15Q(xO@( %p5NR2090_A맿D짿YFSS!V10#fmkyaffs2image Version: Linux-2.6.35-Google Nand Controller V301, make time: Thu Dec 26 10:43:39 2013 .3.flash%AڗRҗRҗR0mntAڗR˺R˺R&nfsAڗR˺R˺R3partRecAڗR˺R˺R)mtdAڗR˺R˺R<partStorageAڗR˺R˺R?languageAڗRڗRڗR*lang_german.xmlėRR̗RB*<root> <Font Name="DejaVu Sans" /> <LanguageName str="Deutsch" /> <LanguageNameEng str="German" /> <Sch_Monitor str="berwachung Zeitplan" /> <Alarm_Monitor str="berwachung Alarme" /> <Week0 str="Sonntag" /> <Week1 str="Montag" /> <Week2 str="Dienstag" /> <Week3 str="Mittwoch" /> <Week4 str="Donnerstag" /> <Week5 str="Freitag" /> <Week6 str="Samstag" /> <WeekS0 str="So" /> <WeekS1 str="Mo" /> <WeekS2 str="Di" /> <WeekS3 str="Mi" /> <WeekS4 str="Do" /> <WeekS5 str="Fr" /> <WeekS6 str="Sa" /> <Disk_Free str="frei" /> <Error str="Fehler" /> <LoginError str="&amp;quot;Fehler bei der Anmeldung, Benutzer oder Kennwort falsch&amp;quot;" /> <DeviceInfo str="Gerteinformation" /> <DeviceTitle str="Gertename" /> <SoftwareVersion str="Softwareversion" /> <Characters str="Zeichen" /> <DateTimeInfo str="Datum/Zeit Info" /> <CurrentDate str="akt. Datum" /> <CurrentTime str="akt. Zeit" /> <Adjust str="einstellen" /> <Manual str="manuell" /> <SyncNTP str="Syn%chronisation mit NTP" /> <Setting str="Einstellung" /> <NTPServer str="NTP Server" /> <Test str="Test" /> <NTPSyncInterval str="Synchronisationsintervall" /> <Hour str="Stunde" /> <Timezone str="Zeitzone" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="&amp;quot;GMT-12 (Eniwetok, Kwajalein)&amp;quot;" /> <Timezone3 str="&amp;quot;GMT-11 (Midway Isl., Samoa)&amp;quot;" /> <Timezone4 str="&amp;quot;GMT-10 (Hawaii, Aleutian Isl.)&amp;quot;" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="&amp;quot;GMT-08 (Las Vegas, San Francisco, Vancouver)&amp;quot;" /> <Timezone7 str="&amp;quot;GMT-07 (Calgary, Denver, Salt Lake City)&amp;quot;" /> <Timezone8 str="&amp;quot;GMT-06 (Chicago, Dallas, Mexico City, New Orleans)&amp;quot;" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="&amp;quot;GMT-05 (New York, Toronto, Washington DC)&amp;quot;" /> <Timezone11 str="GMT-03 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="&amp;quot;GM&T-04 (Charlottetown, Manaus)&amp;quot;" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="&amp;quot;GMT-03 (Brazilia, Sao Paulo)&amp;quot;" /> <Timezone16 str="&amp;quot;GMT-02 (Noronha, Mid-Atlantic)&amp;quot;" /> <Timezone17 str="&amp;quot;GMT-01 (Azores, Cap Verde Isl.)&amp;quot;" /> <Timezone18 str="&amp;quot;GMT (Dublin, Lisbon, London, Reykjavik)&amp;quot;" /> <Timezone19 str="&amp;quot;GMT+01 (Amsterdam, Berlin, Rome, Stockholm, Warsaw)&amp;quot;" /> <Timezone20 str="&amp;quot;GMT+02 (Athens, Helsinki, Istanbul, Riga)&amp;quot;" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="&amp;quot;GMT+03 (Moscow, Riyadh)&amp;quot;" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="&amp;quot;GMT+04 (Abu Dubai, Baku)&amp;quot;" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="&amp;quot;GMT+05 (Isla3 mabad, Karachi, Tashkent)&amp;quot;" /> <Timezone31 str="&amp;quot;GMT+05:30 (Bombay, Calcutta, New Delhi)&amp;quot;" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="&amp;quot;GMT+06 (Novosibirsk, Omsk)&amp;quot;" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="&amp;quot;GMT+07 (Bangkok, Hanoi, Jakarta)&amp;quot;" /> <Timezone36 str="&amp;quot;GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)&amp;quot;" /> <Timezone37 str="&amp;quot;GMT+09 (Seoul, Osaka, Sapporo, Tokyo)&amp;quot;" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="&amp;quot;GMT+10 (Canberra, Melbourne, Sydney)&amp;quot;" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="&amp;quot;GMT+12 (Auckland, Wellington)&amp;quot;" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.))" /> <Timezone48 str="&amp;quot;GMT+13 (Tongatapu, Nuku'alofa)&amp;quot;" /> <Timezone49 str="GMT+12:45 (Chatham Island)" /> <DST str="Sommerzeit" /> <Disable str="deaktivieren" /> <Enable str="aktivieren" /> <DSTStart str="Sommerzeit Anfang" /> <DSTEnd str="Sommerzeit Ende" /> <DSTOffset str="Sommerzeit Differenz" /> <AutoLogin str="autom. Anmeldung" /> <UID str="Benutzername" /> <PWD str="Passwort" /> <System str="System" /> <AutoFullScreen str="autom. Vollbild" /> <Language str="Sprache" /> <Audio str="Ton" /> <InputGain str="Eingangsverstrkung" /> <OutputGain str="Ausgangsverstrkung" /> <KeyinNTPAddr str="Bitte geben Sie einen NTP Server an" /> <Success str="erfolgreich" /> <Fault str="fehlgeschlagen" /> <OK str="OK" /> <Cancel str="Abbrechen" /> <SetDateTime str="Datum &amp; Uhrzeit setzen" /> <Date str="Datum" /> <Time str="Zeit" /> <AutoSetting str="autom. Einstellung" /> <CameraName str="Kameraname" /> <ModelName str="Modellname" /> <IPAddres< s str="IP Adresse" /> <HTTPPort str="HTTP Port" /> <RTSPPort str="RTSP Port" /> <Camera str="Kamera" /> <Schedule str="Zeitplan" /> <Network str="Netzwerk" /> <User str="Benutzer" /> <MotionDetection str="Bewegungserkennung" /> <Snapshot str="Schnappschuss" /> <Maintenance str="Wartung" /> <Add str="hinzufgen" /> <Delete str="lschen" /> <Update str="aktualisieren" /> <Clear str="leeren" /> <Search str="suchen" /> <AutoDetect str="autom. erkennen" /> <Detect str="erkennen" /> <MACAddress str="MAC Adresse" /> <Configuration str="Konfiguration" /> <Copy str="kopieren" /> <StartTime str="Startzeit" /> <EndTime str="Endzeit" /> <RecordType str="Aufnahmetyp" /> <PreAlarm str="vor Alarm" /> <PostAlarm str="nach Alarm" /> <RTC str="rund um die Uhr" /> <DIDetect str="DI Erkennung" /> <TimeSelErr str="Zeitraum ist nicht korrekt!" /> <NoSelSch str="Bitte whlen Sie einen Zeitplan!" /> <Warning str="Warnung" /> <WeekCopyToAll str="Alle Wochenzeitplne werden g? leich gesetzt" /> <DHCP str="IP Adresse automatisch beziehen (DHCP)" /> <SubnetMask str="Subnetzmaske" /> <Gateway str="Gateway" /> <DNS_DHCP str="DNS ber DHCP beziehen" /> <PrimaryDNS str="prim. DNS" /> <SecondaryDNS str="sek. DNS" /> <PPPoE str="PPPoE" /> <Status str="Status" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Server" /> <IPUsed str="Diese Adresse wird bereits verwendet!" /> <IPNoUsed str="Diese Adresse kann genutzt werden" /> <Group str="Gruppe" /> <Description str="Beschreibung" /> <ConfirmPWD str="Passwort besttigen" /> <LiveView str="Live Ansicht" /> <Playback str="Wiedergabe" /> <Record str="Aufnahme" /> <PTZ str="PTZ" /> <TwoWayAudio str="Zwei-Wege-Audio" /> <CheckConfirmPWD str="Bitte prfen Sie die Wiederholung des Passwortes" /> <UIDEmpty str="Bitte ndern Sie den Benutzernamen" /> <UIDRepeat str="Sie haben den gleichen Benutzernamen angegeben. Bitte korrigieren Sie das." /> <NoSelUID str="Bitte whlen Sie ein Konto" /> <M*otionID str="Motion ID" /> <Name str="Name" /> <Included str="eingeschlossen" /> <Excluded str="ausgeschlossen" /> <ObjectSize str="Objektgre" /> <Sensitivity str="Empfindlichkeit" /> <NoSelCamera str="Bitte whlen Sie eine Kamera" /> <OverMaxMotion10 str="Das Maximum ist 10" /> <NoSelMotion str="Bitte whlen Sie eine Bewegung" /> <MotionSettingEnpty str="Bitte definieren Sie erst eine Bewegung" /> <SourceSnapshotList str="Liste Schnappschuss Quellen" /> <SourceSnapshotPreview str="Voransicht Schnappschuss Quellen" /> <DestinationSnapshotList str="Liste Schnappschuss Ziele" /> <DestinationSnapshotPreview str="Voransicht Schnappschuss Ziele" /> <NoFindSD str="Bitte legen Sie eine SD Karte ein!" /> <NoSelImg str="Bitte whlen Sie ein Bild!" /> <SameSnapshotImgName str="Auf der SD-Karte gibt es schon gleichnamige Dateien. Diese werden berschrieben!" /> <IsAutoSetting str="Wollen Sie die Kamera nun autom. einstellen?" /> <GetParamError str="Fehler beim Abrufen der Parameter!*" /> <CameraNameEmpty str="Bitte Kamera Namen eingeben!" /> <IPAddressEmpty str="Bitte IP Adresse eingeben!" /> <UIDEmpty str="Bitte Benutzername angeben!" /> <HttpPortEmpty str="Bitte den HTTP Port angeben!" /> <CameraNameTheSame str="Name der Kamera existiert schon!" /> <CamParam str="Kamera Parameter" /> <Profile str="Profil" /> <FPS str="FPS" /> <Protocol str="Protokoll" /> <EnableAudio str="Ton aktivieren" /> <AudioRecord str="Audio-Aufnahme" /> <InputError str="Fehler (Input)" /> <DefaultSetting str="Voreinstellung" /> <FactoryDefaultSetting str="Werkseinstellung" /> <Default str="Vorgabe" /> <BackupSetting str="Einstellungen Sichern" /> <Backup str="Sicherung" /> <RestoreSetting str="Einstellungen wiederherstellen" /> <Restore str="Wiederherstellung" /> <FirmwareUpgrade str="Firmware Aktualisierung" /> <Upgrade str="Aktualisierung" /> <Browse str="whlen" /> <SystemRestart str="System Neustart" /> <Restart str="Neustart" /> <HDInformation str="Festplatt ? eninformation" /> <SDInformation str="SD Karten Information" /> <TotalCapacity str="Gesamtkapazitt" /> <FreeCapacity str="Freie Kapazitt" /> <UsedCapacity str="Benutze Kapazitt" /> <UsedPercent str="benutzt (%)" /> <Format str="Format" /> <NoFind str="nicht gefunden" /> <NoMount str="nicht gemountet" /> <IsDefaultSetting str="&amp;quot;Das System wird vollstndig zurckgesetzt, inkl. der Netzwerkeinstellung. Bitte besttige Sie dies.&amp;quot;" /> <NoBackupDevice str="Bitte geben Sie ein externes Sicherungsmedium an" /> <NoFindConfigFile str="Kann die Konfiguration nicht finden." /> <ConfigFile str="Konfigurationsdatei" /> <ConfigFileVerErr str="Fehlerhafte Version der Konfigurationsdatei" /> <IsRestart str="System wird neu gestartet. Bitte besttigen" /> <NoFindFirmware str="Kann die Firmware nicht finden." /> <FirmwareFile str="Firmware Datei" /> <IsFormatHD str="Alle Daten werden gelscht. Sicher?" /> <OpenFirmwareUpgradeLogErr str="Kann firmware_upgrade.log nicht ff < nen" /> <Playback str="Wiedergabe" /> <PlaybackTime str="Wiedergabe Zeit" /> <Play str="Abspielen" /> <Reverse str="Rckwrts" /> <Pause str="Pause" /> <Wait str="Bitte warten!" /> <Mute str="Stumm" /> <LiveAudio str="Live Ton" /> <PlaybackAudio str="Ton Wiedergeben" /> <ConvertToAvi str="zu AVI konvertieren" /> <NoFindRecord str="Aufnahme nicht gefunden" /> <TimePeriod str="Zeitabschnitt" /> <SaveTo str="Sichern nach" /> <BackupDeviceFull str="Sicherungsmedium evtl. voll. Bitte prfen." /> <SavePath str="Sicherungspfad" /> <Login str="Anmeldung" /> <Logout str="Abmeldung" /> <PictureSet str="Bild setzen" /> <Rotation str="Rotation" /> <Normal str="normal" /> <Mirror str="gespiegelt" /> <VerticaFlip str="vertikal gespiegelt" /> <ColorLevel str="Farblevel" /> <Brightness str="Helligkeit" /> <Contrast str="Kontrast" /> <Sharpness str="Schrfe" /> <RateControl str="Rate Control" /> <Quality str="Qualitt" /> <Bitrate str="Bitrate" /> <VideoOffset str="V )ideo Offset" /> <De-Noise str="entrauschen" /> <None str="nichts" /> <Method str="Methode" /> <AutoMode str="Autom. Modus" /> <DayMode str="Tagmodus" /> <NightMode str="Nachtmodus" /> <Base str="Basis" /> <Picture str="Bild" /> <OutOfRange str="Auerhalb des Bereiches" /> <SystemClose str="System wird Heruntergefahren" /> <On str="An" /> <Off str="Aus" /> <Vendor str="Hersteller" /> <ModelName str="Modellname" /> <FriendlyName str="Anzeigename" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Portbereich" /> <ExternalIPAddress str="externe IP Adresse" /> <Information str="Information" /> <SelOverPlayerMaxCam str="ber %d der Kamera ausgewhlt" /> <Event str="Ereignis" /> <Event_List str="Ereignisliste" /> <Motion str="Bewegung" /> <DI str="digitaler Eingang" /> <DO str="digitaler Ausgang" /> <Event_Schedule_List str="Ereignisplaner Liste" /> <Action_List str="Aktionsliste" /> <Alarm_Trigger_Type str="Alarm Typ" /> <Alarm_Seconds str="Alarm Sek 3 unden" /> <Buzzer str="Buzzer" /> <UnKnow str="unbekannt" /> <Display_On_CH str="Anzeige auf Kanal" /> <Action_Type str="Aktionstyp" /> <ERR_MSG_NO_CAM str="Bitte erst Kamera oder lokal whlen!" /> <ERR_MSG_NO_EVENT str="Bitte erst ein Ereignis whlen!" /> <ERR_MSG_NO_EVENT_SCH str="Bitte erst ein Ereignisplpan whlen!" /> <ERR_MSG_NO_ACTION str="Bitte erst eine Aktion whlen!" /> <ERR_MSG_TIME_PERIOD str="&amp;quot;Fehler beim Zeitabschnitt, bitte prfen!&amp;quot;" /> <ERR_MSG_TIME_CONFILT str="&amp;quot;Konflikt beim Zeitabschnitt, bitte prfen!&amp;quot;" /> <WeekDays str="Wochentag" /> <AlarmSetting str="Alarm Einstellung" /> <AlarmCondition str="Alarm Zustand" /> <Alarm_True str="Alarm aktiv" /> <Alarm_False str="Alarm inaktiv" /> <Alarm_Seconds str="Alarm Sekunden" /> <Alarm_Manual_Stop str="man. Stop" /> <Local str="lokal" /> <DI_Setting str="DI Einstellung" /> <System_Setting str="Systemeinstellung" /> <Log_Viewer str="Ereignisanzeige" /> <Event_Log str="E &reignisprotokoll" /> <Device str="Gert" /> <Log_Type str="Protokolltyp" /> <Motion_Alarm str="Bewegungsalarm" /> <DI_Alarm str="DI Alarm" /> <Input str="Eingang" /> <Limit_Record str="Beschrnkung Aufnahme" /> <Remark str="Hinweis" /> <Total str="Total" /> <HDD_Err_Alarm str="HDD Fehler Alarm" /> <Disconnect_Alarm str="Verbindung unterbrochen Alarm" /> <Schedule_Trigger str="Zeitplan Trigger" /> <Block_Alarm str="Block Alarm" /> <Blur_Alarm str="Blur Alarm" /> <Camera_Move_Alarm str="Kamera Bewegung Alarm" /> <Address_Book str="Adressbuch" /> <Phone str="Telefon" /> <E_MAIL str="eMail" /> <Notification str="Benachrichtigung" /> <SMTP_Config str="SMTP Einstellung" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="Von" /> <SendMailWithoutPicture str="Mail ohne Bild senden" /> <ServerRequireAuthentication str="Server erfordert Anmeldung" /> <SSL str="Server erfordert sichere Verbindung (SSL)" /> <Send_Test str="Test Senden" /> <FTP_Config s%tr="FTP Einstellung" /> <FTP_Server str="Server" /> <FTP_Port str="Port" /> <Retry str="Wiederholung" /> <RecycleDays str="Tage wiederverwenden" /> <RecycleSize str="Gre wiederverwenden" /> <Path str="Pfad" /> <AllowCreateFolder str="Ordner erstellen zulassen" /> <HTTP_Config str="HTTP Einstellung" /> <HTTP_IP str="IP" /> <HTTP_UID str="Konto" /> <HTTP_PWD str="Passwort" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Adresse" /> <Proxy_UID str="Proxy Konto" /> <Proxy_PWD str="Proxy Passwort" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="TCP Einstellung" /> <TCP_Server str="Server" /> <TCP_Port str="Port" /> <Alarm_Config str="Alarm Einstellung" /> <frame str="Bild" /> <SnapshotInterval str="Intervall Schnappschuss" /> <SendInterval str="Sendeintervall" /> <SnapshotTempFolder str="temporrer Ordner" /> <Mail str="Mail" /> <Subject str="Betreff" /> <body str="Body" /> <MS str="MS" /> <second