:ecret in indirect secret file %sauthorized addresses--/etc/ppp/pap-secrets/etc/ppp/chap-secrets-*invalid address length %v in auth. address listinvalid address length syntax: %vunknown host %s in auth. address listinterface unit %d too large for subnet %vCan't open chap secret file %s: %mSecret for %s on %s is too longNo network protocols runningFailed to authenticate ourselves to peerAuthentication failed%.*vCan't open PAP password file %s: %mno PAP secret found for %s@loginPassword for %s has expired/dev//var/log/lastloguser %s logged inPAP login failure for %sPAP authentication failure for %sLogin incorrect%d LOGIN FAILURES ON %s, %slogin failedLogin okConnect time expiredBy default the remote system is required to authenticate itself(because this system has a default route to the internet)The remote system (%s) is required to authenticate itselfThe remote system is required to authenticate itselfbut I couldn't find any suitable secret (password) for it to use to do so.(None of the available passwords would let it use an IP address.)Connection terminated.Terminating connection due to lack of activity.Link inactive/etc/ppp/auth-down/etc/ppp/auth-upauth_withpeer_success: unknown protocol %xauth_peer_success: unknown protocol %xPEERNAMEpeer refused to authenticate: terminating linkpeer refused to authenticateNo secret found for PAP loginLCP downauthRequire authentication from peernoauthDon't require peer to authenticaterequire-papRequire PAP authentication from peer+paprequire-chapRequire CHAP authentication from peer+chaprefuse-papDon't agree to auth to peer with PAP-papDon't allow PAP authentication with peerrefuse-chapDon't agree to auth to peer with CHAP-chapDon't allow CHAP authentication with peerSet local name for authentication+uaGet PAP user and password from fileSet name for auth with peerpasswordPasswordRU0: for authenticating us to the peerusehostnameMust use hostname for authenticationremotenameSet remote name for authenticationUse system password database for PAPpapcryptPAP passwords are encryptedprivgroupAllow group members to use privileged optionsallow-ipSet IP address(es) which can be used without authentication4 # oops: %d not %d %s %d %x??????%s %q # (from %s) %s xxx # [don't know how to print value]# %s value (type %d??) # (from %s) pppd options in effect: option list entrypppd version %s %s: %s plugin file path/usr/lib/pppd/2.4.1Couldn't load plugin %splugin_init%s has no initialization entry pointpppd_versionWarning: plugin %s has no version informationPlugin %s is for pppd version %s, this is %sPlugin %s loaded.Can't open log file %s: %minvalid numeric parameter '%s' for %s optionError reading %s: %mwarning: word in file %s too long (%.20s...)