str="Sekunde" /> <EventDetect str="Ereignis Erke0 nnung" /> <EventForceRecord str="Ereignis Aufnahme erzwungen" /> <EventSetting str="Ereignis Einstellung" /> <MergeSeconds str="Sekunden zusammenlegen" /> <Display str="Anzeige" /> <Division str="Aufspalten" /> <FullScreen str="Vollbild" /> <ResetDIVDefault str="Aufspalten zurcksetzen" /> <CancelFullScreen str="Vollbild beenden" /> <Function str="Funktion" /> <SystemManagement str="Systemmanagement" /> <PTZControl str="PTZ Kontrolle" /> <Volume str="Lautstrke" /> <Monitor str="Monitor" /> <CancelMute str="stumm rckgngig" /> <TwoWayAudioON str="Zwei-Wege-Audio starten" /> <TwoWayAudioOFF str="Zwei-Wege-Audio stoppen" /> <Resolution str="Auflsung" /> <Style str="Style" /> <Simple str="einfach" /> <Professional str="professionell" /> <Output str="Ausgabe" /> <SettoOpen str="setzen zum ffnen" /> <SettoClose str="setzen zum Schlieen" /> <Preset str="Speicher" /> <Zoom str="Zoom" /> <Wide str="Weit" /> <Tele str="Tele" /> <Advanced str="Erweitert" /> <IsDeletePreset str="Klick auf OK wird den Speicher lschen" /> <System_Log str="Systemprotokoll" /> <PTZ_SPEED str="PTZ Geschwindigkeit" /> <PTZ_HOME str="PTZ Grundstellung" /> <PTZ_UP str="PTZ hoch" /> <PTZ_DOWN str="PTZ runter" /> <PTZ_LEFT str="PTZ links" /> <PTZ_RIGHT str="PTZ rechts" /> <PTZ_UP_RIGHT str="PTZ hoch-rechts" /> <PTZ_UP_LEFT str="PTZ hoch-links" /> <PTZ_DOWN_LEFT str="PTZ runter-links" /> <PTZ_DOWN_RIGHT str="PTZ runter-rechts" /> <PTZ_TOUR_GO str="PTZ starte Tour" /> <PTZ_TOUR_STOP str="PTZ stoppe Tour" /> <PTZ_FOCUS_UP str="PTZ Fokus rein" /> <PTZ_FOCUS_DOWN str="PTZ Fokus raus" /> <PTZ_IRIS_UP str="PTZ Iris auf" /> <PTZ_IRIS_DOWN str="PTZ Iris zu" /> <PTZ_FOCUS_AUTO str="PTZ Autofokus" /> <PTZ_IRIS_AUTO str="PTZ autom. Iris" /> <PTZ_AUTOPAN_START str="PTZ start Navigation" /> <PTZ_AUTOPAN_STOP str="PTZ stoppe Navigation" /> <PTZ_ZOOM_IN str="PTZ Hineinzoomen" /> <PTZ_ZOOM_OUT str="PTZ Herauszoomen" /> <SYS_LOG_SYSTEM_INIT str="System Initia lisierung" /> <SYS_LOG_SYSTEM_SHUTDOWN str="System Herunterfahren" /> <SYS_LOG_USER_LOGIN str="Benutzer Anmeldung" /> <SYS_LOG_USER_LOGOUT str="Benutzer Abmeldung" /> <SYS_LOG_START_SCH_REC str="Starte geplante Aufnahme" /> <SYS_LOG_END_SCH_REC str="Stoppe geplante Aufnahme" /> <SYS_LOG_START_SCH_ALARM str="Starte Alarmplan" /> <SYS_LOG_END_SCH_ALARM str="Stoppe Alarmplan" /> <SYS_LOG_ENTER_SYS_SETUP str="Systemeinrichtung starten" /> <SYS_LOG_EXIT_SYS_SETUP str="Systemeinrichtung beenden" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Starte Einrichtung Aufnahmezeitplan" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Beende Einrichtung Aufnahmezeitplan" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Starte Einrichtung Alarmplan" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Beende Einrichtung Alarmplan" /> <SYS_LOG_RTSP_GET_CONNECT str="Verbindung herstellen" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Verbindung verloren" /> <SYS_LOG_SERVER_HTTP_START str="starte HTTP Server" /> <SYS_LOG_SERVER_HTTP_STOP str="stoppe HT TP Server" /> <SYS_LOG_SERVER_RTSP_START str="starte RTSP Server" /> <SYS_LOG_SERVER_RTSP_STOP str="stoppe RTSP Server" /> <SYS_LOG_SERVER_RPB_START str="starte entf. Wiedergabeserver" /> <SYS_LOG_SERVER_RPB_STOP str="stoppe entf. Wiedergabeserver" /> <DiskManagement str="Diskmanagement" /> <DeviceType str="Gertetyp" /> <Partition str="Partition" /> <FileSystem str="Dateisystem" /> <IsPartition str="Das System wird die HDD neu partitionieren. Bitte besttigen!" /> <Image str="Bild" /> <Brightness str="Helligkeit" /> <Contrast str="Kontrast" /> <Saturation str="Sttigung" /> <Sharpness str="Schrfe" /> <Hue str="Farbton" /> <NoSeldesti str="Bitte Ziel whlen" /> <NoSelSource str="Bitte Quelle whlen!" /> <Time_Range str="Bereich Dateialter" /> <Event_Snapshot str="Ereignis Schnappschuss" /> <EventSnapshotViewer str="Ereignis Schnappschussanzeige" /> <Event_Time str="Ereignis Zeit" /> <Event_Type str="Ereignis Typ" /> <Change_Resolution str="Auflsung wurde gendert. Speichern?" /> <Select_All str="Alles auswhlen" /> <InitNetowrk str="Netzwerkmodul initialisiert" /> <InitSystemDate str="Datum/Zeit Modul initialisiert" /> <InitDisk str="Disk Modul initialisiert" /> <InitRTSP str="RTSP Modul initialisiert" /> <NoVideo str="kein Video" /> <Modify str="ndern" /> <DisplayCount str="Anzahl Anzeige" /> <Mount str="Mount" /> <Unmount str="un-mount" /> <EditEmpty str="&amp;quot;Bitte prfen Sie, ob die Einstellung stimmt!&amp;quot;" /> <Account str="Konto" /> <FindListLog str="&amp;quot;ber %d Aufnahmen gefunden, nur die ersten %d Aufnahmen anzeigen &amp;quot;" /> <Trigger_Interval_Seconds str="Trigger Intervall Sekunden" /> <Alarm_Always str="Immer Alarm" /> <LowFPS str="niedrige Bitrate FPS" /> <WithFPS str="wie oben" /> <ShowPW str="Passwort zeigen" /> <SelOverMaxPlayHours str="ber %d Stunden auswhlen" /> <SelectedCamera str="ausgewhlte Kamera" /> <Codec str="Codec" /> <Switchto str="wechseln zu" /> <Filter str="Filter" />   <AutoSettingNote str="Bitte geben Sie eine Filterregel ein oder frei lassen um alle zu suchen" /> <TemplateSetting str="Vorlage Einstellung" /> <SearchByEvent str="Suche nach Ereignis" /> <Control str="Kontrolle" /> <SwitchCamera str="Wechsel zu Kamera" /> <Preview str="Voransicht" /> <SequentialSearch str="sequentielle Suche" /> <Split str="Aufteilen" /> <PreSearch str="Pr-Suche" /> <SeekTo str="Suche bis" /> <ShowInformation str="Informationen anzeigen" /> <Bitrate_Log str="Bitrate Protokoll" /> <Save str="Speichern" /> <PlaybackControlPad str="Wiedergabe Kontrollpanel" /> <FormatFault str="Fehlerhaftes Format" /> <LowBitrateSetting str="Einstellung geringe Bitrate" /> <NotConfigured str="nicht konfiguriert" /> <Application str="Anwendung" /> <NameOrMailEmpty str="Name oder eMail leer" /> <ONVIF_Auth str="ONVIF Authentifizierung" /> <PIR_Alarm str="PIR Alarm" /> <CameraTamper str="Kamera Manipulation" /> <AudioDetection str="autom. Erkennung" /> <AutoSwitch str="autom. Wechsel" /> <CancelAutoSwitch str="autom. Wechsel abbrechen" /> <MailRepeat str="Sie haben die gleiche eMail Adresse hinzugefgt. Bitte ndern!" /> <SMART str="S.M.A.R.T." /> <OVERALL str="ber alles" /> <PASSED str="erfolgreich" /> <FAILED str="fehlgeschlagen" /> <Raw_Read_Error_Rate str="Raw Read Error Rate" /> <Throughput_Performance str="Throughput Performance" /> <Spin_Up_Time str="Spin Up Time" /> <Start_Stop_Count str="Start Stop Count" /> <Reallocated_Sector_Ct str="Reallocated Sectors Count" /> <Seek_Error_Rate str="Seek Error Rate" /> <Seek_Time_Performance str="Seek Time Performance" /> <Power_On_Hours str="Power On Hours" /> <Spin_Retry_Count str="Spin Retry Count" /> <Calibration_Retry_Count str="Calibration Retry Count" /> <Power_Cycle_Count str="Power Cycle Count" /> <Power_Off_Retract_Count str="Power Off Retract Count" /> <Load_Cycle_Count str="Load Cycle Count" /> <Temperature_Celsius str="Temperatur Celsius" /> <Reallocated_Event_Count str="Reallocated Event Count" /> <Current_Pending_Sector str="Current Pending Sector" /> <Offline_Uncorrectable str="Offline Uncorrectable" /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="Multi Zone Error Rate" /> <SMART_RAW_VALUE str="Raw Value" /> <SMART_WORST str="Reference" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Anzeigeformat" /> <FitWindow str="anpassen an Fenster" /> <KeepRatio str="Verhltnis beibehalten" /> <Joystick str="Joystick" /> <Joystick_Information str="Joystick Information" /> <Joystick_Model str="Joystick Modell" /> <Axis_Count str="Achsenkontrolle" /> <Button_Count str="Zhler Taster" /> <Axis_X str="Wert x-Achse" /> <Axis_Y str="Wert y-Achse" /> <Axis_Z str="Wert z-Achse" /> <Buttons_Status str="Status Taster" /> <Joystick_Buttons_Setting str="Joystick Tasteneinstellung" /> <Button str="Taster" /> <Next_Division str="nchster Bereich" /> <Previous_Division str="vorheriger Bereich" /> <Next_W indow str="nchstes Fenster" /> <Previous_Window str="vorheriges Fenster" /> <Switch_Division_One str="gehe zum ersten Bereich" /> <Axis_Z_ID str="ID z-Achse" /> <RAID_Err_Alarm str="Alarm RAID Fehler" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Verbindung verloren"/> <ConnectFail str="Verbindung fehlgeschlagen"/> <GetSettingValueErr str="Kann die Einstellungen nicht laden!"/> <Refresh str="Bitte aktualisieren"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backup. Bitte warten& "/> <Converting str="Umwandlung. Bitte warten& "/> <ShowDate str="Datum anzeigen"/> <ShowTime str="Zeit anzeigen "/> <Subtitle str="berschrift"/> <PreSecond str="Vorherige Sekunde"/> <PreFrame str="Bild zurck"/> <NextSecond str="Nchste Sekunde"/> <NextFrame str="Nchstes Bild"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Bewegungssuche" /> <TimeSplit str="Zeitaufteilung" /> <ShowDetailWindow str="Details anzeigen" /> <FirstPage str="Erste Seite" /> <PrePage str="Vorherige Seite" /> <NextPage str="Nchste Seite" /> <LastPage str="Letzte Seite" /> <DetailPicture str="Detailbild" /> <SelectTime str="Zeit auswhlen" /> <ErrStartEndTm str="Fehler bei der Startzeit oder Endzeit" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Gesuchtes Bild anzeigen" /> <ShowDetectMark str="Erkennungsmakierung anzeigen" /> <DetectInterval str="Erkennungsintervall." /> <Exit str="Exit" /> <Grayscale str="Grauskalierung" /> <Softness str="Weichzeichnen" /> <Reset str="Reset" /> <Print str="Drucken" /> <RetryAgain str="Versuchen Sie es spter erneut." /> <FirmwareUpgrade_msg str="Firmwareupdate abgeschlossen. Bitte neu verbinden"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Zwei Wege Audio verwenden!"/> <Weekly str="Wchentlich"/> <SAVEAS str="Save As..."/> <Send_To str="Senden an"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Nachricht im Livebild anzeigen"/> <ACTION_DESC_MAIL str="E-Mail senden bei Ereignisalarm"/> <ACTION_DESC_VOICE str="Sound abspielen bei Ereignisalarm"/> <ACTION_DESC_DO str="Digitalen Ausgang nutzen bei Ereignisalarm"/> <ACTION_DESC_FTP str="Bilder auf FTP Server hochladen"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Bilder auf TCP Server hochladen"/> <ACTION_DESC_HTTP str="Bilder auf HTTP Server hochladen"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Bewegungsstatus erkennen"/> <EVENT_DESC_BLOCK str="Kamera Bild verdeckt/blockiert erkennen"/> <EVENT_DESC_BLUR str="Kamera Fokus verndert erkennen"/> <EVENT_DESC_CAM_MOVE str="Kamera verstellt erkennen."/> <EVENT_DESC_DI str="Statusnderung vom digitalen Eingang erkennen"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarmereignis auswhlen"/> <CREATE_NEW_FOLDER str="Neuen Ordner erstellen"/> <CHANGE_NAME str="Namen ndern"/> <TIME_SET_ERROR str="Einstellungsfehler bei der Zeit bitte berprfen."/> <Export str="Export"/> <SEL_VIEW_CH str="Kanalansicht auswhlen"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_  ALL str="Start Monitor (alle)"/> <UPDATE_FAIL str="Kann die Einstellungen nicht hochladen, bitte spter versuchen!"/> <DI_REC_TRIGGER str="DI Aufnahmeauslser durch"/> <PASTE str="Einfgen"/> <PASTE_MON_FRI str="Einfgen von Montag bis Freitag"/> <PASTE_SAT_SUN str="Einfgen von Samstag bis Sonntag"/> <PASTE_ALL_CAM str="Einfgen bei allen Kameras"/> <APPLY_ALL str="Alle besttigen"/> <UN_SELECT_ALL str="Alle abbrechen"/> <GET_PARAM_FAIL_USE_DEFAULT str="Gerteerkennung fehlgeschlagen. System nutzt Standardwerte"/> <NO_CAM_NAME str="Kein Kameraname, nutzen St"/> <ERR_SETUP str="Konfigurationsfehler bitt prfen."/> <DEL_CAM_COFIRM str="Sind Sie sicher das Sie die Datei '%s' von der Liste lschen wollen?"/> <ADD_CAM_ERR_ALREADY_HAS str="Es sind '%s' in der Liste. Bitte die Konfiguration berprfen."/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Kamera Live"/> <SHOW_PB_CAM str="Kamera Wiedergabe"/> <DELETE_CAM str="Kamera vom Display entfernen"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>B0 lang_russian.xmlėR/R̗R ?<root> <Font Name="unifont" /> <LanguageName str="=3;89A:89" /> <LanguageNameEng str="Russian" /> <Sch_Monitor str=">=8B>@8=3 @0A?8A0=8O" /> <Alarm_Monitor str=">=8B>@8=3 B@52>38" /> <Week0 str=">A:@." /> <Week1 str=">=54-:" /> <Week2 str="B>@=8:" /> <Week3 str="!@540" /> <Week4 str="'5B25@3" /> <Week5 str="OB=8F0" /> <Week6 str="!C11>B0" /> <WeekS0 str="A." /> <WeekS1 str="=." /> <WeekS2 str="B." /> <WeekS3 str="!@." /> <WeekS4 str="'B." /> <WeekS5 str="B." /> <WeekS6 str="!1." /> <Disk_Free str="!2>1>4=>" /> <Error str="H81:0" /> <LoginError str="H81:0 2E>40, =5?@028;L=>5 8<O ?>;L7>20B5;O 8;8 ?0@>;L" /> <DeviceInfo str="=D>@-8O" /> <DeviceTitle str="0720=85 CAB@." /> <SoftwareVersion str="5@A8O " /> <Characters str="!8<2>;" /> <DateTimeInfo str="=D. 40B0/2@5<O" /> <CurrentDate str=""5:CI0O 40B0" /> <CurrentTime str=""5:CI55 2@5<O" /> <Adjust str="#AB-B5" /> <Manual str=" CG=0O" /> <SyncNTP str="!8=E. ! NTP" /> <Setting str 0="0AB@-:8" /> <NTPServer str="NTP A5@25@" /> <Test str=""5AB" /> <NTPSyncInterval str="NTP 8=B5@20; A8=E." /> <Hour str="'0A" /> <Timezone str="@5<. >=0" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (-25=5B>:, 20460;59=)" /> <Timezone3 str="GMT-11 (!0<>0)" /> <Timezone4 str="GMT-10 (02098, ;5CBA:85 >-20)." /> <Timezone5 str="GMT-09 (;OA:0)" /> <Timezone6 str="GMT-08 (0A-530A, !0=-$@0=F8A:>, 0=:C25@0)" /> <Timezone7 str="GMT-07 (0;30@8, 5=25@5, !>;B-59:-!8B8)" /> <Timezone8 str="GMT-06 ('8:03>, 0;;0A, 5E8:>, LN-@;50=)" /> <Timezone9 str="GMT-05 (C10)" /> <Timezone10 str="GMT-05 (LN->@:, ">@>=B>, 0H8=3B>=, >:@C3 >;C<18O)" /> <Timezone11 str="GMT-04 (0@03209)" /> <Timezone12 str="GMT-04 ('8;8)" /> <Timezone13 str="GMT-04 ((0@;>BB0C=, 0=0CA)" /> <Timezone14 str="GMT-03:30 (LND0C=4;5=4)" /> <Timezone15 str="GMT-03 (@078;80, !0=-0C;C)" /> <Timezone16 str="GMT-02 (>@>=LO, Mid-Atlantic)" /> <Timezone17 str="GM 3T-01 (7>@A:85 >AB@>20, 01>-5@45)" /> <Timezone18 str="GMT (C1;8=, 8AA01>=, >=4>=, 59:LO28:)" /> <Timezone19 str="GMT +01 (<AB5@40<, 5@;8=, 8<, !B>:3>;L<, 0@H020)" /> <Timezone20 str="GMT +02 (D8=K, %5;LA8=:8, !B0<1C;, 830)" /> <Timezone21 str="GMT +02 (38?5B)" /> <Timezone22 str="GMT +02 (7@08;L)" /> <Timezone23 str="GMT +02 (820=)" /> <Timezone24 str="GMT +02 (!8@8O)" /> <Timezone25 str="GMT +03 (>A:20, -@- 8O4)" /> <Timezone26 str="GMT +03 (@0:)" /> <Timezone27 str="GMT +03:30 (@0=)" /> <Timezone28 str="GMT +04 (1C-C109, 0:C)" /> <Timezone29 str="GMT +04:30 (01C;)" /> <Timezone30 str="GMT +05 (A;0<0104, 0@0G8, "0H:5=B)" /> <Timezone31 str="GMT +05:30 (><159, 0;L:CBB0, LN-5;8)" /> <Timezone32 str="GMT +05:45 (0B<0=4C)" /> <Timezone33 str="GMT +06 (>2>A818@A:, <A:)" /> <Timezone34 str="GMT +06:30 ( 0=3C=)" /> <Timezone35 str="GMT +07 (0=3:>:, %0=>9, 60:0@B0)" /> <Timezone36 str="GMT +08 (5:8=, >=:>=3, (0=E09, !8=30?C@, "091M9)" /> <Ti & mezone37 str="GMT +09 (!5C;, A0:0, !0??