%s%s set in %s cannot be overridden %s%s from %s overrides command line%s%s cannot be changed after initializationusing the %s%s requires root privilege%s%s is disabledthe %s%s may not be changed in %s zero or%s value must be%s >= %d%s value must be%s <= %d%s value must be%s between %d and %d%s value cannot be increasedoption argumentsecrets fileIn secrets file: unrecognized option '%s'In secrets file: too few parameters for option '%s'command linetoo few parameters for option %sWarning: can't open options file %s: %mCan't open options file %s: %mIn file %s: unrecognized option '%s'In file %s: too few parameters for option '%s'call option value may not contain .. or start with /call file name%s%s/etc/ppp/peers/ttytty init file name/etc/ppp/options.%s/%s.ppprcdebugIncrease debugging level-dkdebugSet kernel driver debug levelnodetachDon't detach from controlling tty-detachupdetachDetach from controlling tty once link is upholdoffSet time in seconds befoRV3: re retrying connectionidleSet time in seconds before disconnecting idle linkmaxconnectSet connection time limitdomainAdd given domain name to hostnameTake options from a filecallTake options from a privileged filepersistKeep on reopening connection after closenopersistTurn off persist optionDial on demand--versionShow version number--helpShow brief listing of options-hlogfileAppend log messages to this filelogfdSend log messages to this file descriptornologDon't send log messages to any filenologfdDon't send log messages to any file descriptorlinknameSet logical name for linkmaxfailMaximum number of unsuccessful connection attempts to allowktuneAlter kernel settings as necessarynoktuneDon't alter kernel settingsconnect-delayMaximum time (in ms) to wait after connect script finishesunitPPP interface unit number to use if possibledumpPrint out option values after parsing all optionsdryrunStop after parsing, printing, and checking optionsEnable multilink operationnomultilinkDisable multilink operationnompbundleBundle name for multilinkpluginLoad a plug-in module into pppdpppd version %s Usage: %s [ options ], where options are: Communicate over the named device Set the baud rate to : Set the local and/or remote interface IP addresses. Either one may be omitted. asyncmap Set the desired async map to hex auth Require authentication from peer connect

Invoke shell command

to set up the serial line crtscts Use hardware RTS/CTS flow control defaultroute Add default route through interface file Take options from file modem Use modem control lines mru Set MRU value to for negotiation See pppd(8) for more options. #2$FW6etHZӾl~3"V,Gu>dɜ@ۿRdv!0&gv4DUJüXџn|ك1 w.fT@R+:dN_vm|$ÿ6H ;Z*^lO}~l .ǟ䩐 2ZLKy^hh ?z.ĕ*8FkzTHYb-b[$ZX\!PP,< t<<LdxĆ? ߅ ߅0?L߅0 ?\@h|@ @,l  l-F9#,mtprp|m (P8XPhR^): #@ ~|lyv4800@48h hX@,4X\,   -ЇćЇ0ć 0  -0ч<Ň\ч<0ŇhՇx@ɇ҇Ƈ҇Ƈ҇0Ƈ%-% &-&-8&фD&-l&фD&0-t&҄&-&҄&0-&-&&-& '-('P'-X' l2 '0'0' -' '' $(.0(X(d( -%-(( .((() ) /8>(/ D/8>(/ H/<>P/p/@>R_<: |//@>|/0/A>/@>/X/0P> 0T0D>`0@|00 080@00@0H>0$1H>01P1I>H1H>X1@d1x1111 1X1  8.1H1L2H 202H820h2t202\22233$3`43p3dx3@33334T> 4T> 40<4T>H4d4T>H40l4X>t444  2Kn,X  `  % KKvu\r|pohzydoMCould not determine local IPX node addressCan not determine network number+nxnPndnls9Y8Y8YbusyboxS?>himc9Y8Y8YbtoolsT%>cpio9Y8Y8YbusyboxU0>dmesg9Y8Y8YbusyboxV3>udevd9Y9Y9YW&ELF(4$4 (444ܼܼ  Qtd/lib/ld-uClibc.so.0alN;C2 \_d9TYhX1<Z8WSK"4U]&P:f'5Eb^!%RcIjiAa.geF LD=`kJOQ-[, $# (3)60GM7@>/VB* +H? `4_@LXdpq|đPБܑA $0<H>T:`YltxEA4p%̒ؒu!h ,8VDnPP g\hKt}T0 W):ȓ,ԓxIS*("4$@Ll }X dgp|Wa ĔДlܔ6: |$X0M<HT~`+l xmemcpymallocabortcallocreallocmemsetfreelibc.so.0strlenstrncasecmpclosedirsetsockoptstderrfprintffstat64forkstrlcpyreadlinklstat64writebind__errno_locationopendirmmap64getpwnampipe_exitgetenvreadstrerrorsetsidsigemptysetfnmatchrecvfopen64strsepsnprintfsymlinksigactionchmodselectfcntl64sscanfusleepsprintfwaitpidtimegetgrnamrenamestrchrdup2ioctlstrcasecmpstrlcat__uClibc_maincloselogsendtosetenvmknodfputsgetpidstrtoullstrncmpmunmapchdirunlinkstrcmp__ctype_balarmsyscallstrtoulstrtolreaddir64vsyslogsocketchownopenlogexecvputenvstrcpystrstrumaskclearenvfclosemkdirstrnlen__data_startrmdirstrrchrgetuidsetpriorityatoirecvmsg__environ_edata__bss_start__bss_start____bss_end____end___end  V     $(,048<@DHLPTX!\"`#d$h%l&p't(x)|*+,-/0124678:;<=>?@ABW*:CDEFGHIKLNOPQST UWX[\ ]$^(_,`0a4b8c<e@fDgHhLiPjTk -L-/ƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 09`GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/00//0 R\//\//R\/\0 S/P P P P 40 $0  00 `! p@-MM;pP @| `pV0\0P *H P:?P0@ЍW?: ڍp   p@-MM pP @d `AV0D0P )0 P9 Ѝٍp   p@-Mp@#  P`V@ t@PP \ PL0 0 0@(PPT@ٍp  @-MMLP,`g!,o!,k!,pf!@0 P # 0/R  @S:, I!x, Q!p, M!,p H!@0 P # 0/R  @S:V V= 9L i/cP/ڟ- * 0@P \P @0 T@P NP @`0TVL   P wЍۍ.  A`p@-@H00D00 0S 4!P [@P P@-!G-Mo P@1 29 B  B   x@`@@P@P`E A~p  /{>`P19S.00SW&'  P    , d  ,d0  0 S00002P`PUUߍ4 O-WM4`PP@E Z@0=!  3 B@ 0Gip% p # [V? PK) S?0U/R?0l >.P H1 SW1RS@TV0SoWߍ! !!-(0@-0P  K @ Ѝ/C-M@pP$ P.QW%:VT PPPMK ]# PU7xp 0ЍCЃp`0@4 P p`0c0PЍ`'!3! I!f!,1G- 0SPP1P1@p0`U 40PP0$0`Z X-P8Y P xP P`T0V@p@0T cP` hpO-M M`<P@3t$q zP  uP pP kPH> .0!@T`P >w]n PT4p> @P`i] tOpAj  .00 P 3\-0Q00pFp 04 4+X lThpp0bS=8 4- ,@#,0! 0p  zP0,000L< |@,@ mPU @P8@D,Y<,a$i/@P 9Y gp P @h+0H v@P T ~H*0- ( < Q@Pf*0 KPS|0  P+P@ih0  P 3\8W0: 0)@[+oP_ 983C2 3   O;P )? 3&Ph(X(0H *P  F9$9 PB! ,$ I|($0P  0P0ƒ100pI,(0y/8 ((%<9 Q   0R R 0 /0S(͍00 ͍͍ R  200@ 0@P tP d&0!w͍0"! 023 Io8P 8dm` |T0G> 0L40P4F>0T40 X4dP@Pf g0X4 ST4S  R dS0S TP&MD P4(&0X0F0CS9ꈬĬ<%0H00%0H0(\0%5\ |\\0l%\0$0\0pL%\00 X0%00D%5"! 