>@>, ">:8>)" /> <Timezone38 str="GMT +09:30 (0@28=)" /> <Timezone39 str="GMT +09:30 (45;0840)" /> <Timezone40 str="GMT +10 (Hobart)" /> <Timezone41 str="GMT +10 (0=15@@0, 5;L1C@=, !84=59)" /> <Timezone42 str="GMT +11 (!>;><>=>2K >-20)." /> <Timezone43 str="GMT +11:30 (>@D>;:)" /> <Timezone44 str="GMT +12 (:;5=4, 5;;8=3B>=)" /> <Timezone45 str="GMT +12 ($8468)" /> <Timezone46 str="GMT +12 (0<G0B:0)" /> <Timezone47 str="GMT +12 (0@H0;;>2K >-20)." /> <Timezone48 str="GMT +13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT +13:45 ('0B5<)" /> <DST str="5B=55 2@5<O" /> <Disable str="50:B82=>" /> <Enable str=":B82=>" /> <DSTStart str="0G0;> ;5B=53> 2@5<5=8" /> <DSTEnd str=">=5F ;5B=53> 2@5<5=8" /> <DSTOffset str="!<5I5=85 2@5<5=8" /> <AutoLogin str="2B. E>4" /> <UID str=">38=" /> <PWD str="0@>;L" /> <System str="!8AB5<0" /> <AutoFullScreen str="0 25AL M:@0=" /> <Language str="/K7:" /> <Audio str="C48>" />  < <InputGain str="E. CA8;5=85" /> <OutputGain str="KE. CA8;5=85" /> <KeyinNTPAddr str="2548B5 04@5A NTP A5@25@0!" /> <Success str="#A?5H=>" /> <Fault str="H81:0" /> <OK str="OK" /> <Cancel str="B<5=0" /> <SetDateTime str="#AB. 40BC/2@5<O" /> <Date str="0B0" /> <Time str="@5<O" /> <AutoSetting str="2B> =0AB@>9:8" /> <CameraName str="<O :0<5@K" /> <ModelName str="<O <>45;8" /> <IPAddress str="IP 04@5A" /> <HTTPPort str="HTTP ?>@B" /> <RTSPPort str="RTSP ?>@B" /> <Camera str="0<5@0" /> <Schedule str=" 0A?8A0=85" /> <Network str="!5BL" /> <User str=".75@" /> <MotionDetection str="5B5:F8O 42865=8O" /> <Snapshot str="!:@8=H>B" /> <Maintenance str="1A;C6820=85" /> <Add str=">1-BL" /> <Delete str="#40;8BL" /> <Update str="1=-BL" /> <Clear str="G8A-BL" /> <Search str=">8A:" /> <AutoDetect str="2B> 45B5:-O" /> <Detect str="5B5:F8O" /> <MACAddress str="MAC 04@5A" /> <Configuration str=">=D83C@0F8O" /> <Copy str=">?8@>20BL" /> <StartTim ) e str="@5<O =0G." /> <EndTime str="@5<O :>=." /> <RecordType str=""8? 70?8A8" /> <PreAlarm str="@54B@52>30" /> <PostAlarm str=">AB@52>30" /> <RTC str="@C3>20O" /> <DIDetect str="DI 45B5:F8O" /> <TimeSelErr str="525@=K9 480?-= 2@5<5=8" /> <NoSelSch str="K15@8B5 >48= 3@0D8:" /> <Warning str="=8<0=85" /> <WeekCopyToAll str="@0D8: =0 =545;N B0:>9 65 :0: 2K1@0==K9" /> <DHCP str=">;CG8BL IP 04@5A 02B><0B8G5A:8(DHCP)" /> <SubnetMask str="0A:0 ?>4A5B8" /> <Gateway str="(;N7" /> <DNS_DHCP str=">;CG8BL DNS >B DHCP" /> <PrimaryDNS str="5@28G=K9 DNS" /> <SecondaryDNS str="B>@8G=K9 DNS" /> <PPPoE str="PPPoE" /> <Status str="!B0BCA" /> <Start str="!B0@B" /> <Stop str="!B>?" /> <Server str="!5@25@" /> <IPUsed str="4@5A 8A?>;L7C5BAO" /> <IPNoUsed str="4@5A <>6=> 8A?>;-BL" /> <Group str="@C??0" /> <Description str="?8A0=85" /> <ConfirmPWD str=">4B25@48B5 ?0@>;L" /> <LiveView str="@>A<>B@" /> <Playback str=">A?@-85" /> <Record str="0?8AL" /> <PTZ * str="PTZ" /> <TwoWayAudio str="2C=0?@->5 0C48>" /> <CheckConfirmPWD str="@>25@LB5 ?0@>;L" /> <UIDEmpty str="7<5=8B5 ;>38=" /> <UIDRepeat str=">38= ACI5AB25B. 7<5=8B5 53>." /> <NoSelUID str="K15@8B5 0::0C=B" /> <MotionID str="2865=85 ID" /> <Name str="<O" /> <Included str=":;." /> <Excluded str="A:;." /> <ObjectSize str=" 07<5@" /> <Sensitivity str="'C2AB-BL" /> <NoSelCamera str="K15@8B5 :0<5@C" /> <OverMaxMotion10 str="0:A. 10 7>= 42865=8O" /> <NoSelMotion str="K15@8B5 7>=C 42865=8O" /> <MotionSettingEnpty str="!=0G0;0 =0AB@>9B5 42865=85" /> <SourceSnapshotList str="!?8A>: A:@8=H>B>2" /> <SourceSnapshotPreview str="@54?@>A<>B@ A:@8=H>B>2" /> <DestinationSnapshotList str=" 0A?>;-85 A?8A:0 A:@8=H>B>2" /> <DestinationSnapshotPreview str="@54?@>A<B>@ A:@8=H>B>2" /> <NoFindSD str="AB02LB5 SD :0@BC" /> <NoSelImg str="K15@8B5 87>1@065=85" /> <SameSnapshotImgName str="$09; A B0:8< 8<5=5< 5AB =0 SD :0@B5. $09; 1C45B 70<5=5=." /> <IsAutoSetting str="K?>;= ?8BL 02B>=0AB@>9:8 :0<5@K?" /> <GetParamError str="H81:0 ?0@0<5B@>2" /> <CameraNameEmpty str="2548B5 8<O :0<5@K" /> <IPAddressEmpty str="2548B5 IP 04@5A" /> <UIDEmpty str="2548B5 ;>38=" /> <HttpPortEmpty str="2548B5 HTTP ?>@B" /> <CameraNameTheSame str=""0:>5 65 8<O :0<5@K" /> <CamParam str="0@0<5B@K :0<5@K" /> <Profile str="@>D8;L" /> <FPS str=":/A" /> <Protocol str="@>B>:>;" /> <EnableAudio str=":B. 0C48>" /> <AudioRecord str="C48> 70?8AL" /> <InputError str="H81:0 22>40" /> <DefaultSetting str="0AB@>9:8 ?> C<>;G0=8N" /> <FactoryDefaultSetting str="02>4A:85 =0AB@>9:8" /> <Default str="> C<>;G0=8N" /> <BackupSetting str="0AB@>9:8 @575@2=>3> :>?8@-8O" /> <Backup str=" 575@2=>5 :>?8@-85" /> <RestoreSetting str="0AB@>9:8 2>AAB0=>2;5=8O" /> <Restore str=">AAB0=>2;5=85" /> <FirmwareUpgrade str="1=>2;5=85 " /> <Upgrade str="1=>2;5=85" /> <Browse str="@>A<>B@" /> <SystemRestart str="5@5703@C7:0 A8AB5<K" /> <Restart str="5@5703@C7:0" /> <HDIn ?formation str="=D. > HDD" /> <SDInformation str="=D. > SD :0@B5" /> <TotalCapacity str="1I89 >1J5<" /> <FreeCapacity str="!2>1>4=K9 >1J5<" /> <UsedCapacity str="A?. 1J5<" /> <UsedPercent str="A?. @>F5=B" /> <Format str="$>@<0B-BL" /> <NoFind str="5 =0945=>" /> <NoMount str="5 CAB0=>2;5=" /> <IsDefaultSetting str="!8AB5<0 CAB0=>28B =0AB@>9:8 ?> C<>;G0=8N, 2:;. A5BL. >4B25@48B5 ?@>F54C@C" /> <NoBackupDevice str="AB02LB5 CAB@>9AB22> @575@2. :>?8@>20=8O" /> <NoFindConfigFile str="$09; :>=D83C@0F88 =5 =0945=" /> <ConfigFile str="$09; :>=D83C@0F88" /> <ConfigFileVerErr str="H81:0 25@A88 D09;0 :>=D83C@0F88." /> <IsRestart str="!8AB5<0 ?5@5703@C78BAO, ?>425@48B5 ?@>F54C@C" /> <NoFindFirmware str="@>H82:0 =5 =0945=0" /> <FirmwareFile str="$09; ?@>H82:8" /> <IsFormatHD str="A5 40==K5 1C4CB ?>B5@O=K, ?@>4>;68BL?" /> <OpenFirmwareUpgradeLogErr str="5 >B:@K205BAO firmware_upgrade.log" /> <Playback str=">A?@-85" /> <PlaybackTime str="@5<O 2>A?@-8O" /> <Play str="0  * ?CA:" /> <Reverse str="1@0B=0O" /> <Pause str="0C70" /> <Wait str=">4>648B5!" /> <Mute str="57 72C:0" /> <LiveAudio str="C48>" /> <PlaybackAudio str="C48> 2>A?@-85" /> <ConvertToAvi str=">=2-BL 2 AVI" /> <NoFindRecord str="0?8AL =5 =0945=0" /> <TimePeriod str="5@8>4 2@5<5=8" /> <SaveTo str="!>E@0=8BL 2" /> <BackupDeviceFull str="#AB@>9AB2> @575@2. :>?8@>20=8O 70?>;=5=>. @>25@LB5" /> <SavePath str="CBL A>E@-8O" /> <Login str=">9B8" /> <Logout str="K9B8" /> <PictureSet str="#AB0=>2:8 87>1@-8O" /> <Rotation str="5@525@=CBL" /> <Normal str="1KG=K9" /> <Mirror str="B>1@078BL" /> <VerticaFlip str="5@B8:0;L=>5 >B>1@-85" /> <ColorLevel str="#@>25=L F25B0" /> <Brightness str="/@:>ABL" /> <Contrast str=">=B@0AB" /> <Sharpness str="'5B:>ABL" /> <RateControl str=">=B@>;L A:>@>AB8" /> <Quality str="0G5AB2>" /> <Bitrate str="8B@59B" /> <VideoOffset str="845> A<5I5=85" /> <De-Noise str=">402;5=85 HC<0" /> <None str="8 >48=" /> <Method str="  ) 5B>4" /> <AutoMode str="C48> @568<" /> <DayMode str=" 568< 45=L" /> <NightMode str=" 568< =>GL" /> <Base str="A=>2=>9" /> <Picture str="7>1@065=85" /> <OutOfRange str="=5 480?>7>=0" /> <SystemClose str="025@H5=<5 @01>BK A8AB5<K" /> <On str=":;." /> <Off str="K:;." /> <Vendor str="@>872>48B5;L" /> <ModelName str="<O <>45;8" /> <FriendlyName str="<O 4>ABC?0" /> <UPnPTraversal str="UPnP >1E>4" /> <PortRange str="80?07>= ?>@B>2" /> <ExternalIPAddress str="=5H=89 IP-04@5A" /> <Information str="=D>@<0F8O" /> <SelOverPlayerMaxCam str="K15@8B5 :0<5@K" /> <Event str="!>1KB85" /> <Event_List str="!?8A>: A>1KB89" /> <Motion str="2865=85" /> <DI str="&8D@>2>9 2E>4" /> <DO str="&8D@>2>9 2KE>4" /> <Event_Schedule_List str="!?8A>: @0D8:0 A>1KB89" /> <Action_List str="!?8A>: 459AB289" /> <Alarm_Trigger_Type str=""8? B@52>38" /> <Alarm_Seconds str="@5<O B@52>38" /> <Buzzer str="C<<5@" /> <UnKnow str="58725AB=K9" /> <Display_On_CH str=">:070BL :0=0;"   </> <Action_Type str=""8? 459AB28O" /> <ERR_MSG_NO_CAM str="K15@8B5 :0<5@C" /> <ERR_MSG_NO_EVENT str="K15@8B5 A=0G0;0 A>1KB85" /> <ERR_MSG_NO_EVENT_SCH str="K15@8B5 A=0G0;0 A>1KB85 87 @0A?8A0=8O" /> <ERR_MSG_NO_ACTION str="2K15@8B5 A=0G0;0 459AB285" /> <ERR_MSG_TIME_PERIOD str="H81:0 =0AB@>9:8 ?5@8>40 2@5<5=8, ?@>25@LB5 =0AB@>9:8" /> <ERR_MSG_TIME_CONFILT str=">=D;8:B =0AB@>9:8 ?5@8>40 2@5<5=8, ?@>25@LB5 =0AB@>9:8!" /> <WeekDays str="=8 =545;8" /> <AlarmSetting str="0AB@>9:8 B@52>38" /> <AlarmCondition str="!>AB>O=85 B@52>38" /> <Alarm_True str="AB8=0 " /> <Alarm_False str=">6L" /> <Alarm_Seconds str="@5<O B@52>38" /> <Alarm_Manual_Stop str=" CG=0O >AB0=>2:0" /> <Local str=">:0;L=K9" /> <DI_Setting str="DI =0AB@>9:8" /> <System_Setting str="0AB@>9:8 A8AB5<K" /> <Log_Viewer str="@>A<>B@ 6C@=0;0" /> <Event_Log str="C@=0; A>1KB89" /> <Device str="#AB@>9AB2>" /> <Log_Type str=""8? 6C@=0;0" /> <Motion_Alarm str="?>25I. 42865=8O" /> <DI_Alarm str="DI >?>25  & I." /> <Input str="E>4=>9" /> <Limit_Record str="@545; 70?8A8" /> <Remark str="><5B:0" /> <Total str="1I89" /> <HDD_Err_Alarm str=""@52>30 >H81:8 HDD" /> <Disconnect_Alarm str=""@52>30 @07J548=5=8O" /> <Schedule_Trigger str=" 0A?8A0=85 B@8335@0" /> <Block_Alarm str=";>: B@52>38" /> <Blur_Alarm str="!83=0; B@52>38" /> <Camera_Move_Alarm str=""@52>30 2>7459AB28O =0 :0<5@C" /> <Address_Book str="4@5A=0O :=830" /> <Phone str=""5;." /> <E_MAIL str="E-Mail" /> <Notification str="#254><;5=85" /> <SMTP_Config str="SMTP =0AB@>9:8" /> <SMTP_Server str="!5@25@" /> <SMTP_Port str=">@B" /> <From str="B" /> <SendMailWithoutPicture str="B?@028BL ?>GBC 157 87>1@065=8O" /> <ServerRequireAuthentication str="!5@25@ 70?@0H8205B 02B>@870F8N" /> <SSL str="!5@25@ 70?@0H8205B 70I8I5==>5 A>548=5=85" /> <Send_Test str=""5AB" /> <FTP_Config str="FTP =0AB@>9:8" /> <FTP_Server str="!5@25@" /> <FTP_Port str=">@B" /> <Retry str=">2B>@8BL" /> <RecycleDays str=">2B>@8BL 4=8" /  3> <RecycleSize str=">2B>@8BL @07<5@" /> <Path str="CBL" /> <AllowCreateFolder str=" 07@5H8BL A>740BL ?0?:C" /> <HTTP_Config str="HTTP =0AB@>9:8" /> <HTTP_IP str="IP" /> <HTTP_UID str="::0C=B" /> <HTTP_PWD str="0@>;L" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="@>:A8 04@5A" /> <Proxy_UID str="@>:A8 0::0C=B" /> <Proxy_PWD str="@>:A8 ?0@>;L" /> <Proxy_Port str="@>:A8 ?>@B" /> <TCP_Config str="0AB@>9:8 TCP" /> <TCP_Server str="!5@25@" /> <TCP_Port str=">@B" /> <Alarm_Config str="0AB@>9:0 B@52>38" /> <frame str="04@" /> <SnapshotInterval str="=B5@20; A:@8=H>B>2" /> <SendInterval str="=B5@20; >B?@02:8" /> <SnapshotTempFolder str="@5<5==0O ?0?:0 A:@8=H>B>2" /> <Mail str=">GB0" /> <Subject str=""5<0" /> <body str="!>>1I5=85" /> <MS str="MS" /> <second str="!5:C=40" /> <EventDetect str="!>1KB85 >1=0@-O" /> <EventForceRecord str="0?8AL ?> A>1KB8N" /> <EventSetting str="0AB@>9:8 A>1KB8O" /> <MergeSeconds str="1J54-85 A5:C=4" /> <Display str 0="B>1@060BL" /> <Division str="5;5=85" /> <FullScreen str=">;=K9 M:@0=" /> <ResetDIVDefault str="!1@>A8BL" /> <CancelFullScreen str="B<5=8BL ?>;=K9 M:@0=" /> <Function str="$C=:F8O" /> <SystemManagement str="#?@02;5=85 A8AB5<>9" /> <PTZControl str="PTZ C?@02-85" /> <Volume str="@><:>ABL" /> <Monitor str="B>1@060BL" /> <CancelMute str=":;. 2C:" /> <TwoWayAudioON str=":;. 42C=0?@->5 0C48>" /> <TwoWayAudioOFF str="K:;. 42C=0?@->5 0C48>" /> <Resolution str=" 07@5H5=85" /> <Style str="!B8;L" /> <Simple str="@>AB>9" /> <Professional str="@>D5AA8>=0;L=K9" /> <Output str="KE>4=>9" /> <SettoOpen str="#AB. =0 >B:@KB85" /> <SettoClose str="#AB. =0 70:@KB85" /> <Preset str="@54CAB0=>2:0" /> <Zoom str="C<" /> <Wide str="@81;878BL" /> <Tele str="B40;8BL" /> <Advanced str=" 0AH8@5==K9" /> <IsDeletePreset str="06<8B5 , GB>1K C40;8BL ?@54CAB0=>2:C" /> <System_Log str="!8AB5<=K9 6C@=0;" /> <PTZ_SPEED str="!:>@>ABL" /> <PTZ_HOME str=" F5=B@" /> <PTZ_ % UP str="25@E" /> <PTZ_DOWN str="=87" /> <PTZ_LEFT str=";52>" /> <PTZ_RIGHT str="?@02>" /> <PTZ_UP_RIGHT str="25@E/2?@02>" /> <PTZ_UP_LEFT str="25@E/2;52>" /> <PTZ_DOWN_LEFT str="=87/2;52>" /> <PTZ_DOWN_RIGHT str="=87/2?@02>" /> <PTZ_TOUR_GO str=""C@ AB0@B" /> <PTZ_TOUR_STOP str=""C@ AB>?" /> <PTZ_FOCUS_UP str="#2. D>:CA" /> <PTZ_FOCUS_DOWN str="#<. D>:CA" /> <PTZ_IRIS_UP str="#2. 480D@0<C" /> <PTZ_IRIS_DOWN str="#<. 480D@0<C" /> <PTZ_FOCUS_AUTO str="2B>D>:CA" /> <PTZ_IRIS_AUTO str="2B>480D@03<0" /> <PTZ_AUTOPAN_START str="0?CA: =02830F88" /> <PTZ_AUTOPAN_STOP str="!B>? =02830F88" /> <PTZ_ZOOM_IN str="#2. 7C<" /> <PTZ_ZOOM_OUT str="#<. 7C<" /> <SYS_LOG_SYSTEM_INIT str="=8F80;-O A8AB5<K" /> <SYS_LOG_SYSTEM_SHUTDOWN str="025@H5=85 @01>BK A8AB5<K" /> <SYS_LOG_USER_LOGIN str="E>4" /> <SYS_LOG_USER_LOGOUT str="KE>4" /> <SYS_LOG_START_SCH_REC str="0G0BL 70?8AL ?> @0A?8A0=8N" /> <SYS_LOG_END_SCH_REC str="025@H8BL 70?8AL ?> @0A?8A0=8N" /> <SYS_LOG_ST ART_SCH_ALARM str=":;. @0A?8A0=85 B@52>38" /> <SYS_LOG_END_SCH_ALARM str="K:;. @0A?8A0=85 B@52>38" /> <SYS_LOG_ENTER_SYS_SETUP str=">9B8 2 A8AB5<=K5 =0AB@>9:8" /> <SYS_LOG_EXIT_SYS_SETUP str="K9B8 87 A8AB5<=KE =0AB@>5:" /> <SYS_LOG_ENTER_SCH_REC_SETUP str=">9B8 2 =0AB@>9:8 70?8A8 ?> @0A?8A0=8N" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="K9B8 87 =0AB@>5: 70?8A8 ?> @0A?8A0=8N" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str=">9B8 2 =0AB@>9:8 @0A?8A0=8O B@52>38 " /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="K9B8 87 =0AB@>5: @0A?8A0=8O B@52>38 " /> <SYS_LOG_RTSP_GET_CONNECT str="!>548=5=85" /> <SYS_LOG_RTSP_LOSE_CONNECT str=">B5@O A>548=5=8O" /> <SYS_LOG_SERVER_HTTP_START str="!B0@B HTTP A5@25@" /> <SYS_LOG_SERVER_HTTP_STOP str="!B>? HTTP A5@25@" /> <SYS_LOG_SERVER_RTSP_START str="!B0@B RTSP A5@25@" /> <SYS_LOG_SERVER_RTSP_STOP str="!B>? RTSP A5@25@" /> <SYS_LOG_SERVER_RPB_START str="!B0@B C40;5==K9 A5@25@ 2>A?@-8O" /> <SYS_LOG_SERVER_RPB_STOP str="!B>? C40;5==K9 A5@25@ 2>A?@-8O" /> <DiskManageme  nt str="#?@02;5=85 HDD" /> <DeviceType str=""8? CAB@>9AB20" /> <Partition str=" 0745;" /> <FileSystem str="$09;-0O A8AB5<0" /> <IsPartition str="!8AB5<0 ?>2B>@=> A>740AB @0745;, ?>4B25@48B5 ?@>F54C@C" /> <Image str="7>1@065=85" /> <Brightness str="/@:>ABL" /> <Contrast str=">=B@0AB" /> <Saturation str="0AKI5==>ABL" /> <Sharpness str="'5B:>ABL" /> <Hue str="BB5=>:" /> <NoSeldesti str="K15@8B5 =0?@02;5=85" /> <NoSelSource str="K15@8B5 A?8A>: 8AB>G=8:0" /> <Time_Range str="$09; 480?-=0 2@5<5=8" /> <Event_Snapshot str="!:@8=H>B A>1KB8O" /> <EventSnapshotViewer str="@>A<>B@ A:@8=H>B0" /> <Event_Time str="@5<O A>1KB8O" /> <Event_Type str=""8? A>1KB8O" /> <Change_Resolution str=" 07@5H5=85 M:@0=0 1K;> 87<5=5=>, 2K E>B8B5 87<5=8BL?" /> <Select_All str="K1@0BL 2A5" /> <InitNetowrk str="=8F80;870F8O A5B8" /> <InitSystemDate str="=8F80;870F8O 40BK/2@5<5=8" /> <InitDisk str="=8F80;870F8O 48A:0" /> <InitRTSP str="=8F80;870F8O RTSP " /> <NoVideo str="5B 2845>" /  > <Modify str="7<5=8BL" /> <DisplayCount str="B>1@060BL" /> <Mount str=">=B8@>20BL" /> <Unmount str=" 07<>=B8@>20BL" /> <EditEmpty str=">4B25@48B5 ?@028;L=>ABL =0AB@>5:" /> <Account str="::0C=B" /> <FindListLog str="0945=> 1>;55 % 4=59 70?8A59, >B>1@060BL B>;L:> ?5@2K5 % 4=O 70?8A8" /> <Trigger_Interval_Seconds str="=B5@20;" /> <Alarm_Always str="A5340 B@52>30" /> <LowFPS str="87:89 18B@59B :/A" /> <WithFPS str="0: 2KH5" /> <ShowPW str=">:070BL ?0@>;L" /> <SelOverMaxPlayHours str="K1@0=> 1>;55 G0A0" /> <SelectedCamera str="K1@0==0O :0<5@0" /> <Codec str=">45:" /> <Switchto str="5@5:;NG8BL" /> <Filter str="$8;LB@" /> <AutoSettingNote str="2548B5 ?@028;0 D8;LB@0F88 8;8 >AB028B5 ?CABK< 4;O ?>8A:0 2A5E 70?8A59" /> <TemplateSetting str="0AB@>9:0 H01;>=0" /> <SearchByEvent str=">8A: ?> A>1KB8N" /> <Control str="#?@02;585" /> <SwitchCamera str="5@5:;NG. 0<5@C" /> <Preview str="@54?@>A<>B@ " /> <SequentialSearch str="Sequential Search" /> <Split s tr="Split" /> <PreSearch str="Pre Search" /> <SeekTo str="Seek To" /> <ShowInformation str="Show Information" /> <Bitrate_Log str="Bitrate Log" /> <Save str="Save" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting"/> <NotConfigured str="Not Configured"/> <Application str="Application"/> <NameOrMailEmpty str="Name or E-Mail is empty"/> <ONVIF_Auth str="ONVIF Authentication"/> <PIR_Alarm str="PIR Alarm"/> <CameraTamper str="Camera Tamper"/> <AudioDetection str="Audio Detection"/> <AutoSwitch str="Auto Switch"/> <CancelAutoSwitch str="Cancel Auto Switch"/> <MailRepeat str="You add the same E-Mail. Please change it!"/> <SMART str="S.M.A.R.T Status"/> <OVERALL str="Over all"/> <PASSED str="PASSED"/> <FAILED str="FAILED"/> <Raw_Read_Error_Rate str="Raw Read Error Rate"/> <Throughput_Performance str="Throughput Performance"/> <Spin_Up_Time str="Spin Up Time"/> <Start_Stop_Count str="S  tart Stop Count"/> <Reallocated_Sector_Ct str="Reallocated Sectors Count"/> <Seek_Error_Rate str="Seek Error Rate"/> <Seek_Time_Performance str="Seek Time Performance"/> <Power_On_Hours str="Power On Hours"/> <Spin_Retry_Count str="Spin Retry Count"/> <Calibration_Retry_Count str="Calibration Retry Count"/> <Power_Cycle_Count str="Power Cycle Count"/> <Power_Off_Retract_Count str="Power Off Retract Count"/> <Load_Cycle_Count str="Load Cycle Count"/> <Temperature_Celsius str="Temperature Celsius"/> <Reallocated_Event_Count str="Reallocated Event Count"/> <Current_Pending_Sector str="Current Pending Sector"/> <Offline_Uncorrectable str="Offline Uncorrectable"/> <UDMA_CRC_Error_Count str="UDMA CRC Error Count"/> <Multi_Zone_Error_Rate str="Multi Zone Error Rate"/> <SMART_RAW_VALUE str="Raw Value"/> <SMART_WORST str="Reference"/> <SMART_Event str="HDD S.M.A.R.T"/> <DisplayRatio str="Display Ratio"/> <FitWindow str="Fit Window"/> <KeepRatio str="Keep Ratio"/> <Joystick   str="Joystick"/> <Joystick_Information str="Joystick Information"/> <Joystick_Model str="Joystick Model"/> <Axis_Count str="Axis Count"/> <Button_Count str="Button Count"/> <Axis_X str="Axis X Value"/> <Axis_Y str="Axis Y Value"/> <Axis_Z str="Axis Z Value"/> <Buttons_Status str="Buttons Status"/> <Joystick_Buttons_Setting str="Joystick Buttons Setting"/> <Button str="Button"/> <Next_Division str="Next Division"/> <Previous_Division str="Previous Division"/> <Next_Window str="Next Window"/> <Previous_Window str="Previous Window"/> <Switch_Division_One str="Switch Division One"/> <Axis_Z_ID str="Axis Z ID"/> <RAID_Err_Alarm str="RAID Error Alarm"/> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware s tr="Invalid Firmware!"/> <ConnectLost str=">B5@O !2O78"/> <ConnectFail str="H81:0 !>548=5=8O"/> <GetSettingValueErr str="52>7<>6=> >;CG8BL =0G5=85 0AB@>9:8!"/> <Refresh str=">60;C9AB0 1=>28B5!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str=" 575@2>=>5 :>?8@>20=85, >60;C9AB0 ?>4>648B5"/> <Converting str=">=25@B0F8O. >60;C9AB0 ?>4>648B5"/> <ShowDate str=">:070BL 0BC"/> <ShowTime str=">:070BL @5<O"/> <Subtitle str="Subtitle"/> <PreSecond str="@54 !5:C=40"/> <PreFrame str="@54 04@"/> <NextSecond str="!;54CNI0O !5:C=40"/> <NextFrame str="!;54CNI89 04@"/> <LowBitrate str="Low Bitrate"/> <DigitalZoom str="&8D@>2>9 C<" /> <MotionSearch str=">8A: 2865=8O" /> <TimeSplit str=" 0745;5=85 @5<5=8" /> <ShowDetailWindow str=">:070BL 5B0;L=>5 :=>" /> <FirstPage str="5@20O !B@0=8F0" /> <PrePage str="@54 !B@0=8F0" /> <NextPage str="!;54CNI0O !B@0=8F0" /> <LastPage str=">A;54=OO !B@0=8F0  " /> <DetailPicture str="5B0;L=>5 7>1@065=85" /> <SelectTime str="K1>@ @5<5=8" /> <ErrStartEndTm str="H81:0 0G0;L=>3> 8;8 >=5G=>3> @5<5=8!" /> <SearchSet str="#AB0=>2:0 >8A:0" /> <ShowSearchImage str=">:070BL 7>1@065=85 >8A:0" /> <ShowDetectMark str=">:070BL =0: 1=0@C65=8O" /> <DetectInterval str="=B5@20; 1=0@C65=8O:" /> <Exit str="KE>4" /> <Grayscale str="BB5=>: !5@>3>" /> <Softness str="O3:89" /> <Reset str="!1@>A" /> <Print str="5G0BL" /> <RetryAgain str=">60;C9AB0 ?>?@>1C9B5 ?>765!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="A?>;L7C5BAO 2C=0?@02;5==>5 C48>"/> <Weekly str="65=545;L=>"/> <SAVEAS str="Save As..."/> <Send_To str="B?@02:0 :"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/>  <ACTION_DESC_DISPLAY str="B>1@065=85 !>>1I5=8O =0 82>< 845"/> <ACTION_DESC_MAIL str="B>A;0BL !>>1I5=85 A @54C?@5645=85< ?@8 !@01>B:8 !>1KB8O!"/> <ACTION_DESC_VOICE str=">A?@>872545=85 "@52>6=>3> 2C:0 ?@8 !@01>B:8 2865=8O"/> <ACTION_DESC_DO str="!@01>B:0 &8D@>2>3> KE>40 ?@8 !@01>B:8 !>1KB8O"/> <ACTION_DESC_FTP str="03@C78BL 04@K =0 FTP A09B"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="1=0@C65=85 701;>:8@>20==>9 :0<5@K"/> <EVENT_DESC_BLUR str="1=0@C65=85 ?>B5@8 D>:CA0 :0<5@K"/> <EVENT_DESC_CAM_MOVE str="1=0@C65=85 =0?@02;5=8O ?5@5<5I5=8O :0<5@K"/> <EVENT_DESC_DI str="1=0@C65=85 AB0BCA0 87<5=5=8O F8D@>2>3> 2E>40"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected "/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="K1>@ !>1KB8O "@52>38"/> <CREATE_NEW_FOLDER str="!>740=85 >2>9 0?:8"/> <CHANGE_NAME str="7<5=5=85 <5=8"/> <TIME_SET_ERROR str="H81:0 CAB0=>2:8 2@5<5=8, ?>60;C9AB0 ?@>25@LB5 =0AB@>9:8 2@5<5=8"/> <Export str="-:A?>@B"/> <SEL_VIEW_CH str="K1@0BL 84 B>1@065=8O 0=0;>2"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="!B0@B A5E >=8B>@>2"/> <UPDATE_FAIL str="52>7<>6=> >1=>28BL =0AB@>9:8, ?>60;C9AB0, ?>?@>1C9B5 A=>20 ?>765!"/> <DI_REC_TRIGGER str="DI 0?8AL ?> !@01>B:5:"/> <PASTE str="AB028BL"/> <PASTE_MON_FRI str="AB028BL A >=545;L=8:0 ?> OB=8FC"/> <PASTE_SAT_SUN str="AB028BL A !C11>BK ?> >A:@5A5=L5"/> <PASTE_ALL_CAM str="AB028BL 4;O 2A5E :0<5@"/> <APPLY_ALL str=">1028BL 4;O 2A5E"/> <UN  _SELECT_ALL str="B<5=8BL A5"/> <GET_PARAM_FAIL_USE_DEFAULT str="H81:0 >;CG5=8O 0@0<5B@>2 #AB@>9AB20, !8AB5<0 1C45B 8A?>;L7>20BL 7=0G5=8O ?> C<>;G0=8N!"/> <NO_CAM_NAME str="5B 8<5=8 :0<5@K, 8A?>;L7>20BL 7=0G5=85 ?> C<>;G0=8N?"/> <ERR_SETUP str="H81:0 =0AB@>9:8 40==KE, ?>60;C9AB0, ?5@5?@>25@LB5"/> <DEL_CAM_COFIRM str="K 65;05B5 C40;8BL '%s' 87 A?8A:0?"/> <ADD_CAM_ERR_ALREADY_HAS str="#65 8<55BAO '%s', ?>60;C9AB0, ?5@5?@>25@LB5 =0AB@>9:8"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str=">:070BL 82>5 7>1@065=85 0<5@K"/> <SHOW_PB_CAM str=">:070BL >A?@>872545=85 0<5@K"/> <DELETE_CAM str="#40;5=85 B>1@065=85 0<5@K"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>  lang_korean.xmlėR!R̗R <<root> <Font Name="unifont" /> <LanguageName str="\m" /> <LanguageNameEng str="Korean" /> <Sch_Monitor str="t Ȳ0" /> <Alarm_Monitor str="LŌ Ȳ0" /> <Week0 str="|ǔ|" /> <Week1 str="Ɣ|" /> <Week2 str="T֔|" /> <Week3 str="”|" /> <Week4 str="|" /> <Week5 str="|" /> <Week6 str="є|" /> <WeekS0 str="|" /> <WeekS1 str="" /> <WeekS2 str="T" /> <WeekS3 str="" /> <WeekS4 str="" /> <WeekS5 str="" /> <WeekS6 str="" /> <Disk_Free str="" /> <Error str="$X" /> <LoginError str="\x (, Ɛ tDŽ  T8 ޹ JŵȲ." /> <DeviceInfo str="X " /> <DeviceTitle str="X tDŽ" /> <SoftwareVersion str="ոƴ " /> <Characters str="Characters" /> <DateTimeInfo str="  " /> <CurrentDate str="֬ " /> <CurrentTime str="֬ " /> <Adjust str="p" /> <Manual str="ٳ" /> <SyncNTP str="NTP  ٳ0T" /> <Setting str="$" /> <NTPServer str="NTP" /> <Test str="LѤ¸" /> <NTPSyncInterval str="NTP ٳ0T " /> <Hour str="" /> <Timezone str="" />  3 <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Azores, Cap Verde Isl.)" /> <Timezone18 str="GMT (Dublin, Lisbon, London, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berlin, Rome, Stockholm, War 0saw)" /> <Timezone20 str="GMT+02 (Athens, Helsinki, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="GMT+03 (Moscow, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)" /> <Timezone37 str="GMT+09 (Seoul, Osaka, Sapporo, Tokyo)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" / % > <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+13:45 (Chatham" /> <DST str="| } " /> <Disable str="D\1" /> <Enable str="\1" /> <DSTStart str="| }  ‘" /> <DSTEnd str="| }  ̸" /> <DSTOffset str="| }  (" /> <AutoLogin str="ٳ \x" /> <UID str="Ɛ tDŽ" /> <PWD str="T8" /> <System str="¤\" /> <AutoFullScreen str="ٳ ȴ Tt" /> <Language str="Ŵ" /> <Audio str="$$" /> <InputGain str="% ij" /> <OutputGain str="% ij" /> <KeyinNTPAddr str="NTP  Ȍ| % X8!" /> <Success str="1" /> <Fault str="(" /> <OK str="U" /> <Cancel str="͌" /> <SetDateTime str="  $" /> <Date str="" /> <Time str=""  ?/> <AutoSetting str="ٳ $" /> <CameraName str="tT| tDŽ" /> <ModelName str="x tDŽ" /> <IPAddress str="IP Ȍ" /> <HTTPPort str="HTTP Ӹ" /> <RTSPPort str="RTSP Ӹ" /> <Camera str="tT|" /> <Schedule str="t" /> <Network str="$l" /> <User str="Ɛ" /> <MotionDetection str="ٳ " /> <Snapshot str=" " /> <Maintenance str=" " /> <Add str="" /> <Delete str="" /> <Update str="ptǸ" /> <Clear str="ɰ0" /> <Search str="" /> <AutoDetect str="ٳ " /> <Detect str="" /> <MACAddress str="MAC Ȍ" /> <Configuration str="Xֽ $" /> <Copy str="" /> <StartTime str="‘ " /> <EndTime str="̸ " /> <RecordType str="yT Ѕ" /> <PreAlarm str="LŌ t" /> <PostAlarm str="LŌ t" /> <RTC str=" yT" /> <DIDetect str="DI " /> <TimeSelErr str=" $ $X!" /> <NoSelSch str="X՘X tD X8!" /> <Warning str="" /> <WeekCopyToAll str=" @ $ ȩ" /> <DHCP str="IP Ȍ ٳ `(DHCP)" /> <SubnetMask str=" 7 ȹl" /> <Gateway str="tǸ t" /> <D * NS_DHCP str="DHCP DNS 0" /> <PrimaryDNS str="0 DNS" /> <SecondaryDNS str="p DNS" /> <PPPoE str="PPPoE" /> <Status str="" /> <Start str="‘" /> <Stop str="" /> <Server str="" /> <IPUsed str="Ȍ  Ȳ!" /> <IPNoUsed str="Ȍ| `  ǵȲ!" /> <Group str="" /> <Description str="$" /> <ConfirmPWD str="T8 Ux" /> <LiveView str=" " /> <Playback str="" /> <Record str="yT" /> <PTZ str="PTZ" /> <TwoWayAudio str=") $$" /> <CheckConfirmPWD str="T8 UxD l X8." /> <UIDEmpty str="Ɛ tDŽD  X8." /> <UIDRepeat str="Ɛ tDŽt t ]  ǵȲ!" /> <NoSelUID str="ĬD X8!" /> <MotionID str="ٳ ID" /> <Name str="tDŽ" /> <Included str="Ŵ" /> <Excluded str="x" /> <ObjectSize str=" l0" /> <Sensitivity str="ij" /> <NoSelCamera str="tT|| X8!" /> <OverMaxMotion10 str="\ ٳ ɔ 10 Ȳ." /> <NoSelMotion str="ٳ | X8." /> <MotionSettingEnpty str="ٳ | < $ X8." /> <SourceSnapshotList str=" ]" /> <SourceSnapshotPreview  ) str="  0" /> <DestinationSnapshotList str="xƥ   ]" /> <DestinationSnapshotPreview str="xƥ   0" /> <NoFindSD str="SD tܴ| X8!" /> <NoSelImg str="t| X8!" /> <SameSnapshotImgName str="SD tܴ ٳ|\ tDŽt ǵȲ. |D iȲ!" /> <IsAutoSetting str="ٳ<\ tT| $D X ȲL?" /> <GetParamError str=" |0 8 $0 $X!" /> <CameraNameEmpty str="tT| tDŽD % X8!" /> <IPAddressEmpty str="IP Ȍ| % X8!" /> <UIDEmpty str="Ɛ tDŽD % X8!" /> <HttpPortEmpty str="HTTP Ӹ| % X8!" /> <CameraNameTheSame str="tT| tDŽt  )Ȳ.!" /> <CamParam str="tT| " /> <Profile str="\ |" /> <FPS str="FPS" /> <Protocol str="\\" /> <EnableAudio str="$$ \1" /> <AudioRecord str="$$ yL" /> <InputError str="% $X" /> <DefaultSetting str="$ 0T" /> <FactoryDefaultSetting str=" 0T" /> <Default str="0" /> <BackupSetting str="$ 1" /> <Backup str="1" /> <RestoreSetting str="$ l" /> <Restore str="l" /> <FirmwareUpgrade str="ƴ tܴ" /> <Upgrade str="tܴ" /> <B <rowse str="" /> <SystemRestart str="¤\ ‘" /> <Restart str="‘" /> <HDInformation str="Xܴl " /> <SDInformation str="SD tܴ " /> <TotalCapacity str="ȴ ɷ" /> <FreeCapacity str="@ ɷ" /> <UsedCapacity str=" ɷ" /> <UsedPercent str=" D(" /> <Format str="g" /> <NoFind str=">D  L" /> <NoMount str="Ű H(" /> <IsDefaultSetting str="$l $D hX $D 0T iȲ." /> <NoBackupDevice str="1 X| Ű X8." /> <NoFindConfigFile str="l1 |D >D  ŵȲ." /> <ConfigFile str="l1 |" /> <ConfigFileVerErr str="l1 |  $X." /> <IsRestart str="¤\D ‘ iȲ. Ux X8." /> <NoFindFirmware str="ƴ| >D  ŵȲ.!" /> <FirmwareFile str="ƴ |" /> <IsFormatHD str=" pt0 )Ȳ. Ĭ X ȲL?" /> <OpenFirmwareUpgradeLogErr str="ƴ tܴ \|  ŵȲ." /> <Playback str="" /> <PlaybackTime str=" " /> <Play str="" /> <Reverse str="\" /> <Pause str="|" /> <Wait str="0!" /> <Mute str="Lnjp" /> <LiveAudio str=" $$" /> <PlaybackAudio str="$$ " />  <<ConvertToAvi str="AVI | X" /> <NoFindRecord str="yT |t ŵȲ." /> <TimePeriod str="0" /> <SaveTo str="ȥ" /> <BackupDeviceFull str="1 XX t q iȲ. UxX8." /> <SavePath str="ȥ \" /> <Login str="\x" /> <Logout str="\D" /> <PictureSet str=" $" /> <Rotation str="" /> <Normal str="" /> <Mirror str="Ȱ " /> <VerticaFlip str="X " /> <ColorLevel str="" /> <Brightness str="0" /> <Contrast str="D" /> <Sharpness str=" ij" /> <RateControl str="ȡ ȴ" /> <Quality str="" /> <Bitrate str="DtǸ" /> <VideoOffset str="D$ " /> <De-Noise str="xtLj " /> <None str="L" /> <Method str=")" /> <AutoMode str="ٳ ܴ" /> <DayMode str=" ܴ" /> <NightMode str="| ܴ" /> <Base str="0" /> <Picture str="" /> <OutOfRange str=" " /> <SystemClose str="¤\ ̸ ..." /> <On str="0" /> <Off str="D0" /> <Vendor str="pȬ" /> <ModelName str="x" /> <FriendlyName str="ļ" /> <UPnPTraversal str="UPnP " /> <PortRange str="Ӹ " />   ) <ExternalIPAddress str="xƀ IP Ȍ" /> <Information str="" /> <SelOverPlayerMaxCam str="%d tT| !" /> <Event str="tǤ" /> <Event_List str="tǤ ]" /> <Motion str="ٳ" /> <DI str="8 %" /> <DO str="8 %" /> <Event_Schedule_List str="tǤ t ]" /> <Action_List str="ٳ ]" /> <Alarm_Trigger_Type str="LŌ Ѕ" /> <Alarm_Seconds str="LŌ " /> " <Buzzer str="L" /> <UnKnow str="L L" /> <Display_On_CH str="D \" /> <Action_Type