023n  ,0P Pd $0q]40e[!0L`LP ep@PL   `(@, jppP( D@P 4BP ppQ  :P ppI  2PppA  *P p p9  "P D. Pp8p&  P! t P +,H P   P <P4(0`(XW3: Y00,0  0 Ơ" $ ", :#:  0`"! R0 8 VR\  `0! `0PQ0S 0SZ! PP PN h!1~m`# e<0Sf h'f="!!!!!!! !","C" `"t"""", #)#O#g###.#####$ܖ=A$$$$$$'%3%K%x%%H %% &6&d&&&2'\'}'X  ''''''''''' (h 8(P(((pT( | (h`/)R#AL80 L*@0"! 023 ,x@ P&=0"! 023 - _PP 0  PP! S0 01 $M(A0S 0 0 T1 R6   ,`P-ڄ4 <C4 0<<S „$041T@0SЃ` P0"0c0 P2 L*@42T@2L*R L*H0Sh20S! @t 2P2P2P2 P2PfЍۍ 8@' ,H,P@P8@P~8PT,1h,9ti/mPP /@-p``:V&Z#: $pF^`P@ 0@-@ 2P 0 0'P  Ѝ+l)@-@i{ @n@-@P .i>066{>077=077W&:00> 7jErAm+{>O-`4M@PU A^PP PIyW*TUR `P  P `0$ 0bPPV vi0┆ 0 P 040 40 X p WqpPAPPR9S t#cPIn`_P 0PP#`S[Uf pP P #0A d  #  PP= tP  p PP \H" 0   떯 jPP P m! 0|Z*\U[0x! / PJ PP,   D 85X( A P" P 9SpW `PUI,49S |P *9S 4 P4Ѝ r)))H) *y) *\)<*#*Y**P****59O-MT/@P`Py @(("2`s  d`  Pp150 51:!1`MYHXU 0Რ Y@ !>1H @000 0SH  =S00010@ ᳰ "Q5 wP0  P ,  P ,/@ @P @ !0pPU: ߍ#SW&:00@ 0`@+*7+h+r+}++@-1.+0 @ 00DP P=P h,\/8h2P 4,(/D(P0+++++++ / 6:0/0S/@-inGM`MPPM /F:00!104P){>  C΍LQP  0Q0 J;SD/P p,3\,/@T@ 0S , )tЍۍd,j,,,<,A-pGMOI^PH!H1P04P {>  C΍LQP  0@3o 03@P) yW0 pW`p p ?`M`02V/'P <Gލd,,, -'-/-V--O-`|M@PP PZ ZP 00%  # SR44!0 P !0 0`P p p /`P | 0P`WZ  P @ 0L`|Ѝ1-0,-- .*.G-MMcnI^`P<%<5@P0/38P j^`pP  480S upr^PM`P  480S <`{^Հ o pcHH$700 p`;S 7`W 3: +Pc 9SP  P %P@ 90c>0#;SP7 9Cc>p#0P3{>3  0  0 :#:,(؂p` Ă 06 *6$ 0"  0P9UiPC/4Vcn0`082,"038;S/P  `4b 0/P `0Q`` P /S,E`0SI cn,`8x\!0p8؛Y24 ,Pڃ@ bPp !0c~po 0`4P U~p 0Cn`c,,PUxCN@ X 8Ѝۍd,m+K.@,'-..-../*/P,c/<,0S/p@-`@P< 0 @R/  0S:p.p@-MM@*`*PP  0'/0* 0/ P 0S .S  ,0 @R/  0S: ?ߍڍp///O-MM@P*R*ZP "0C ^P 0S .S |p@P"0@0+R0SP 8*4: S$k!`% P<@TP _!0 T  5GSS-<8 `P2 Fo4!0* *40NSp SSW 0:  W1#J r< 04JP  p`*0x03V0#SXk @@ !TAߍۍ///d,00=0^0p@-,@``X,,P@0 P # 0/R  @S:p/;@-SM@jpP P  P 9S9SiIPK ((!0 `PP  0L2I. 'f !`V7#Ơ.ʌ 0.*0)R l )R Xg D`VGߍ0/00000000O-@QM M`,"^ SJ`P Bk4: S #B~ ~P Q`@I,!J8(#0,  `PiI /   50A0CPS񟗔l@@@@@@@@@@h8@@@, Pp1|#pG &p04u Pp1|#pG  Q. 0pQ.tC Q>%5Ơ p؁*0"*$ 0 { D P1#H pQ  $H 2 P1#H p Q΍04H " P1#H p Q04H|  P1#H p Q.  $H P`VZ: )4SGߍۍ00/=01l)@-M  Q @܍00/ 0 0000/ W %:A-NMMLPp,,`,,1PPU P`1Ue@PL /,|`P;4* R ,B> PP0N>0d@/ sP' _ R  R   pP[ xXX N>0`H oY `bЍۍ.A- `P@,pPU  JW  D/+P_ :0!R  0 R000 p  A!A-MMK,/ 3@ \P @3[TL,, (`P8: S5 , PPچ>0hh@ P`  @PP p[/P p0W0,,2@ P @2Tu@P x" 0 PZX `P _ /P` w Pm  PRl,,, ,-Pʀ,|,, ,P چ>0h@/ QP  a|,\,d,` , PP#چ>00h8@/ /P JP9P =Pp )A@hЍۍ.. 61>11F1P1U1`1h1n1x111E-PMUMpz ` P  P  PgK,/P] P[ 00|0PT h+P X P/W ?: 0P P  <L,,, ,f P+<@ 0 0P  ,`/P 0`0 VK\,,mPߍۍF161>11111..8@-PP eP@88@-`0@P@P80T@P}@P 0T8@-TP ,DJ</< ,,,B$0  0011 / 6:0/@-`0M0CS@0 >, p| PP00P0PS S UpߍO-mMP `@i   P Pp150 51:!1PTJZP 0Ჰ R !