str="ٳ Ѕ" /> <ERR_MSG_NO_CAM str="tT|| < X8!" /> <ERR_MSG_NO_EVENT str="tǤ| < X8!" /> <ERR_MSG_NO_EVENT_SCH str="tǤ tD < X8!" /> <ERR_MSG_NO_ACTION str="ٳD < X8!" /> <ERR_MSG_TIME_PERIOD str="$ 0t $X ǵȲ. Ux X8!" /> <ERR_MSG_TIME_CONFILT str="$  t ǵȲ. Ux X8!" /> <WeekDays str="" /> <AlarmSetting str="LŌ $" /> <AlarmCondition str="LŌ " /> <Alarm_True str="" /> <Alarm_False str="Hh" /> <Alarm_Seconds str="LŌ " /> <Alarm_Manual_Stop str="ٳ " /> <Local str="\" /> <DI_S  * etting str="DI $" /> <System_Setting str="¤\ $" /> <Log_Viewer str="\ 0" /> <Event_Log str="tǤ \" /> <Device str="X" /> <Log_Type str="\ Ѕ" /> <Motion_Alarm str="ٳ  LŌ" /> <DI_Alarm str="DI LŌ" /> <Input str="%" /> <Limit_Record str="yT \" /> <Remark str="D" /> <Total str="" /> <HDD_Err_Alarm str="HDD $X LŌ" /> <Disconnect_Alarm str="Ű J LŌ" /> <Schedule_Trigger str=" |" /> <Block_Alarm str="( LŌ" /> <Blur_Alarm str="P׼ LŌ" /> <Camera_Move_Alarm str="tT| tٳ LŌ" /> <Address_Book str="Ȍ]" /> <Phone str="T" /> <E_MAIL str="E-Mail" /> <Notification str="T" /> <SMTP_Config str="SMTP $" /> <SMTP_Server str="" /> <SMTP_Port str="Ӹ" /> <From str="" /> <SendMailWithoutPicture str="  t T| 0" /> <ServerRequireAuthentication str=" xǝ" /> <SSL str="SSLxǝ" /> <Send_Test str=" LѤ¸" /> <FTP_Config str="FTP $" /> <FTP_Server str="" /> <FTP_Port str="Ӹ" /> <Retry str="ij" /> <RecycleDays str=" " /> <Recy  ?cleSize str=" l0" /> <Path str="\" /> <AllowCreateFolder str="m T ̹0" /> <HTTP_Config str="HTTP $" /> <HTTP_IP str="IP" /> " <HTTP_UID str="Ĭ" /> <HTTP_PWD str="T8" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Ȍ" /> <Proxy_UID str="Proxy Ĭ" /> <Proxy_PWD str="Proxy T8" /> <Proxy_Port str="Proxy Ӹ" /> <TCP_Config str="TCP $" /> <TCP_Server str="" /> <TCP_Port str="Ӹ" /> <Alarm_Config str="LŌ $" /> <frame str="" /> <SnapshotInterval str="  " /> <SendInterval str="ȡ " /> <SnapshotTempFolder str="  T" /> <Mail str="T|" /> <Subject str="ȩ" /> <body str="" /> <MS str="MS" /> <second str="" /> <EventDetect str="tǤ " /> <EventForceRecord str="tǤ  yT" /> <EventSetting str="tǤ $" /> <MergeSeconds str="Ѽi " /> <Display str=" t" /> <Division str="`" /> <FullScreen str="ȴ Tt" /> <ResetDIVDefault str="` 0T" /> <CancelFullScreen str="ȴ Tt ͌" /> <Function str="0" /> <SystemManagement str  % ="¤\ " /> <PTZControl str="PTZθd" /> <Volume str="h" /> <Monitor str="Ȳ0" /> <CancelMute str="Lnjp ͌" /> <TwoWayAudioON str=") $$ ‘" /> <TwoWayAudioOFF str=") $$ " /> <Resolution str="tij" /> <Style str="|" /> <Simple str="" /> <Professional str="8" /> <Output str="%" /> <SettoOpen str="0 $" /> <SettoClose str="0 $" /> <Preset str="լK" /> <Zoom str=" " /> <Wide str="@tܴ" /> <Tele str="U" /> <Advanced str=" " /> <IsDeletePreset str="OK | tt լKt  )Ȳ." /> <System_Log str="¤\ \" /> <PTZ_SPEED str="PTZ ij" /> <PTZ_HOME str="PTZ H" /> <PTZ_UP str="PTZ \" /> <PTZ_DOWN str="PTZ DŘ\" /> <PTZ_LEFT str="PTZ |ƽ<\" /> <PTZ_RIGHT str="PTZ $x<\" /> <PTZ_UP_RIGHT str="PTZ $x \" /> <PTZ_UP_LEFT str="PTZ |ƽ \" /> <PTZ_DOWN_LEFT str="PTZ |ƽ DŘ\" /> <PTZ_DOWN_RIGHT str="PTZ $x DŘ\" /> <PTZ_TOUR_GO str="PTZ ,Ҵ ‘" /> <PTZ_TOUR_STOP str="PTZ ,Ҵ " /> <PTZ_FOCUS_UP str="PTZ  +" /> <PTZ_FOCUS_DOWN str="PTZ  -" /> <PTZ  0_IRIS_UP str="PTZ Iris " /> <PTZ_IRIS_DOWN str="PTZ Iris " /> <PTZ_FOCUS_AUTO str="PTZ ٳ " /> <PTZ_IRIS_AUTO str="PTZ ٳ Iris" /> <PTZ_AUTOPAN_START str="PTZ $DtX ‘" /> <PTZ_AUTOPAN_STOP str="PTZ $DtX " /> <PTZ_ZOOM_IN str="PTZ x" /> <PTZ_ZOOM_OUT str="PTZ D" /> <SYS_LOG_SYSTEM_INIT str="¤\ 0T" /> <SYS_LOG_SYSTEM_SHUTDOWN str="¤\ D0" /> <SYS_LOG_USER_LOGIN str="Ɛ \x" /> <SYS_LOG_USER_LOGOUT str="Ɛ \D" /> <SYS_LOG_START_SCH_REC str="t yT ‘" /> <SYS_LOG_END_SCH_REC str="t yT " /> <SYS_LOG_START_SCH_ALARM str="LŌ t ‘" /> <SYS_LOG_END_SCH_ALARM str="LŌ t " /> <SYS_LOG_ENTER_SYS_SETUP str="¤\ $ ‘" /> <SYS_LOG_EXIT_SYS_SETUP str="¤\ $ 0" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="T) t $ ‘" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="T) t $ 0" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="LŌ t $ ‘" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="LŌ t $ 0" /> <SYS_LOG_RTSP_GET_CONNECT str="Ű 8$0" /> <SYS_LOG_RTSP_LOSE_CONNECT str=" 3Ű J" /> <SYS_LOG_SERVER_HTTP_START str="HTTP  ‘" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP  " /> <SYS_LOG_SERVER_RTSP_START str="RTSP  ‘" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP  " /> <SYS_LOG_SERVER_RPB_START str="Ʃ  ‘" /> <SYS_LOG_SERVER_RPB_STOP str="Ʃ  " /> <DiskManagement str="l " /> <DeviceType str="X " /> <Partition str=" X" /> <FileSystem str=" | ¤\" /> <IsPartition str=" XD ̹ Ȳ. Ux X8." /> <Image str="" /> <Brightness str="0" /> <Contrast str="D" /> <Saturation str="Dij" /> <Sharpness str=" ij" /> <Hue str="p" /> <NoSeldesti str="| X8!" /> <NoSelSource str=" ]D X8!" /> <Time_Range str=" |  " /> <Event_Snapshot str="tǤ  " /> <EventSnapshotViewer str="tǤ   0" /> <Event_Time str="tǤ " /> <Event_Type str="tǤ Ѕ" /> <Change_Resolution str="Ȳ0 tij| X ȲL?" /> <Select_All str="ȴ " /> <InitNetowrk str="$l ȴ 0T" /> <InitSystemDate str="  ȴ 0T" /> <InitDis & k str="l ȴ 0T" /> <InitRTSP str="RTSP ȴ 0T" /> <NoVideo str="8 L" /> <Modify str="" /> <Display str="\" /> <Mount str="Ű" /> <Unmount str="Ű J0" /> <EditEmpty str="$t ,x Ux X8!" /> <Account str="Ĭ" /> <FindListLog str="%d  tX yT| >XŵȲ , < yT %d|(D) iȲ.." /> <Trigger_Interval_Seconds str="  " /> <Alarm_Always str="m LŌ" /> <LowFPS str="@ DtǸ FPS" /> <WithFPS str="@ t" /> <ShowPW str="T8 0" /> <SelOverMaxPlayHours str="%d  t 1" /> <SelectedCamera str="tT| " /> <Codec str="Tq" /> <Switchto str="X" /> <Filter str="D0" /> <AutoSettingNote str="D0 D % Xp P iȲ." /> <TemplateSetting str="\ տ $" /> <SearchByEvent str="tǤ " /> <Control str="θd" /> <SwitchCamera str="tT| X" /> <Preview str="0" /> <SequentialSearch str="Sequential Search" /> <Split str="Split" /> <PreSearch str="Pre Search" /> <SeekTo str="Seek To" /> <ShowInformation str="Show Information" /> <Bitrate_Log str="Bitrate Log" />  <Save str="Save" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting"/> <NotConfigured str="Not Configured"/> <Application str="Application"/> <NameOrMailEmpty str="Name or E-Mail is empty"/> <ONVIF_Auth str="ONVIF Authentication"/> <PIR_Alarm str="PIR Alarm"/> <CameraTamper str="Camera Tamper"/> <AudioDetection str="Audio Detection"/> <AutoSwitch str="Auto Switch"/> <CancelAutoSwitch str="Cancel Auto Switch"/> <MailRepeat str="You add the same E-Mail. Please change it!"/> <SMART str="S.M.A.R.T Status"/> <OVERALL str="Over all"/> <PASSED str="PASSED"/> <FAILED str="FAILED"/> <Raw_Read_Error_Rate str="Raw Read Error Rate"/> <Throughput_Performance str="Throughput Performance"/> <Spin_Up_Time str="Spin Up Time"/> <Start_Stop_Count str="Start Stop Count"/> <Reallocated_Sector_Ct str="Reallocated Sectors Count"/> <Seek_Error_Rate str="Seek Error Rate"/> <Seek_Time_Performance str="Seek T  ime Performance"/> <Power_On_Hours str="Power On Hours"/> <Spin_Retry_Count str="Spin Retry Count"/> <Calibration_Retry_Count str="Calibration Retry Count"/> <Power_Cycle_Count str="Power Cycle Count"/> <Power_Off_Retract_Count str="Power Off Retract Count"/> <Load_Cycle_Count str="Load Cycle Count"/> <Temperature_Celsius str="Temperature Celsius"/> <Reallocated_Event_Count str="Reallocated Event Count"/> <Current_Pending_Sector str="Current Pending Sector"/> <Offline_Uncorrectable str="Offline Uncorrectable"/> <UDMA_CRC_Error_Count str="UDMA CRC Error Count"/> <Multi_Zone_Error_Rate str="Multi Zone Error Rate"/> <SMART_RAW_VALUE str="Raw Value"/> <SMART_WORST str="Reference"/> <SMART_Event str="HDD S.M.A.R.T"/> <DisplayRatio str="Display Ratio"/> <FitWindow str="Fit Window"/> <KeepRatio str="Keep Ratio"/> <Joystick str="Joystick"/> <Joystick_Information str="Joystick Information"/> <Joystick_Model str="Joystick Model"/> <Axis_Count str="Axis Count"/> <Button_Co  unt str="Button Count"/> <Axis_X str="Axis X Value"/> <Axis_Y str="Axis Y Value"/> <Axis_Z str="Axis Z Value"/> <Buttons_Status str="Buttons Status"/> <Joystick_Buttons_Setting str="Joystick Buttons Setting"/> <Button str="Button"/> <Next_Division str="Next Division"/> <Previous_Division str="Previous Division"/> <Next_Window str="Next Window"/> <Previous_Window str="Previous Window"/> <Switch_Division_One str="Switch Division One"/> <Axis_Z_ID str="Axis Z ID"/> <RAID_Err_Alarm str="RAID Error Alarm"/> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Ű J@"/> <ConnectFail str="Ű ("/> <GetSettingValueErr str="$t ǻ ŵȲ!"/> <Refresh str="\hD X8!" /> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="1. 0$ 8"/> <Converting str="X. 0$ 8"/> <ShowDate str=" t0"/> <ShowTime str=" t0"/> <Subtitle str="Subtitle"/> <PreSecond str="L "/> <PreFrame str="t "/> <NextSecond str="t "/> <NextFrame str="L "/> <LowBitrate str="Low Bitrate"/> <DigitalZoom str="8 " /> <MotionSearch str="ٳ  :" /> <TimeSplit str=" `" /> <ShowDetailWindow str="8 Tt 0" /> <FirstPage str="̘t" /> <PrePage str="t t" /> <NextPage str="L t" /> <LastPage str="ȹɹ t" /> <DetailPicture str="8 " /> <SelectTime str=" " /> <ErrStartEndTm str="‘  ̸  $X ǵȲ." /> <SearchSet str=" $" /> <ShowSearchImage str=" t 0" /> <ShowDetectMark str=" 0" /> <DetectInterval str=":" /> <Exit str="0" /> <Grayscale str="Q1 X" /> <Softness str="ܴ" /> <Reset str="K" /> <Print str="x" /> <RetryAgain str="  ij X8!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str=") L !"/> <Weekly str=""/> <SAVEAS str="Save As..."/> <Send_To str="0"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="լ Tt T \X0"/> <ACTION_DESC_MAIL str="tǤ  T| 0"/> <ACTION_DESC_VOICE str="tǤ 0 LŌ X0"/> <ACTION_DESC_DO str= "tǤ  8 % 8 0"/> <ACTION_DESC_FTP str="FTP \ t 0"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="t ٳ "/> <EVENT_DESC_BLOCK str="tT|  "/> <EVENT_DESC_BLUR str="tT| P׼ "/>  <EVENT_DESC_CAM_MOVE str="tT| tٳ "/> <EVENT_DESC_DI str="8 % "/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="LŌ tǤ "/> <CREATE_NEW_FOLDER str="T ̹0"/> <CHANGE_NAME str="tDŽ "/> <TIME_SET_ERROR str=" $ $X,  $D Uxt 8"/> <Export str="%"/> <SEL_VIEW_CH str="tT| "/> <SYSTEM_UPDATEMESSAGE str= "Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str=" Ȳ0 ‘"/> <UPDATE_FAIL str="$ ptǸ| `  ŵȲ. ij Ȳ."/> <DI_REC_TRIGGER str="DI yT :"/> <PASTE str="#0"/> <PASTE_MON_FRI str="Ɣ|ǀ0 |L #0"/> <PASTE_SAT_SUN str="є|ǀ0 |ǔ|L #0"/> <PASTE_ALL_CAM str=" tT| #0"/> <APPLY_ALL str=" $ U"/> <UN_SELECT_ALL str="ȴ ͌"/> <GET_  PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="$ $X. 0<\ $ iȲ!"/> <ERR_SETUP str="$ $X. Ux Ȳ."/> <DEL_CAM_COFIRM str="'%s' | ]  XՠȲL?"/> <ADD_CAM_ERR_ALREADY_HAS str="'%s' ¸ tȬ iȲ. Uxt 8"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="  0"/> <SHOW_PB_CAM str="ȥ  0"/> <DELETE_CAM str="Tt 0"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>  *lang_traditional_chinese.xmlėRR̗R )<root> <Font Name="wenquanyi" /> <LanguageName str="A~Ԛ-Ne" /> <LanguageNameEng str="Traditional Chinese" /> <Sch_Monitor str="q_c z_UR" /> <Alarm_Monitor str="f1Xc z_UR" /> <Week0 str="fge" /> <Week1 str="fgN" /> <Week2 str="fgN" /> <Week3 str="fg N" /> <Week4 str="fgV" /> <Week5 str="fgN" /> <Week6 str="fgmQ" /> <WeekS0 str="fge" /> <WeekS1 str="fgN" /> <WeekS2 str="fgN" /> <WeekS3 str="fg N" /> <WeekS4 str="fgV" /> <WeekS5 str="fgN" /> <WeekS6 str="fgmQ" /> <Disk_Free str="iRzz" /> <Error str="/" /> <LoginError str="{veQ/,l gdk3^_b[x/" /> <DeviceInfo str="݈n o`" /> <DeviceTitle str="݈n T1z" /> <SoftwareVersion str="ߎԚHr,g" /> <Characters str="W[CQ" /> <DateTimeInfo str="egBfnj " /> <CurrentDate str="s(Weg" /> <CurrentTime str="s(WBf" /> <Adjust str="!h" /> <Manual str="KbR" /> <SyncNTP str="TNTP Tek" /> <Setting str="-[" /> <NTPServer str="NTP:O ghV" /> <Test str=",nf" /> <NTPSyncInterval str="NTP Tek" /> <Hour str="\Bf" /> <Timezone str="Bf@S" /> <Timezone0 st &r="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (}XbKQ\, tRg\)" /> <Timezone3 str="GMT-11 (-N\, idN)" /> <Timezone4 str="GMT-10 (YZ7Y, ?Yu3u\)" /> <Timezone5 str="GMT-09 (?beR)" /> <Timezone6 str="GMT-08 (be}Re, ёq\, nT)" /> <Timezone7 str="GMT-07 (aSR)R, 9N[O, }VnW)" /> <Timezone8 str="GMT-06 (RT, Tbe, XT, egY>ro)" /> <Timezone9 str="GMT-05 (S])" /> <Timezone10 str="GMT-05 (}}, Y+PY/n^, v)" /> <Timezone11 str="GMT-04 (]b-W)" /> <Timezone12 str="GMT-04 (zf)R)" /> <Timezone13 str="GMT-04 (Ymyr, Yte)" /> <Timezone14 str="GMT-03:30 (}-)" /> <Timezone15 str="GMT-03 (], VO)" /> <Timezone16 str="GMT-02 (<\N, 'Y m-N)" /> <Timezone17 str="GMT-01 (N>r\, }_҉\)" /> <Timezone18 str="GMT (gg, ̑e,g, +Pfe, KQŖ}KQ)" /> <Timezone19 str="GMT+01 (?Yeyr9N, gg, , e_T>rid, l)" /> <Timezone20 str="GMT+02 (ŖxQ, k>rW, OefW^>r, ψR)" /> <Timezone21 str="GMT+02 (WS)" /> <Timezone22 str="GMT+02 (NrR)" /> <Timezone23 str="GMT+02 (Ξ]Z)" /> <Timezone24 str="GMT+02 (Xe)RN)" /> <Timezone25 str %="GMT+03 (ey, )RŖ_)" /> <Timezone26 str="GMT+03 ( ObKQ)" /> <Timezone27 str="GMT+03:30 ( Og)" /> <Timezone28 str="GMT+04 (?^Tk, ]^)" /> <Timezone29 str="GMT+04:30 (U^>r)" /> <Timezone30 str="GMT+05 ( Oe-]_, aSbGY^, TXNy^)" /> <Timezone31 str="GMT+05:30 (_[, R>rTT{, e_̑)" /> <Timezone32 str="GMT+05:45 (R_n)" /> <Timezone33 str="GMT+06 (e/O)RN, (geKQ)" /> <Timezone34 str="GMT+06:30 (NIQ)" /> <Timezone35 str="GMT+07 (f7, lgQ, ŖRT)" /> <Timezone36 str="GMT+08 (SN, /n, Nwm, eRaW, S)" /> <Timezone37 str="GMT+09 ("oW, 'Y*, -gL^, qgN)" /> <Timezone38 str="GMT+09:30 (T>re)" /> <Timezone39 str="GMT+09:30 (?_ _)" /> <Timezone40 str="GMT+10 ( ]yr)" /> <Timezone41 str="GMT+10 (NWWb, X>r,g, ꖨh)" /> <Timezone42 str="GMT+11 (@b\)" /> <Timezone43 str="GMT+11:30 (yKQ)" /> <Timezone44 str="GMT+12 (gYKQ-, ZH)" /> <Timezone45 str="GMT+12 (eo)" /> <Timezone46 str="GMT+12 (*X[RJS\)" /> <Timezone47 str="GMT+12 (Gk>r\)" /> <Timezone48 str="GMT+13 (onRTX, R^?ml)" /> <Timezone49 str="GMT+13:45 (gTXY\" /> <DST str 0 ="eIQ{}Bf" /> <Disable str="\P(u" /> <Enable str="_U(u" /> <DSTStart str="eIQ{}BfY" /> <DSTEnd str="eIQ{}BfP}_g" /> <DSTOffset str="eIQ{}BfOP] <AutoLogin str="R{veQ" /> <UID str="3^_" /> <PWD str="[x" /> <System str="|q}" /> <AutoFullScreen str="RhQU^" /> <Language str="" /> <Audio str="r" /> <InputGain str="8eQXv" /> <OutputGain str="8QXv" /> <KeyinNTPAddr str="ˊ8eQNTP:O ghVMOn!" /> <Success str="bR" /> <Fault str="1YWe" /> <OK str="x" /> <Cancel str="Sm" /> <SetDateTime str="-[egBf" /> <Date str="eg" /> <Time str="Bf" /> <AutoSetting str="R-[" /> <CameraName str="eq__j T1z" /> <ModelName str="W_" /> <IPAddress str="IPMO@W" /> <HTTPPort str="HTTPW" /> <RTSPPort str="RTSPW" /> <Camera str="eq__j" /> <Schedule str="c z" /> <Network str="}" /> <User str="O(u" /> <MotionDetection str="MOyuP,n" /> <Snapshot str="_gq" /> <Maintenance str="}w" /> <Add str="eX" /> <Delete str="*Rd" /> <Update str="fe" /> <Clear str="nd" /> <Search str="d \" /> <AutoDetect str= *"RuP,n" /> <Detect str="uP,n" /> <MACAddress str="MACMO@W" /> <Configuration str="Mn" /> <Copy str="" /> <StartTime str="YBf" /> <EndTime str="P}_gBf" /> <RecordType str="q_!j_" /> <PreAlarm str="HQf1X" /> <PostAlarm str="f1X_q_" /> <RTC str="hQBfq_" /> <DIDetect str="DI uP,n" /> <TimeSelErr str="Bf@Sk Nckx!" /> <NoSelSch str="ˊxdc z" /> <Warning str="fJT" /> <WeekCopyToAll str="WY(u0RvQNc z" /> <DHCP str="RS_IP(DHCP)" /> <SubnetMask str="P[}ni" /> <Gateway str="-S" /> <DNS_DHCP str="RS_DNS" /> <PrimaryDNS str="ca(uDNS:O ghV" /> <SecondaryDNS str="vQNDNS:O ghV" /> <PPPoE str="PPPoE" /> <Status str="rKa" /> <Start str="_UR" /> <Stop str="\Pbk" /> <Server str=":O ghV" /> <IPUsed str="dkIPMO@WO(u-N" /> <IPNoUsed str="dkIPMO@WSNO(u" /> <Group str="D}" /> <Description str="c" /> <ConfirmPWD str="x[x" /> <LiveView str="sSBfq_P" /> <Playback str="V>e" /> <Record str="q_" /> <PTZ str="PTZ" /> <TwoWayAudio str="ٖT" /> <CheckConfirmPWD str="ˊ͑ex[x!" /> <UIDEmpty str="ˊ8eQ3^_!" /> <UID ? Repeat str="3^_͑ ˊ͑e8eQ!" /> <NoSelUID str="ˊxd3^6b!" /> <MotionID str="MOy}_" /> <Name str=" T1z" /> <Included str="S+T" /> <Excluded str="cd" /> <ObjectSize str="irN:\[" /> <Sensitivity str="HOe^" /> <NoSelCamera str="ˊxdeq__j!" /> <OverMaxMotion10 str="gYS10 PMOy@SJX!" /> <NoSelMotion str="ˊxdMOy@SJX!" /> <MotionSettingEnpty str="ˊkXnMOySxe" /> <SourceSnapshotList str="On_gqRh" /> <SourceSnapshotPreview str="On_gqo:y" /> <DestinationSnapshotList str="vv_gqRh" /> <DestinationSnapshotPreview str="vv_gqo:y" /> <NoFindSD str="ˊceQSDaS" /> <NoSelImg str="ˊxdWGr!" /> <SameSnapshotImgName str="j T͑,\g˄dkjHh!" /> <IsAutoSetting str="/f&Ts(WWLR-[?" /> <GetParamError str="S_Sxe1YWe!" /> <CameraNameEmpty str="ˊkXeQeq__j T1z" /> <IPAddressEmpty str="ˊkXeQIPMO@W!" /> <UIDEmpty str="ˊkXeQ3^_!" /> <HttpPortEmpty str="ˊkXeQHTTPW!" /> <CameraNameTheSame str="eq__j T1zv T!" /> <CamParam str="eq__jSxe" /> <Profile str=" <FPS str="ky5_xe" /> <Protocol str=" TS[" /> <EnableAudio str="_U(ur" /> <AudioRecord str="_U(u" />  < <InputError str="8eQ/" /> <DefaultSetting str="b`_- <FactoryDefaultSetting str="Q^- <Default str="-" /> <BackupSetting str="PN-[j" /> <Backup str="PN" /> <RestoreSetting str="S-[j" /> <Restore str="S" /> <FirmwareUpgrade str="̗Ԛfe" /> <Upgrade str="fe" /> <Browse str="p" /> <SystemRestart str="|q}͑e_UR" /> <Restart str="͑e_UR" /> <HDInformation str="lxxnj " /> <SDInformation str="SDaSnj " /> <TotalCapacity str="=~[ϑ" /> <FreeCapacity str="iR[ϑ" /> <UsedCapacity str="O(u[ϑ" /> <UsedPercent str="O(ukO" /> <Format str=" <NoFind str="!q" /> <NoMount str="lc " /> <IsDefaultSetting str="|q}\gV_0RQ^- <NoBackupDevice str="ˊceQPN݈n" /> <NoFindConfigFile str="~b N0R-[j" /> <ConfigFile str="-[j" /> <ConfigFileVerErr str="-[jHr,g/" /> <IsRestart str="|q}\g͑e_UR,/f&T|~~WL?" /> <NoFindFirmware str="~b N0RNUO̗Ԛ" /> <FirmwareFile str="̗Ԛj" /> <IsFormatHD str="|q}\WL <OpenFirmwareUpgradeLogErr str="!ql_Ufirmware_upgrade.log" /> <Pl )ayback str="V>e" /> <PlaybackTime str="V>eBf" /> <Play str="d>e" /> <Reverse str="Pd" /> <Pause str="f\P" /> <Wait str="ˊ zP!" /> <Mute str="\" /> <LiveAudio str="s4X" /> <PlaybackAudio str="V>e" /> <ConvertToAvi str="IbAVI" /> <NoFindRecord str="~b N0R" /> <TimePeriod str="Bf@Sk" /> <SaveTo str="2QX[0R" /> <BackupDeviceFull str="ˊjgPN݈nzz/f&T Y" /> <SavePath str="2QX[_" /> <Login str="{veQ" /> <Logout str="{vQ" /> <PictureSet str="q_P-[" /> <Rotation str="eI" /> <Normal str="ck8^" /> <Mirror str="\" /> <VerticaFlip str="WvI" /> <ColorLevel str="i_^" /> <Brightness str="N^" /> <Contrast str=" \k" /> <Sharpness str=")R^" /> <RateControl str="Amϑc6R" /> <Quality str="T" /> <Bitrate str="MOCQs" /> <VideoOffset str="q_PMOy" /> <De-Noise str="Sdܖ " /> <None str="!q" /> <Method str="el" /> <AutoMode str="R!j_" /> <DayMode str="e!j_" /> <NightMode str="Y!j_" /> <Base str="Wy" /> <Picture str="WP" /> <OutOfRange str="Q{ W" /> <SystemClose str="|q}ܕ-N!" /> <On str )="_U" /> <Off str="ܕ" /> <Vendor str="TLr" /> <ModelName str="W_" /> <FriendlyName str="SU T1z" /> <UPnPTraversal str="UPnPz2kpFr" /> <PortRange str="W{ W" /> <ExternalIPAddress str=" \Y}MOn" /> <Information str=" o`" /> <SelOverPlayerMaxCam str="xdN%deq__j" /> <Event str="NN" /> <Event_List str="NNRh" /> <Motion str="RKauP,n" /> <DI str="xeMO8eQ" /> <DO str="xeMO8Q" /> <Event_Schedule_List str="NNc z" /> <Action_List str="f1XUnRh" /> <Alarm_Trigger_Type str="|v1XhN" /> <Alarm_Seconds str="|v1Xyxe" /> <Buzzer str="hV" /> <UnKnow str=" Nf" /> <Display_On_CH str="o:ye;S" /> <Action_Type str="f1X^%R" /> <ERR_MSG_NO_CAM str="ˊHQxdeq__jb,g_j!" /> <ERR_MSG_NO_EVENT str="ˊHQxdNN!" /> <ERR_MSG_NO_EVENT_SCH str="ˊHQxdN PNNc z!" /> <ERR_MSG_NO_ACTION str="ˊHQxdN PNNUn!" /> <ERR_MSG_TIME_PERIOD str="Bf-[ g,ˊ͑ex-[ <ERR_MSG_TIME_CONFILT str="Bf-[]z,ˊ͑ex-[ <WeekDays str="1-[" /> <AlarmSetting str="f1X-[" /> <AlarmCondition str="|v1XrKa" /> <Alarm_True str="&{T" /> <Alarm_False str=  < "ST" /> <Alarm_Seconds str="|v1Xyxe" /> <Alarm_Manual_Stop str="KbR\Pbk" /> <Local str=",g_j" /> <DI_Setting str="DI -[" /> <System_Setting str="|q}-[" /> <Log_Viewer str="j]wQ" /> <Event_Log str="NN" /> <Device str="݈n" /> <Log_Type str=".z^" /> <Motion_Alarm str="MOyuP,n|v" /> <DI_Alarm str="xeMO8eQ|v" /> <Input str="8eQ" /> <Limit_Record str="P6RF{xe" /> <Remark str="P;" /> <Total str="hQ" /> <HDD_Err_Alarm str="lxx/|v" /> <Disconnect_Alarm str="e}|v" /> <Schedule_Trigger str="c z|v" /> <Block_Alarm str="niuP,n|v" /> <Blur_Alarm str="1Y&quP,n|v" /> <Camera_Move_Alarm str="-MOy|v" /> <Address_Book str=" " /> <Phone str="q" /> <E_MAIL str="P[N" /> <Notification str="f1Xw" /> <SMTP_Config str="SMTP-[" /> <SMTP_Server str=":O ghV" /> <SMTP_Port str=" W" /> <From str="[N" /> <SendMailWithoutPicture str="[O ND6^Wj" /> <ServerRequireAuthentication str=":O ghVI" /> <SSL str=":O ghV[hQ#}(SSL)" /> <Send_Test str="[N,nf" /> <FTP_Config str="FTP-[" /> <FTP_Server str=";N_j  ? " /> <FTP_Port str=" W" /> <Retry str="1YWe͑f!kxe" /> <RecycleDays str="OYu)Yxe" /> <RecycleSize str="Recycle'Y\" /> <Path str="_" /> <AllowCreateFolder str="AQ1^znje>Y" /> <HTTP_Config str="HTTP-[" /> <HTTP_IP str="IP" /> <HTTP_UID str="3^_" /> <HTTP_PWD str="[x" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Nt:O ghVMOn" /> <Proxy_UID str="Nt:O ghV3^_" /> <Proxy_PWD str="Nt:O ghV" /> <Proxy_Port str="Nt:O ghVW" /> <TCP_Config str="TCP-[" /> <TCP_Server str=":O ghV" /> <TCP_Port str=" W" /> <Alarm_Config str="f1X-[" /> <frame str="5_" /> <SnapshotInterval str="k5_Wg\" /> <SendInterval str="P" /> <SnapshotTempFolder str="WGrfX[nje>Y" /> <Mail str="O{" /> <Subject str=";Ne" /> <body str="gQ[" /> <MS str="ky" /> <second str="y" /> <EventDetect str="NNuP,n" /> <EventForceRecord str="NN7_6Rq_" /> <EventSetting str="NN-[" /> <MergeSeconds str="TuOyxe" /> <Display str="o:y" /> <Division str="RrR" /> <FullScreen str="hQU^" /> <ResetDIVDefault str="b`_RrR- <CancelFullScreen str  *="SmhQU^" /> <Function str="R" /> <SystemManagement str="|q}{t" /> <PTZControl str="PTZ c6R" /> <Volume str="ϑ" /> <Monitor str="vc" /> <CancelMute str="Sm\" /> <TwoWayAudioON str="YٖT" /> <TwoWayAudioOFF str="\PbkٖT" /> <Resolution str="㉐g^" /> <Style str="^W" /> <Simple str="!|f" /> <Professional str="\mi" /> <Output str="8Q" /> <SettoOpen str="-b" /> <SettoClose str="-b" /> <Preset str="-ޞ" /> <Zoom str="-.~>e" /> <Wide str="^҉" /> <Tele str="g`" /> <Advanced str="2" /> <IsDeletePreset str=" c N'x'\g*Rd-ޞ." /> <System_Log str="|q}" /> <PTZ_SPEED str="PTZ ^" /> <PTZ_HOME str="PTZ Vwޞ" /> <PTZ_UP str="PTZ Ny" /> <PTZ_DOWN str="PTZ Ny" /> <PTZ_LEFT str="PTZ ]y" /> <PTZ_RIGHT str="PTZ Sy" /> <PTZ_UP_RIGHT str="PTZ S Ny" /> <PTZ_UP_LEFT str="PTZ ] Ny" /> <PTZ_DOWN_LEFT str="PTZ ] Ny" /> <PTZ_DOWN_RIGHT str="PTZ S Ny" /> <PTZ_TOUR_GO str="PTZ -]*Y" /> <PTZ_TOUR_STOP str="PTZ -]*\Pbk" /> <PTZ_FOCUS_UP str="PTZ \&qXR" /> <PTZ_FOCUS_DOWN str  0 ="PTZ \&qn\" /> <PTZ_IRIS_UP str="PTZ IQWXR" /> <PTZ_IRIS_DOWN str="PTZ IQWn\" /> <PTZ_FOCUS_AUTO str="PTZ R \&q" /> <PTZ_IRIS_AUTO str="PTZ RIQW" /> <PTZ_AUTOPAN_START str="PTZ R]*Y" /> <PTZ_AUTOPAN_STOP str="PTZ R]*\Pbk" /> <PTZ_ZOOM_IN str="PTZ >e'Y" /> <PTZ_ZOOM_OUT str="PTZ .~\" /> <SYS_LOG_SYSTEM_INIT str="|q}RYS" /> <SYS_LOG_SYSTEM_SHUTDOWN str="|q}ܕ" /> <SYS_LOG_USER_LOGIN str="O(u{veQ" /> <SYS_LOG_USER_LOGOUT str="O(u{vQ" /> <SYS_LOG_START_SCH_REC str="_URq_c z" /> <SYS_LOG_END_SCH_REC str="P}_gq_c z" /> <SYS_LOG_START_SCH_ALARM str="_URf1Xc z" /> <SYS_LOG_END_SCH_ALARM str="P}_gf1Xc z" /> <SYS_LOG_ENTER_SYS_SETUP str="2eQ|q}-[" /> <SYS_LOG_EXIT_SYS_SETUP str="▋|q}-[" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="2eQq_c z-[" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="▋q_c z-[" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="2eQf1Xc z-[" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="▋f1Xc z-[" /> <SYS_LOG_RTSP_GET_CONNECT str="rs_#}" /> <SYS_LOG_RTSP_LOSE_CONNECT str="1YS#}" /> <SYS_LOG_SERVER_HTTP_START str="  %HTTP:O ghV_UR" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP:O ghV\Pbk" /> <SYS_LOG_SERVER_RTSP_START str="RTSP:O ghV_UR" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP:O ghV\Pbk" /> <SYS_LOG_SERVER_RPB_START str="Remote`zV>e:O ghV_UR" /> <SYS_LOG_SERVER_RPB_STOP str="Remote`zV>e:O ghV_UR\Pbk" /> <DiskManagement str="xx{t" /> <DeviceType str="݈n^W" /> <Partition str="R@S" /> <FileSystem str="jHh|q}" /> <IsPartition str="|q}\͑e^zR@S, ˊx/f&T|~~WL" /> <Image str="q_P" /> <Brightness str="N^" /> <Contrast str=" \k" /> <Saturation str="i_^" /> <Sharpness str="q_P)R" /> <Hue str="r" /> <NoSeldesti str="ˊxdvv0W!" /> <NoSelSource str="ˊxdOnRh!" /> <Time_Range str="jHhBf{ W" /> <Event_Snapshot str="NN_gq" /> <EventSnapshotViewer str="NN_gqj" /> <Event_Time str="NNBf" /> <Event_Type str="NN.z^" /> <Change_Resolution str="㉐g^]f,/f&TOYu-[?" /> <Select_All str="hQx" /> <InitNetowrk str="}!jD}RYS" /> <InitSystemDate str="egBf!jD}RYS" /> <InitDisk str="lxxRYS" /> <InitRTSP str="RTSPRYS" /> <NoVideo str="l gq_P" /> <Modify str="O9e &" /> <DisplayCount str="o:y=~xe" /> <Mount str="c " /> <Unmount str="xS " /> <EditEmpty str="ˊxkMOgQ[/f&Tckx!" /> <Account str="3^_" /> <FindListLog str="~b0RN %d F{, Po:yMR %d F{" /> <Trigger_Interval_Seconds str="|vyxe" /> <Alarm_Always str="=~/f|v1X" /> <LowFPS str="NOMOCQsky5_xe" /> <WithFPS str="ky5_xev T" /> <ShowPW str="o:y[x" /> <SelOverMaxPlayHours str="xdN%d\Bf" /> <SelectedCamera str="]xdeq__j" /> <Codec str="}x" /> <Switchto str="Rc0R" /> <Filter str="{x" /> <AutoSettingNote str="ˊ8eQ{xhNb}czz}v2LhQd \" /> <TemplateSetting str="{,g-[" /> <SearchByEvent str="ONNd \" /> <Control str="c6R" /> <SwitchCamera str="Rceq__j" /> <Preview str="p" /> <SequentialSearch str="_^d \" /> <Split str="RrR" /> <PreSearch str="MR!kd \" /> <SeekTo str="y" /> <ShowInformation str="o:y o`" /> <Bitrate_Log str="MOCQs" /> <Save str="2QX[" /> <PlaybackControlPad str="`Oc6RS" /> <FormatFault str=" <LowBitrateSetting str="NOMOCQs-["/> <NotConfigured str="*gRM"/> <Application str="a(u"/> <Name 3 OrMailEmpty str=" T1zbP[Nzz}v"/> <ONVIF_Auth str="ONVIFI"/> <PIR_Alarm str="}Y}uP,n"/> <CameraTamper str="q_P1YHe"/> <AudioDetection str="ruP,n"/> <AutoSwitch str="RS"/> <CancelAutoSwitch str="SmRS"/> <MailRepeat str="EMail]X[(W0ˊ͑-EMail!"/> <SMART str="lxxrKa"/> <OVERALL str="=~"/> <PASSED str="N"/> <FAILED str="/"/> <Raw_Read_Error_Rate str="xedS/s"/> <Throughput_Performance str="X[SHe"/> <Spin_Up_Time str="xv_URBf(ms)"/> <Start_Stop_Count str="_UR/\Pbkxe"/> <Reallocated_Sector_Ct str="͑nSectorsxe"/> <Seek_Error_Rate str=" \~b/s"/> <Seek_Time_Performance str=" \~bs^GWBf"/> <Power_On_Hours str="_U(u\Bf"/> <Spin_Retry_Count str="_UR͑fxe"/> <Calibration_Retry_Count str="!hn͑fxe"/> <Power_Cycle_Count str="n_URܕ!kxe"/> <Power_Off_Retract_Count str="n_xkxe"/> <Load_Cycle_Count str=" eQ/xS xe"/> <Temperature_Celsius str="n^(el)"/> <Reallocated_Event_Count str="͑eRMxe"/> <Current_Pending_Sector str="vuMR\PbkSectorxe"/> <Offline_Uncorrectable str="!qlOckSectorxe"/> <UDMA_CRC_Error_Count st r="UDMA CRC/xe"/> <Multi_Zone_Error_Rate str="Y@SW/s"/> <SMART_RAW_VALUE str="s <SMART_WORST str="S <SMART_Event str="lxx S.M.A.R.T"/> <DisplayRatio str="o:ykO"/> <FitWindow str="kXnz"/> <KeepRatio str="OckO"/> <Joystick str="c6Rv"/> <Joystick_Information str="c6Rvnj "/> <Joystick_Model str="c6RvW_"/> <Axis_Count str="eTxeϑ"/> <Button_Count str=" cxeϑ"/> <Axis_X str="X <Axis_Y str="Y <Axis_Z str="Z <Buttons_Status str=" crKa"/> <Joystick_Buttons_Setting str="c6Rv c-["/> <Button str=" c"/> <Next_Division str="Rc NN.zRrR"/> <Previous_Division str="Rc NN.zRrR"/> <Next_Window str="Rc NN Pz"/> <Previous_Window str="Rc NN Pz"/> <Switch_Division_One str="RcURrR"/> <Axis_Z_ID str="ZN_"/> <RAID_Err_Alarm str="RAID/|v"/> <Create str="^z"/> <Detail str="0}{"/> <Rebuild str="͑^"/> <EraseDisk str="dkR\O\nzzlxx Nv@b gnje,ˊx/f&T|~~WL"/> <FishEyeCtrl str="Z <FishEyeDispMode str="o:y!j_"/> <FishEyePosition str="[݈e_"/> <FishEyeWin str="z"/> <Invalid  Firmware str="!qHev̗Ԛ!"/> <ConnectLost str="1YS#}"/> <ConnectFail str="#}1YWe"/> <GetSettingValueErr str="!qlS_-[ <Refresh str="ˊ͑etet"/> <IE_Protected_Open str="IEvOw!j_]_U ˊbdk}@WReQIEvON}z0"/> <Backuping str="PN-N ˊ z_0"/> <Converting str="Ij-N ˊ z_0"/> <ShowDate str="o:yeg"/> <ShowTime str="o:yBf"/> <Subtitle str="W[U^"/> <PreSecond str=" NNy"/> <PreFrame str=" NN5_"/> <NextSecond str=" NNy"/> <NextFrame str=" NN5_"/> <LowBitrate str="NOMOCQs"/> <DigitalZoom str="xeMO>e'Y"/> <MotionSearch str="R\OuP,n"/> <TimeSplit str="BfRk" /> <ShowDetailWindow str="o:y>e'Yz" /> <FirstPage str=",{N" /> <PrePage str="MRN" /> <NextPage str=" NN" /> <LastPage str="g_N" /> <DetailPicture str="s0}WGr" /> <SelectTime str="xdBfk" /> <ErrStartEndTm str="YBfbP}_gBf/" /> <SearchSet str="d \-[" /> <ShowSearchImage str="o:yd \q_P" /> <ShowDetectMark str="o:yuP,nj" /> <DetectInterval str="uP,n" /> <Exit str="▋" /> <Grayscale str="pp" /> <Softness str="s^nS" /> <Reset str="͑-" /> <Print str="RpS" /> <R  etryAgain str="ˊ z_Qf" /> <FirmwareUpgrade_msg str="̗Ԛfe[b,ˊ͑e#}"/> <SYSTEM_TIME_MSG str="O9eBf\͑_Uq_, /f&T|~~?"/> <TWO_WAYAUDIOUSED str="ٖTck(WO(u-N"/> <Weekly str="1c z"/> <SAVEAS str="SX[..."