> J\CP$1 <000 0S1  =S000 0Ჰ "Q 'QPQ0 0Q    >  p@ 0T:ߍ#S7+1O-=CMP.M 0@p 0`p$S'0Sl $S ,g  c `N00| $P$@ Q6%S40SB %S , =  9`$004 0 0 B P($034 Q0$0 0 R`0S 0{S}xP  $ 00, $ 0B S<\  QW *:{>{>( D9S Z) B  uP"2 0 R   X( , ,40+SH  PB Z\\"P 0P P P (,w  ePf( ,l 1! P01jS Z0C (, 0Pt!e(p?PA bP> MPI L G2̇X{  0 0 0=0ˉ v:7Z P0lT $0y0 0  4Ѝۍ132:32e+_32333O-PMA>M  0@Pg0  ?P_0  ?PW0p  0PO0T  ?PGI>8 O/0P`p <00CSJ B"8 P0|P) p0X$1SG A,( p , , d,  , pa Ppg  (0pA P 00'0upW0'k$1Sp9,00CS34 0sP a ? P D7 0Y00   00jP 0Z@00  B"a>, 0P p(0X04p00hx004 ?PX4| ?PP4` ?PpC F00CS<  ∐P  P2 a FP 5 W): Y0  09 0  jP  Z@  B"a>X 0P p0XP+1S6 a,  ,40A~S00p0  0B/0<P1S{ A,[ ,1S>0030pS000 ;# P_(;pRS.  aP <<#0;E(!M8S; pP7 00P03 Pp%wa   =sP A7 P  0 p WpWp 1Sb0S̰a    I  qPpB p0Y,0S6A,40 ,  , , )P . P 0  0p `(0W$Ѝۍ333*3*-!3.32"4P4 Nr444444324420044@-@p}{n`|PPC <1SD1S`1SL1ST1SKPh1 0? C09#7S1S 0CSph 3  1S h141S 8452?5O-@Mr(ij>I{00 0PP 0S <10CSPh1 0?#0909daW<: V pP 3Si7S\1S `1S07\17 7SL1S S0 7P   '7ST1S S07X    6SWD1ST S06D10CS" H`,} ,J0P XH"P2`0`  0 !m  -10  `Pp0S !0R  <10CS@,2 ,0P ,!80? !10 07S1S S0710CS     h141S 8" 0S ,X4 07S  :07ߍ531R53i5~5?5500/0P R* l . //@-@PB008@-{'PP P}!@P00 P8:36A-@Ppl10p`l l10`laE-@P`gQtt pA! 00 G'l1 0lhl10l000l6,6O-NMMM.M  P  +0X [;$ 0 0CS   S31%#4%(+%*\^ @ T N^@xDP:N.pxrA7@P* 0P $0(Px0(P, 0 <0PB_@ D0.G?HPI_L P0K/M?TPO_X \0Q/S?`PU_d 0 P hPp04P< 80_   *rpP0Sh 9P0 W: ,S SZ 0SW =S +S !S :SP0 S@ =S0=SP`!S0=S3P`+S0=S+P` =SP`:S!0=SP`008 P00 0Q "Q P00P 0 pP W 0FS @  ,xP 0FS 'i$ gP 0FS ( 0a VP0FS , HP 0FS h`0'05A H P `0P $ P0Z %P  P0FS 4 P  P0FS 8 P0FS p \ P H P 0P $p P<  P0P _ @P (P : PDb P0FS DHT t fP@pP TP1DP.4P0)hp,} hp/P00P ,m,u PFhPx4@ 001L p hPP X aPT @ ZPX ( SP\  PvP .P0d1 (Ph10h1` 0y< 0Pd )P  0S ${P%vPM 40S gF^P E P  0S $UP%PPM 40S W : F^P   lP `a\ @P4,Ph10h1Ph10h1Ph10h1P0d1  0l1^ e 0l1PPp 0 #0PP0\ 0P0Y":Ѝۍ#P/6@666L637*#73A73^73~77774 884.8284S8q8x8888848888068+999*-9.9<9D9 J9P9U9]9g9u999A- xMp@X @PP60: S P-p pt p@`P P# Qz\\ 0 0@00<00j@`p0TxЍ99\6 @-PpHV*@@0@0@P l1`n`@00/7@-P00@PPP@@ P44 0"  0>:95:7@-P00@PPP@@ P44 0  0>X:9x:8@-P@ 0 0000@P8 E-pP@ W`Ph 0bP U`P@ @0 02n:E-`p@PjP @TZ_PX@`PP P,BG-M@@PP Ox 0#P 0S .S#S  .P $pP`W: < 0[ r@ߍ::d,@- @00S T P @P ,P P : : 0R/ R/ R/ R/ R/0S/@-@PM P0 RF0S0@S?0000000 0000\#?3 RS S S S s  RS . 6 R ,C BR8 #8S@-P`@A A00A SRa0ASHP @P_0@@P0pQ:8@-@Pt@0@0dP80TS 8@-@@P , P p3::(0 \ \ 0\\S:b/e@-`|MP@PPG 0  @0@pp6@000|Ѝ7@- @qP ' 0lP d\ 0PPP U $ 0>::;-p@-M@/VP0@0/OPPP `P V 'P  0aߍp:;:@-M /, @PP0  s/Q 00 P2: S @P ߍO-MM 06@0.^.P ,  yP\P` 'Rp0\"! 0R3C A "Pʠ `Ylq c@"0g 0XhC` `V*  X," 0`@A>0< <S0S !0-P` P5>"! 0R3- A^P!Pʘ ?0Y< <H!0 08I\ <S0S 8 0PP<SCʘ,R@ʠ P P X ,0R0P  < <C400D <S@l( 0z@ЍۍT;.