/> <Send_To str="6eN"/> <ACTION_DESC_SNAPSHOT str="vuNN|vBfgqv"/> <ACTION_DESC_RECORD str="vuNN|vBfq_"/> <ACTION_DESC_DISPLAY str="o:y o`esSBfkub N"/> <ACTION_DESC_MAIL str="vuNN|vBf,[|vwN"/> <ACTION_DESC_VOICE str="vuNN|vBf,d>efJT"/> <ACTION_DESC_DO str="vuNN|vBf,|vxeMO8Q"/> <ACTION_DESC_FTP str=" NPWGr0RFTP:O ghV"/> <ACTION_DESC_BUZZER str="vuNN|vBf,hV\OR"/> <ACTION_DESC_TCP str=" NPWGr0RTCP:O ghV"/> <ACTION_DESC_HTTP str=" NPWGr0RHTTP:O ghV"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="uP,nq_P/f&T gR"/> <EVENT_DESC_BLOCK str="uP,n-puirn="/> <EVENT_DESC_BLUR str="-&qݍ1Y&q"/> <EVENT_DESC_CAM_MOVE str="-eTMOy"/> <EVENT_DESC_DI str="uP,nDIrKa"/> <EVENT_DESC_HDD_ERR str="uP,nlxx/"/> <EVENT_DESC_DISCONNECT str="uP,neq__je}"/> <EVENT_DESC_FORCE str="uP,nc z|v"/> <EVENT_DESC_PIR str="}Y}uP,n"/> <EVENT_ DESC_TAMPER str="q_P1YHe"/> <EVENT_DESC_AUDIO_DETECTION str="ruP,n"/> <ALARM_EVENT_SELECT str="f1XNNxd"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="^zenje>Y"/> <TIME_SET_ERROR str="Bf-[ g,ˊ͑exBf-["/> <Export str="/SQ"/> <SEL_VIEW_CH str="xdo:y;S"/> <SYSTEM_UPDATEMESSAGE str="fe,g_j-[,ˊe'Y}40y_͑e#}"/> <START_MONITOR_ALL str="_URhQvc"/> <UPDATE_FAIL str="!ql NP-[,ˊ z_Qf"/> <DI_REC_TRIGGER str="f1Xq_|vOd:"/> <PASTE str=" N"/> <PASTE_MON_FRI str=" N(WfgN0RN"/> <PASTE_SAT_SUN str=" N(WfgmQ0Re"/> <PASTE_ALL_CAM str=" N@b geq__je "/> <APPLY_ALL str="WY(uhQ"/> <UN_SELECT_ALL str="SmhQx"/> <GET_PARAM_FAIL_USE_DEFAULT str="S_݈nSxe1YWe, |q}\O(u- <NO_CAM_NAME str="*gkXeQeq__j T1z /f&TO(u- <ERR_SETUP str="-[gQ[ g,ˊ͑ex"/> <DEL_CAM_COFIRM str="/f&Tx[*Rd '%s' ?"/> <ADD_CAM_ERR_ALREADY_HAS str="nU-N] g '%s' ,ˊ͑ex-["/> <MOTION_GET_DATA_ERR str="njeS_1YWe"/> <SHOW_LIVE_CAM str="o:ysSBfeq__jq_P"/> <SHOW_PB_CAM str="o:yV>eeq__jq_P"/> <DELETE_CAM str="ydeq__jo:y"/> <NoCamSupportPreset str="l geq__j/ec-ޞ"/>  <ACTION_DESC_PRESET str="y-ޞ"/> <EVENT_DESC_SMART_ERR str="uP,nlxx S.M.A.R.T /"/> <EVENT_DESC_RAID_ERR str="uP,n RAID /"/> <AutoPan str="R]*"/> <ACTION_DESC_AUTO_PAN str="R]*Y"/> </root>   lang_polish.xmlėR$R̗R 3<root> <Font Name="DejaVu Sans" /> <LanguageName str="Polski" /> <LanguageNameEng str="Polish" /> <Sch_Monitor str="Monitoring wg Harmonogramu" /> <Alarm_Monitor str="Monitoring wg Alarmu" /> <Week0 str="Niedziela" /> <Week1 str="PoniedziaBek" /> <Week2 str="Wtorek" /> <Week3 str="Zroda" /> <Week4 str="Czwartek" /> <Week5 str="Pitek" /> <Week6 str="Sobota" /> <WeekS0 str="Niedziela" /> <WeekS1 str="Pon " /> <WeekS2 str="Wt " /> <WeekS3 str="Zr " /> <WeekS4 str="Czw" /> <WeekS5 str="Pi " /> <WeekS6 str="Sob " /> <Disk_Free str="Wolny" /> <Error str="BBd" /> <LoginError str="&amp;quot;BBd logowania, brak u|ytkownika lub nieprawidBowe hasBo&amp;quot;" /> <DeviceInfo str="Informacje o urzdzeniu" /> <DeviceTitle str="Nazwa urzdzenia" /> <SoftwareVersion str="Wersja oprogramowania" /> <Characters str="Znakw" /> <DateTimeInfo str="Ustawienia Daty i Czasu" /> <CurrentDate str="Aktualna data" /> <CurrentTime str="Aktualny czas" /> <Adjust str="Zmienia <j" /> <Manual str="Rcznie" /> <SyncNTP str="Synchronizacja z NTP" /> <Setting str="Ustawiania" /> <NTPServer str="Ntp Serwer" /> <Test str="Test" /> <NTPSyncInterval str="Okres synchronizacji NTP" /> <Hour str="Godzina" /> <Timezone str="Strefa czasowa" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="&amp;quot;GMT-12 (Eniwetok, Kwajalein)&amp;quot;" /> <Timezone3 str="&amp;quot;GMT-11 (Midway ISL., Samoa)&amp;quot;" /> <Timezone4 str="&amp;quot;GMT-10 (Hawaii, Aleuty ISL.)&amp;quot;" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="&amp;quot;GMT-08 (Las Vegas, San Francisco, Vancouver)&amp;quot;" /> <Timezone7 str="&amp;quot;GMT-07 (Calgary, Denver, Salt Lake City)&amp;quot;" /> <Timezone8 str="&amp;quot;GMT-06 (Chicago, Dallas, Mexico City, New Orleans)&amp;quot;" /> <Timezone9 str="GMT-05 (Kuba)" /> <Timezone10 str="&amp;quot;GMT-05 (New York, Toronto, Washington DC)&amp;quot;" /> <Timezone11 str="GMT-04 (Paragwaj)" /> <Timezone12 str ?="GMT-04 (Chile)" /> <Timezone13 str="&amp;quot;GMT-04 (Charlottetown, Manaus)&amp;quot;" /> <Timezone14 str="GMT-03: 30 (Nowa Fundlandia)" /> <Timezone15 str="&amp;quot;GMT-03 (Brazilia, Sao Paulo)&amp;quot;" /> <Timezone16 str="&amp;quot;GMT-02 (Noronha, Mid-Atlantic)&amp;quot;" /> <Timezone17 str="&amp;quot;GMT-01 (Azory, Cap Verde ISL.)&amp;quot;" /> <Timezone18 str="&amp;quot;GMT (Dublin, Lizbona, Londyn, Reykjavik)&amp;quot;" /> <Timezone19 str="&amp;quot;GMT +01 (Amsterdam, Berlin, Rzym, Sztokholm, Warszawa)&amp;quot;" /> <Timezone20 str="&amp;quot;GMT +02 (Ateny, Helsinki, IstambuB, Ryga)&amp;quot;" /> <Timezone21 str="GMT +02 (Egipt)" /> <Timezone22 str="GMT +02 (Izrael)" /> <Timezone23 str="GMT +02 (Liban)" /> <Timezone24 str="GMT +02 (Syria)" /> <Timezone25 str="&amp;quot;GMT +03 (Moscow, Riyadh)&amp;quot;" /> <Timezone26 str="GMT +03 (Irak)" /> <Timezone27 str="GMT +03:30 (Iran)" /> <Timezone28 str="&amp;quot;GMT +04 (Abu Dubai, Baku)&amp;quot;" /> <Timezone29 str * ="GMT +04:30 (Kabul)" /> <Timezone30 str="&amp;quot;GMT +05 (Islamabad, Karaczi, Taszkient)&amp;quot;" /> <Timezone31 str="&amp;quot;GMT +05:30 (Bombaj, Kalkuta, New Delhi)&amp;quot;" /> <Timezone32 str="GMT +05:45 (Katmandu)" /> <Timezone33 str="&amp;quot;GMT +06 (Nowosybirsk, Omsk)&amp;quot;" /> <Timezone34 str="GMT +06:30 (Rangoon)" /> <Timezone35 str="&amp;quot;GMT +07 (Bangkok, Hanoi, D|akarta)&amp;quot;" /> <Timezone36 str="&amp;quot;GMT +08 (Pekin, Hong Kong, Szanghaj, Singapur, Taipei)&amp;quot;" /> <Timezone37 str="&amp;quot;GMT +09 (Seul, Osaka, Sapporo, Tokio)&amp;quot;" /> <Timezone38 str="GMT +09:30 (Darwin)" /> <Timezone39 str="GMT +09:30 (Adelaide)" /> <Timezone40 str="GMT +10 (Hobart)" /> <Timezone41 str="&amp;quot;GMT +10 (Canberra, Melbourne, Sydney)&amp;quot;" /> <Timezone42 str="GMT +11 (Solomon ISL.)" /> <Timezone43 str="GMT +11:30 (Norfolk)" /> <Timezone44 str="&amp;quot;GMT +12 (Auckland, Wellington)&amp;quot;" /> <Timezone45 str="GMT +12 (Fid|i)" /> <T 0imezone46 str="GMT +12 (Kamczatka)" /> <Timezone47 str="GMT +12 (Marshall ISL.)" /> <Timezone48 str="&amp;quot;GMT +13 (Tongatapu, Nuku'alofa)&amp;quot;" /> <Timezone49 str="GMT +12:45 (Chatham Island)" /> <DST str="Czas Letni" /> <Disable str="WyBcz" /> <Enable str="WBcz" /> <DSTStart str="Pocztek czasu letniego" /> <DSTEnd str="Koniec czasu letniego" /> <DSTOffset str="Przesunicie czasu letniego" /> <AutoLogin str="Automatyczne logowanie" /> <UID str="Nazwa u|ytkownika" /> <PWD str="HasBo" /> <System str="System" /> <AutoFullScreen str="Automatycznie PeBny Ekran" /> <Language str="Jzyk" /> <Audio str="Audio" /> <InputGain str="Wzmocnienie wej[cia" /> <OutputGain str="Wzmocnienie wyj[cia" /> <KeyinNTPAddr str="Prosz wprowadz adres serwera NTP!" /> <Success str="Powodzenie" /> <Fault str="Niepowodzenie" /> <OK str="OK" /> <Cancel str="Anuluj" /> <SetDateTime str="Ustaw czas i dat" /> <Date str="Data" /> <Time str="Czas" /> <AutoSetting str="Ustawien % ia Automatyczne" /> <CameraName str="Nazwa kamery" /> <ModelName str="Model urzdzenia" /> <IPAddress str="Adres IP" /> <HTTPPort str="Port HTTP" /> <RTSPPort str="Port RTSP" /> <Camera str="Kamera" /> <Schedule str="Harmonogram" /> <Network str="Sie" /> <User str="U|ytkownik" /> <MotionDetection str="Detekcja Ruchu" /> <Snapshot str="Zdjcie" /> <Maintenance str="Ustawienia" /> <Add str="Dodaj" /> <Delete str="UsuD" /> <Update str="Aktualizuj" /> <Clear str="Wyczy[" /> <Search str="Szukaj" /> <AutoDetect str="Autodetekcja" /> <Detect str="Wykryj" /> <MACAddress str="Adres MAC" /> <Configuration str="Konfiguracja" /> <Copy str="Kopiuj" /> <StartTime str="Czas startu" /> <EndTime str="Czas koDca" /> <RecordType str="Typ Nagrania" /> <PreAlarm str="PreAlarm" /> <PostAlarm str="Postalarm" /> <RTC str="CigBe" /> <DIDetect str="Detekcja DI" /> <TimeSelErr str="Zakres czasu jest nieprawidBowy!" /> <NoSelSch str="Prosz wybra jeden harmonogram!" />  & <Warning str="Ostrze|enie" /> <WeekCopyToAll str="Wszystkie ustawienia tygodnia bd takie same jak obecnie wybrane" /> <DHCP str="Uzyskaj adres IP automatycznie (DHCP)" /> <SubnetMask str="Maska podsieci" /> <Gateway str="Brama" /> <DNS_DHCP str="Uzyskaj DNS z DHCP" /> <PrimaryDNS str="Pierwszy DNS" /> <SecondaryDNS str="Drugi DNS" /> <PPPoE str="PPPoE" /> <Status str="Status" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Serwer" /> <IPUsed str="Ten adres jest w u|yciu!" /> <IPNoUsed str="Adres ten mo|na u|ywa!" /> <Group str="Grupa" /> <Description str="Opis" /> <ConfirmPWD str="Potwierdz hasBo" /> <LiveView str="Podgld na |ywo" /> <Playback str="Odtwarzanie" /> <Record str="Nagrania" /> <PTZ str="PTZ" /> <TwoWayAudio str="Dwukierunkowe Audio" /> <CheckConfirmPWD str="&amp;quot;Prosz sprawdzi, potwierdzi hasBo.&amp;quot;" /> <UIDEmpty str="Prosz zmieni nazw u|ytkownika." /> <UIDRepeat str="DodaBe[ t sam nazw u|ytkownika. Prosz zmieD t 3o!" /> <NoSelUID str="Wybierz konto!" /> <MotionID str="ID okna Detekcji" /> <Name str="Nazwa" /> <Included str="Wewntrz" /> <Excluded str="Na Zewntrz" /> <ObjectSize str="Rozmiar obiektu" /> <Sensitivity str="CzuBo[" /> <NoSelCamera str="Prosz wybra kamer!" /> <OverMaxMotion10 str="Maksymalna ilo[ to 10" /> <NoSelMotion str="Please select a motion." /> <MotionSettingEnpty str="Please fill motion setting first." /> <SourceSnapshotList str="Source Snapshot List" /> <SourceSnapshotPreview str="Source Snapshot Preview" /> <DestinationSnapshotList str="Destination Snapshot List" /> <DestinationSnapshotPreview str="Destination Snapshot Preview" /> <NoFindSD str="Prosz wBo|y kart SD!" /> <NoSelImg str="Prosz wybra obraz!" /> <SameSnapshotImgName str="Nazwa pliku istnieje na karcie SD. Plik zostanie nadpisany!" /> <IsAutoSetting str="Czy chcesz Automatycznie skonfigurowa kamer ? " /> <GetParamError str="BBd pobierania parametrw!" /> <CameraNameEmpty str="Pro 3sz wprowadz nazw kamery!" /> <IPAddressEmpty str="Prosz wprowadz adres IP!" /> <UIDEmpty str="Prosz wprowadz Nazw u|ytkownika!" /> <HttpPortEmpty str="Prosz wprowadz port HTTP!" /> <CameraNameTheSame str="Nazwa kamery jest taka sama!" /> <CamParam str="Dane kamery" /> <Profile str="Profil" /> <FPS str="FPS" /> <Protocol str="ProtokB" /> <EnableAudio str="WBcz dzwik" /> <AudioRecord str="Nagrywaj dzwik" /> <InputError str="BBd wej[cia" /> <DefaultSetting str="Ustawienia domy[lne" /> <FactoryDefaultSetting str="Ustawienia fabryczne" /> <Default str="Domy[lne" /> <BackupSetting str="Ustawienia Kopii Zapasowych" /> <Backup str="Tworzenie kopii zapasowych" /> <RestoreSetting str="Przywr ustawienia" /> <Restore str="Przywracaj" /> <FirmwareUpgrade str="Aktualizacja oprogramowania" /> <Upgrade str="Aktualizuj" /> <Browse str="Przegldaj" /> <SystemRestart str="Restart systemu" /> <Restart str="Restart" /> <HDInformation str="Informacje o Dysku Twardym" />   & <SDInformation str="Informacje o karcie SD" /> <TotalCapacity str="CaBkowita pojemno[" /> <FreeCapacity str="Wolna Pojemno[" /> <UsedCapacity str="U|ywana Pojemno[" /> <UsedPercent str="Procent u|ywany" /> <Format str="Format" /> <NoFind str="Nie znaleziono" /> <NoMount str="Nie zamontowany" /> <IsDefaultSetting str="&amp;quot;System przywrci wszystkie ustawienia do fabrycznych, prosz potwierdz wybr.&amp;quot;" /> <NoBackupDevice str="Prosz podBczy zewntrzny no[nik kopii." /> <NoFindConfigFile str="Nie mo|na odnalez pliku konfiguracyjnego." /> <ConfigFile str="Plik konfiguracyjny" /> <ConfigFileVerErr str="BBd wersji pliku konfiguracyjnego." /> <IsRestart str="&amp;quot;System zostanie uruchomiony ponownie, prosz o potwierdzenie tej czynno[ci.&amp;quot;" /> <NoFindFirmware str="Nie mo|na znalez |adnego oprogramowania!" /> <FirmwareFile str="Plik Oprogramowania" /> <IsFormatHD str="&amp;quot;Wszystkie dane zostan utracone, kontynuowa ? .&amp;quot;" /> <OpenFi  % rmwareUpgradeLogErr str="Nie mo|na otworzy pliku firmware_upgrade.log" /> <Playback str="Odtwarzanie" /> <PlaybackTime str="Czas odtwarzania" /> <Play str="Odtwarzaj" /> <Reverse str="Wstecz" /> <Pause str="Pauza" /> <Wait str="Prosz czeka!" /> <Mute str="Wyciszenie" /> <LiveAudio str="Obecny Dzwik" /> <PlaybackAudio str="Odtwarzanie dzwiku" /> <ConvertToAvi str="Konwersja do avi" /> <NoFindRecord str="Nie znaleziono zapisu" /> <TimePeriod str="Okres" /> <SaveTo str="Zapisz do" /> <BackupDeviceFull str="&amp;quot;Urzdzenie Archiwizujce zdaje si by peBne, prosz to sprawdzi.