<d;;;8#;;;;</<!F<a<x<<A-MMpP k`n @y` ; 0 `p.g &p00 R W0#03:+ ` `,<< P0P``xЍۍ<<p;00S4\R/@-0@@T*PTQP040d0S0 -LW: udev_event_runmaininit_udevd_socketinit_uevent_netlink_sockget_ctrl_msgget_netlink_msgget_msg_from_envbufudev_done/proc/meminfoMemTotal: MemTotal: %ld kB/proc/statprocs_running procs_running %ucpu.udev/queue.udev/failedaddsocket:/proc/proc/%s/stat%c %d %d %d udevd-event%s: seq %llu finished%s: fork of child failed: %s%s: seq %llu forked, pid [%d], '%s' '%s', %ld seconds old--daemon-d--help-hUsage: udevd [--help] [--daemon]%s: unrecognized option '%s' root privileges required %s: root privileges required/org/kernel/udev/udevd%s: error getting socket: %s%s: bind failed: %sanother udev daemon already running %s: another udev daemon already runningerror initializing udevd socket %s: error initializing udevd socketerror initializing netlink socket %s: error initializing netlink socket0 /.udev/uevent_seqnum%s: fork of daemon failed: %s/dev/null%s: error opening /dev/null: %s/proc/self/oom_adj%s: error disabling OOM: %s-17%s: error getting pipes: %s%s: error fcntl on read pipe: %s%s: error fcntl on write pipe: %s%s: the kernel does not support inotify, udevd can't monitor configuration file changes%s: inotify_init failed: %sUDEVD_MAX_CHILDS%s: initialize max_childs to %uUDEVD_MAX_CHILDS_RUNNING%s: initialize max_childs_running to %uUDEV_LOG=%i%s: error in select: %s%s: unable to receive user udevd message: %s%s: no sender credentials received, message ignored%s: sender uid=%i, message ignoredudevd_100%s: message magic '%s' doesn't match, ignore it%s: udevd message (STOP_EXEC_QUEUE) received%s: udevd message (START_EXEC_QUEUE) received%s: udevd message (SET_LOG_PRIORITY) received, udev_log_priority=%i%s: udevd message (UDEVD_SET_MAX_CHILDS) received, max_childs=%i%s: udevd message (UDEVD_SET_MAX_CHILDS_RUNNING) received, max_childs=%i%s: udevd message (RELOAD_RULES) received%s: unknown control message type%s: unable to receive kernel netlink message: %sACTION=SUBSYSTEM=SEQNUM=PHYSDEVPATH=PHYSDEVDRIVER=MAJOR=MINOR=TIMEOUT=UDEVW:D_EVENT=1%s: DEVPATH or ACTION missing, ignore message%s: invalid uevent '%s'%s: no ACTION in payload found, skip event '%s'%s: ACTION in payload does not match uevent, skip event '%s'%llu %s: error getting buffer for inotify, disable watching%s: seq %llu, pid [%d] exit with %i, %ld seconds old/kernel/uevent_seqnumudev_device_eventrename_netif%u:%uchange%s: device event will be ignored%s: device node creation supressed%s: device '%s' already in database, validate currently present symlinksnet%s: changing net interface name from '%s' to '%s'%s: error opening socket: %s%s: error changing netif name %s to %s: %s_rename%s: error changing net interface name %s to %s: %s%s: renamed netif to '%s'INTERFACE_OLDDEVPATHINTERFACEparse_config_file%s: can't open '%s' as config file: %s%s: line too long, conf line skipped %s, line %dudev_rootudev_rulesudev_log%s: error parsing %s, line %d:%d/dev/etc/udev/udev.conf/etc/udev/rules.dUDEV_RUNUDEV_CONFIG_FILEUDEV_ROOTUDEV_LOGudev_node_remove_symlinksudev_node_removeudev_node_mknodudev_node_addudev_node_symlink%s/%s%s: symlink '%s' points to a different device, skip removal%s: removing symlink '%s'DEVLINKS%s: device node '%s' points to a different device, skip removal%s: removing device node '%s'DEVNAME%s: removing all_partitions '%s[1-%i]'%s: garbage from udev database, skip all_partitions removal%s%d%s: preserve file '%s', because it has correct dev_t%s: unlink(%s) failed: %s%s: mknod(%s, %#o, %u, %u) failed: %s%s: chmod(%s, %#o) failed: %s%s: chown(%s, %u, %u) failed: %s%s: creating device node '%s', major = '%d', minor = '%d', mode = '%#o', uid = '%d', gid = '%d'range%s: creating device partition nodes '%s[1-%i]'../%s: creating symlink '%s' to '%s'%s: preserving symlink '%s' to '%s'%s: link '%s' points to different target '%s', delete it%s: symlink(%s, %s) failed: %sudev_db_get_all_entriesudev_db_lookup_nameudev_db_add_deviceudev_db_get_device/.udev/db%s: no udev_db available '%s':W: %s%s: unable to read %s: %s%s: found a symlink as db file%s: error reading db link %s: %s%s: unable to read db file '%s': %s%s: unable to create db link '%s': %sw%s: unable to create db file '%s': %sN:%s S:%s M:%u:%u A:%u R:%u E:%s %s: no db file to read %s: %s%s: error reading db file %s: %s/class//block//devices//bus/subsystem/driver/bus//drivers/drivers/module/module/devices/block/class/deviceSYSFS_PATH/sysimport_keys_into_env5p5n5k5b5M5m5c~3s5s6P 6N m+r 6E get_format_lenget_format_attributeudev_rules_apply_formatwait_for_sysfsmatch_ruleimport_file_into_envudev_rules_get_runudev_rules_get_name%s: format parsing error '%s'%s: missing closing brace for format%s: missing file parameter for attr%s: %i untrusted character(s) replaced%s/.tmp-%u-%u%s: unknown substitution type=%iACTIONKERNELSUBSYSTEMDRIVERENV%s: file '%s' appeared after %i loops%s: device disappeared while waiting for '%s'%s: wait for '%s' for %i mseconds%s: waiting for '%s' failedATTRKERNELSSUBSYSTEMSDRIVERSATTRSRESULT%s: can't open '%s': %s%s: error writing ATTR{%s}: %s%s: error opening ATTR{%s} for writing: %s%s: rule applied, '%s' is ignored%s: reset run list%s: reset symlink list%s: add symlink '%s'%s: rule applied, '%s' becomes '%s'%s: no node name set, will use kernel name '%s'devpathnumberkernelidmajorminorresultsysfsparenttempnodeenvget_key_attributeadd_rule_key_pairparse_fileadd_to_rulesudev_rules_init%s: skip, too many keys of the same type in a single rule%s: can't open '%s' as rules file: %s%s: line too long, rule skipped '%s:%u'%s: malloc failed%s: invalid ACTION operation%s: invalid DEVPATH operation%s: invalid KERNEL operation%s: invalid SUBSYSTEM operation%s: invalid DRIVER operation%s: DRIVER== will change in a future relase, please use DRIVERS== in %s:%uATTR{%s: error parsing ATW: TR attributeID%s: invalid KERNELS operationBUS%s: invalid SUBSYSTEMS operation%s: invalid DRIVERS operationATTRS{SYSFS{%s: error parsing ATTRS attributeENV{%s: error parsing ENV attributePROGRAM%s: invalid RESULT operationIMPORTprogram/lib/udev/WAIT_FOR_SYSFSLABELGOTOall_partitionsignore_removeSYMLINKOWNERGROUPMODEOPTIONSlast_ruleignore_device%s: unknown key '%s' in %s:%u%s: realloc failed%s: invalid rule '%s:%u'.rules%s: could not read '%s': %slookup_grouplookup_useradd_matching_files%s: specified group unknown '%s'%s: error resolving group '%s': %s%s: specified user unknown '%s'%s: error resolving user '%s': %s%s=%s%s: unable to open '%s': %serrdebug #$%+-./:=?@_,trueyesunlink_securedelete_path%s: chown(%s, 0, 0) failed: %s%s: chmod(%s, 0000) failed: %s%s: rmdir(%s) failed: %srun_programpass_env_to_socket%s: '%s'%s: pipe failed: %s%s: open /dev/null failed: %s%s: exec of program '%s' failed%s: fork of '%s' failed: %s%s: stdin read failed: %s%s: ressize %ld too short%s: '%s' (stdout) '%s'%s: stderr read failed: %s%s: '%s' (stderr) '%s'%s: '%s' returned with status %i%s: '%s' abnormal exit%s@%s%s: passed %zi bytes to socket '%s', W: 0  D  0  hhppA(aeabi5TE ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.init_array.fini_array.jcr.dynamic.gotW:.data.bss.ARM.attributes.comment < DD! ) 2 00;6 dAlGM Uamr  {|XX<pp)W:>dnsdomainname9Y8Y8YbusyboxX&>LinkLocalIP9Y9Y9Y|Y3ELF(4 4 (444tQtd/lib/ld-uClibc.so.0%,+"$ & '#)(*%   !O/ a" ̇؇6. @,! P 8DPp\;htEWk- ȈwԈ'5 fmemcpyabortmemsetlibc.so.0srandomstderrfprintfputsforkbindinet_atonputcharinet_ntoarecvexitpollmemcmpsprintfwaitpidtimeioctl__uClibc_mainsystemsendtosetenvperrorstrcmpsocketstrncpydaemonexeclgettimeofday__data_startfwrite_edata__bss_start__bss_start____bss_end____end___end$lptx|     "#%&)* -L-Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏY<: ʌƏ ʌƏ ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌXƏ ʌPƏ ʌHƏ ʌ@Ə ʌ8Ə ʌ0Ə ʌ(Ə ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0x,`GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/8@-*I @@@ 0 @ @U  0 0@P@ ( 0@ 0C @X % @ @i 0+ @  @^  @ Y@-@9 -!HA 7a,á$8# ,̀!40@-@PMPp` HP  P \Ѝ8 @Z): @0@t @ 0Md @HD @ V *P @  0T @0E-TMP@`p<  0 6 2 @0̠ *2&@' 0 p400 t&< 0PTЍ @O-`MME,a0z[p@0} U )JP@ `@``@[ @ P  @P[A  &xP |P䐍  䠍蠍o ' DP IJ 0@ '&)!( < ,P ,4 㰒 0@  0 $ 0@ (D( (T0S  Y?: @,P^  @&P#  @ P  @P2\G @SCQU? @K;\ x @ 02e iL `@0@ PX @ @P.  @PZ KP ,,.<!Ċ  8 ^ , @p @,I/  0ȐFaV @d @lK( R>I @@@0 j < 0JPd4.p R $ Ă|Q,1^ I$ XP K RL HI/ ,0 Ȑ5U `P@``@H @ZP< @ P @o @(  @(;(,+ 0@( 1( @kQ1` @p+l @ 0   -L%s: %s Usage: %s [OPTIONS -q quit after obtaining address -f do not fork a daemon -n exit with failure if no address can be obtained -i network interface (default %s) eth0 -I network interface alias -s