&amp;quot;" /> <SavePath str="Zapisz [cie|k" /> <Login str="Zaloguj" /> <Logout str="Wyloguj" /> <PictureSet str="Ustawienia Obrazu" /> <Rotation str="Obrt" /> <Normal str="Normalny" /> <Mirror str="Lustro" /> <VerticaFlip str="Obrt w poziomie" /> <ColorLevel str="Poziom Kolorw" /> <Brightness str="Jasno[" /> <Contrast str="Kontrast" /> <Sharpness str="Ostro[" /> <RateCon  0trol str="Kontrola pasma" /> <Quality str="Jako[" /> <Bitrate str="Bitrate" /> <VideoOffset str="Przesunicie wideo" /> <De-Noise str="Odszumianie" /> <None str="Brak" /> <Method str="Metoda" /> <AutoMode str="Tryb automatyczny" /> <DayMode str="Tryb dzienny" /> <NightMode str="Tryb nocny" /> <Base str="Dane Podstawowe" /> <Picture str="Obraz" /> <OutOfRange str="Poza zakresem" /> <SystemClose str="Zamknij system ..." /> <On str="WBczony" /> <Off str="WyBczony" /> <Vendor str="Producent" /> <ModelName str="Nazwa modelu" /> <FriendlyName str="Przyjazna nazwa" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Zakres Portw" /> <ExternalIPAddress str="Zewntrzny adres IP" /> <Information str="Informacje" /> <SelOverPlayerMaxCam str="Wybierz na% d kamery!" /> <Event str="Zdarzenie" /> <Event_List str="Lista ZdarzeD" /> <Motion str="Ruch" /> <DI str="Wej[cie cyfrowe" /> <DO str="Wyj[cie cyfrowe" /> <Event_Schedule_List str="Lista harmonogramu zda  * rzeD" /> <Action_List str="Lista Akcji" /> <Alarm_Trigger_Type str="Typ Alarmu" /> <Alarm_Seconds str="Sekund alarmu" /> <Buzzer str="Brzczyk" /> <UnKnow str="Nieznane" /> <Display_On_CH str="Poka| na kanale" /> <Action_Type str="Rodzaj Akcji" /> <ERR_MSG_NO_CAM str="Prosz najpierw wybra kamer lub lokalizacj !" /> <ERR_MSG_NO_EVENT str="Prosz najpierw wybra zdarzenie!" /> <ERR_MSG_NO_EVENT_SCH str="Prosz najpierw wybra harmonogram zdarzeD !" /> <ERR_MSG_NO_ACTION str="Wybierz Najpierw akcj!" /> <ERR_MSG_TIME_PERIOD str="BBd czasokresu ;). Sprawdz konfiguracj!" /> <ERR_MSG_TIME_CONFILT str="Konflikt czasokresu ;). Sprawdz konfiguracj!" /> <WeekDays str="Dni Tygodnia" /> <AlarmSetting str="Ustawienia Alarmu" /> <AlarmCondition str="Stan Alarmu" /> <Alarm_True str="True" /> <Alarm_False str="False" /> <Alarm_Seconds str="Sekundy Alarmu" /> <Alarm_Manual_Stop str="Zatrzymanie rczne" /> <Local str="Lokalizacja" /> <DI_Setting str="Otoczenie DI" /> <Syste  ?m_Setting str="Ustawienia Systemu" /> <Log_Viewer str="Podgld Log" /> <Event_Log str="Log zdarzeD" /> <Device str="Urzdzenie" /> <Log_Type str="Typ Loga" /> <Motion_Alarm str="Alarm Ruchu" /> <DI_Alarm str="Alarm DI" /> <Input str="Wej[cie" /> <Limit_Record str="Limit Record" /> <Remark str="Uwagi" /> <Total str="Aczny" /> <HDD_Err_Alarm str="Alarm BBdu HDD" /> <Disconnect_Alarm str="Alarm odBczenia" /> <Schedule_Trigger str="Alarm wg Harmonogramu" /> <Block_Alarm str="Alarm blokowania" /> <Blur_Alarm str="Alarm rozmycia" /> <Camera_Move_Alarm str="Alarm przesunicia kamery" /> <Address_Book str="Ksi|ka adresowa" /> <Phone str="Telefon" /> <E_MAIL str="E-Mail" /> <Notification str="Powiadamianie" /> <SMTP_Config str="Ustawienie SMTP" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="Od" /> <SendMailWithoutPicture str="Wy[lij mail bez zdjcia" /> <ServerRequireAuthentication str="Serwer wymaga uwierzytelnienia" /> <SSL str="Server Wy <magaj bezpiecznego poBczenia (SSL)" /> <Send_Test str="Wy[lij wiadomo[ testow" /> <FTP_Config str="Ustawianie FTP" /> <FTP_Server str="Serwer" /> <FTP_Port str="Port" /> <Retry str="Ponawiaj ilo[ razy" /> <RecycleDays str="Nadpisywanie DNI" /> <RecycleSize str="Nadpisywanie wielko[ci" /> <Path str="Zcie|ka" /> <AllowCreateFolder str="Zezwl na utworzenie folderu" /> <HTTP_Config str="Ustawienie HTTP" /> <HTTP_IP str="IP" /> <HTTP_UID str="Konto" /> <HTTP_PWD str="HasBo" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Adres Proxy " /> <Proxy_UID str="Konto Proxy" /> <Proxy_PWD str="HasBo Proxy" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="Ustawienie TCP" /> <TCP_Server str="Serwer" /> <TCP_Port str="Port" /> <Alarm_Config str="Ustawienia Alarmu" /> <frame str="Ramka" /> <SnapshotInterval str="InterwaB zdj" /> <SendInterval str="InterwaB wysyBania" /> <SnapshotTempFolder str="Folder Temp dla zdj" /> <Mail str="Poczta" /> <Subject str="Przedmio ) t" /> <body str="Tre[" /> <MS str="MS" /> <second str="Sekund" /> <EventDetect str="Detekcja zdarzeD" /> <EventForceRecord str="Event Force Record" /> <EventSetting str="Ustawienia zdarzeD" /> <MergeSeconds str="Powtarzaj Sekund" /> <Display str="Wy[wietl" /> <Division str="Sekcja" /> <FullScreen str="PeBny Ekran" /> <ResetDIVDefault str="Przywr do fabrycznych" /> <CancelFullScreen str="Anuluj PeBny Ekran" /> <Function str="Funkcja" /> <SystemManagement str="Zarzdzanie systemem" /> <PTZControl str="PTZControl" /> <Volume str="GBo[no[" /> <Monitor str="Monitor" /> <CancelMute str="Anuluj wyciszenie" /> <TwoWayAudioON str="Uruchom Audio" /> <TwoWayAudioOFF str="Zatrzymaj Audio" /> <Resolution str="Rozdzielczo[" /> <Style str="Styl" /> <Simple str="Prosty" /> <Professional str="Profesjonalny" /> <Output str="Wyj[cie" /> <SettoOpen str="Ustaw by otworzy" /> <SettoClose str="&amp;quot;Ustaw, aby zamkn&amp;quot;" /> <Preset str="Preset" /> <Zoom str  ="Powiksz" /> <Wide str="Szeroki" /> <Tele str="Tele" /> <Advanced str="Zaawansowany" /> <IsDeletePreset str="Wci[nicie 'OK' usunie preset" /> <System_Log str="Log Systemu" /> <PTZ_SPEED str="Prdko[ PTZ" /> <PTZ_HOME str="PTZ Home" /> <PTZ_UP str="PTZ w gr" /> <PTZ_DOWN str="PTZ w dB" /> <PTZ_LEFT str="PTZ w lewo" /> <PTZ_RIGHT str="PTZ w prawo" /> <PTZ_UP_RIGHT str="PTZ gra prawo" /> <PTZ_UP_LEFT str="PTZ gra lewo" /> <PTZ_DOWN_LEFT str="PTZ dB lewo" /> <PTZ_DOWN_RIGHT str="PTZ dB prawo" /> <PTZ_TOUR_GO str="PTZ wBcz [cie|k" /> <PTZ_TOUR_STOP str="PTZ wyBcz [cie|k" /> <PTZ_FOCUS_UP str="PTZ wyostrz plus" /> <PTZ_FOCUS_DOWN str="PTZ wyostrz minus" /> <PTZ_IRIS_UP str="PTZ przesBona plus" /> <PTZ_IRIS_DOWN str="PTZ przesBona minus" /> <PTZ_FOCUS_AUTO str="PTZ Auto ostro[" /> <PTZ_IRIS_AUTO str="PTZ Auto przesBona" /> <PTZ_AUTOPAN_START str="PTZ Navigation Start" /> <PTZ_AUTOPAN_STOP str="PTZ Navigation Stop" /> <PTZ_ZOOM_IN str="PTZ Zoom In"  /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="Inicjalizacja systemu" /> <SYS_LOG_SYSTEM_SHUTDOWN str="WyBczenie systemu" /> <SYS_LOG_USER_LOGIN str="Zaloguj u|ytkownika" /> <SYS_LOG_USER_LOGOUT str="Wyloguj u|ytkownika" /> <SYS_LOG_START_SCH_REC str="WBcz Harmonogram Nagrywania" /> <SYS_LOG_END_SCH_REC str="ZakoDcz Harmonogram Nagrywania" /> <SYS_LOG_START_SCH_ALARM str="WBcz Harmonogram Alarmw" /> <SYS_LOG_END_SCH_ALARM str="ZakoDcz Harmonogram Alarmw" /> <SYS_LOG_ENTER_SYS_SETUP str="Wejdz do programu konfiguracji systemu" /> <SYS_LOG_EXIT_SYS_SETUP str="Wyjdz z programu konfiguracji systemu" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Wejdz do ustawieD harmonogramu nagrywania" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Wyjdz z ustawieD Harmonogramu nagrywania" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Wejdz do ustawieD harmonogramu alarmu" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Wyjdz z ustawieD harmonogramu alarmu" /> <SYS_LOG_RTSP_GET_CONNECT str="Nawi| poBczenie"   /> <SYS_LOG_RTSP_LOSE_CONNECT str="Utracono poBczenie" /> <SYS_LOG_SERVER_HTTP_START str="WBcz serwer HTTP" /> <SYS_LOG_SERVER_HTTP_STOP str="Zatrzymanie serwera HTTP" /> <SYS_LOG_SERVER_RTSP_START str="Acz serwer RTSP" /> <SYS_LOG_SERVER_RTSP_STOP str="Zatrzymaj serwer RTSP" /> <SYS_LOG_SERVER_RPB_START str="WBcz zdalny serwer odtwarzania" /> <SYS_LOG_SERVER_RPB_STOP str="WyBcz zdalny serwer odtwarzania" /> <DiskManagement str="Zarzdzanie dyskami" /> <DeviceType str="Typ urzdzenia" /> <Partition str="Partycja" /> <FileSystem str="System Plikw" /> <IsPartition str="&amp;quot;System przebuduje partycje, prosz potwierdz.&amp;quot;" /> <Image str="Obraz" /> <Brightness str="Jasno[" /> <Contrast str="Kontrast" /> <Saturation str="Nasycenie" /> <Sharpness str="Ostro[" /> <Hue str="Barwa" /> <NoSeldesti str="Please select Destination!" /> <NoSelSource str="Please select Source List!" /> <Time_Range str="Zakres czasowy pliku" /> <Event_Snapshot str="Event Snapsh ot" /> <EventSnapshotViewer str="Event Snapshot Viewer" /> <Event_Time str="Czas zdarzenia" /> <Event_Type str="Typ zdarzenia" /> <Change_Resolution str="&amp;quot;Rozdzielczo[ ekranu zostaBa zmieniona, Czy chcesz zmiany?&amp;quot;" /> <Select_All str="Zaznacz wszystko" /> <InitNetowrk str="Inicjowanie ModuBu Sieciowego" /> <InitSystemDate str="Inicjowanie moduBu czasu" /> <InitDisk str="Inicjowanie moduBu HDD" /> <InitRTSP str="Inicjowanie moduBu RTSP" /> <NoVideo str="Bez Video" /> <Modify str="Modyfikuj" /> <DisplayCount str="Wy[wietl licznik" /> <Mount str="Montuj" /> <Unmount str="Odinstaluj" /> <EditEmpty str="&amp;quot;Prosz potwierdzi, czy ustawienia s poprawne!&amp;quot;" /> <Account str="Konto" /> <FindListLog str="&amp;quot;Znaleziono ponad% d rekordw, wy[wietl jako pierwsze% rekordw.&amp;quot;" /> <Trigger_Interval_Seconds str="Wyzwalanie w przedziale czasu" /> <Alarm_Always str="Zawsze Alarm" /> <LowFPS str="Niski strumieD Bitrate/FPS" /> <WithFPS s  tr="Jak wy|ej" /> <ShowPW str="Poka| hasBo" /> <SelOverMaxPlayHours str="Wybrane przez% d godzin" /> <SelectedCamera str="Wybrana kamera" /> <Codec str="Kodek" /> <Switchto str="PrzeBcz na" /> <Filter str="Filtrowanie" /> <AutoSettingNote str="&amp;quot;Wprowadz reguB filtrowania lub zachowa puste, aby znalez wszystkie&amp;quot;" /> <TemplateSetting str="Ustawienie szablonu" /> <SearchByEvent str="Szukaj przez zdarzenie" /> <Control str="Sterowanie" /> <SwitchCamera str="PrzeBcz kamer" /> <Preview str="Podgld" /> <SequentialSearch str="Wyszukiwanie sekwencyjne" /> <Split str="Podziel" /> <PreSearch str="Przeszukaj" /> <SeekTo str="Szukaj do" /> <ShowInformation str="Poka| informacje" /> <Bitrate_Log str="Logi Bitrate" /> <Save str="Zapisz" /> <PlaybackControlPad str="Panel odtwarzania" /> <FormatFault str="BBd Formatu" /> <LowBitrateSetting str="Ustawienia niskiego Bitrate" /> <NotConfigured str="Nie skonfigurowano" /> <Application str="Aplikacja" /> < NameOrMailEmpty str="Nazwa lub E-Mail jest pusty" /> <ONVIF_Auth str="Uwierzytelnianie ONVIF" /> <PIR_Alarm str="Alarm PIR" /> <CameraTamper str="Sabota| Kamery" /> <AudioDetection str="Detekcja dzwiku" /> <AutoSwitch str="AutoprzeBczanie" /> <CancelAutoSwitch str="Anuluj autoprzeBczanie" /> <MailRepeat str="DodaBe[ ten sam e-mail. Prosz zmieD to!" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Over all" /> <PASSED str="Test OK" /> <FAILED str="Niepowodzenie" /> <Raw_Read_Error_Rate str="Ilo[ zmierzonych bBdw" /> <Throughput_Performance str="Wydajno[" /> <Spin_Up_Time str="Czas rozkrcania Talerzy ;) HDD" /> <Start_Stop_Count str="Licznik Start Stop" /> <Reallocated_Sector_Ct str="Reallocated Sectors Count" /> <Seek_Error_Rate str="Seek Error Rate" /> <Seek_Time_Performance str="Czas wyszukiwania" /> <Power_On_Hours str="WBczony godzin" /> <Spin_Retry_Count str="Spin Retry Count" /> <Calibration_Retry_Count str="Calibration Retry Count" /> <Power_Cycle_Count st r="Power Cycle Count" /> <Power_Off_Retract_Count str="Power Off Retract Count" /> <Load_Cycle_Count str="ZaBaduj Cycle Count" /> <Temperature_Celsius str="Temperatura Celsjusza" /> <Reallocated_Event_Count str="Reallocated Event Count" /> <Current_Pending_Sector str="Current Pending Sector" /> <Offline_Uncorrectable str="Offline Uncorrectable" /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="Multi Zone Error Rate" /> <SMART_RAW_VALUE str="Warto[ Raw" /> <SMART_WORST str="Referencje" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="WspBczynnik wy[wietlania" /> <FitWindow str="Dopasuj okno" /> <KeepRatio str="Utrzymaj proporcje" /> <Joystick str="Manipulator" /> <Joystick_Information str="Informacje Manipulatora" /> <Joystick_Model str="Model Manipulatora" /> <Axis_Count str="Axis Count" /> <Button_Count str="Ilo[ przyciskw" /> <Axis_X str="O[ X Warto[" /> <Axis_Y str="Warto[ osi Y" /> <Axis_Z str="Warto[ osi Z" />   <Buttons_Status str="Status Przyciskw" /> <Joystick_Buttons_Setting str="Ustawienia przyciskw manipulatora" /> <Button str="Przycisk" /> <Next_Division str="Nastpna sekcja" /> <Previous_Division str="Poprzednia sekcja" /> <Next_Window str="Nastpne okno" /> <Previous_Window str="Poprzednie okno" /> <Switch_Division_One str="PrzeBcz pierwsz sekcj" /> <Axis_Z_ID str="O[ Z ID" /> <RAID_Err_Alarm str="Alarm bBdu RAID" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Lost Connect"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="Can't Get Setting Value!"/> <Refresh str="Please Refresh!"/> <IE_Protected_Open str="IE Protected Mode is enabled, pl  ease add this URL to IE Trusted sites."/> <Backuping str="Backuping, Please wait."/> <Converting str="Converting. Please wait."/> <ShowDate str="Show Date"/> <ShowTime str="Show Time"/> <Subtitle str="Subtitle"/> <PreSecond str="Pre Second"/> <PreFrame str="Pre Frame"/> <NextSecond str="Next Second"/> <NextFrame str="Next Frame"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Motion Search" /> <TimeSplit str="Time Split" /> <ShowDetailWindow str="Show Detail Window" /> <FirstPage str="First Page" /> <PrePage str="Pre Page" /> <NextPage str="Next Page" /> <LastPage str="Last Page" /> <DetailPicture str="Detail Picture" /> <SelectTime str="Select Time" /> <ErrStartEndTm str="Start or End Time Error" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Show Search Image" /> <ShowDetectMark str="Show Detect Mark" /> <DetectInterval str="Detect Interval" /> <Exit str="Exit" /> <Grayscale str="Grayscale" /> <Softn ess str="Softness" /> <Reset str="Reset" /> <Print str="Print" /> <RetryAgain str="Please try again later!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Two Way Audio Used!"/> <Weekly str="Weekly"/> <SAVEAS str="Save As..."/> <Send_To str="Send to"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Display Message on Live Preview"/> <ACTION_DESC_MAIL str="Send Notice Mail on Event Triggered"/> <ACTION_DESC_VOICE str="Play Alarm Sound on Event Triggered"/> <ACTION_DESC_DO str="Trigger Digital Output on Event Triggered"/> <ACTION_DESC_FTP str="Upload Images To FTP Site"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="U pload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detect digital inuput change status"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarm Event Selection"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="Change Name"/> <TIME_SET_ERROR str="Time setting error, please check time setting"/> <Export str="Export"/> <SEL_VIEW_CH str="Select View Channel"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 sec  onds."/> <START_MONITOR_ALL str="Start Monitor All"/> <UPDATE_FAIL str="Can not upload setting , please try again later!"/> <DI_REC_TRIGGER str="DI Record trigger by:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="Camera name is empty, Do you want to use default name?"/> <ERR_SETUP str="Configuration data error, please re-check"/> <DEL_CAM_COFIRM str="Are you sure want to delete '%s' from list?"/> <ADD_CAM_ERR_ALREADY_HAS str="It's already has '%s' at list,please re-check Configuration"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Show Live Camera"/> <SHOW_PB_CAM str="Show Playback Camera"/> <DELETE_CAM str="Remove Camera display"/> <NoCamSupportPreset  str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root> & lang_portuguese.xmlėR5R̗R &<root> <Font Name="DejaVu Sans" /> <LanguageName str="Portugus" /> <LanguageNameEng str="Portuguese" /> <Sch_Monitor str="Agendar Monitorizao" /> <Alarm_Monitor str="Alarme Monitorizao" /> <Week0 str="Domingo" /> <Week1 str="Segunda" /> <Week2 str="Tera" /> <Week3 str="Quarta" /> <Week4 str="Quinta" /> <Week5 str="Sexta" /> <Week6 str="Sbado" /> <WeekS0 str="Dom " /> <WeekS1 str="Seg " /> <WeekS2 str="Ter " /> <WeekS3 str="Qua " /> <WeekS4 str="Qui " /> <WeekS5 str="Sex " /> <WeekS6 str="Sb " /> <Disk_Free str="Livre" /> <Error str="Erro" /> <LoginError str="&amp;quot;Erro Login, utilizador no corresponde ou senha incorrecta&amp;quot;" /> <DeviceInfo str="Dispositivo Info" /> <DeviceTitle str="Ttulo do Dispositivo" /> <SoftwareVersion str="Verso do Software" /> <Characters str="Caracteres" /> <DateTimeInfo str="Info Data e Hora" /> <CurrentDate str="Data Actual" /> <CurrentTime str="Hora Actual" /> <Adjust str="Ajustar" /> <Manual str=" )Manual" /> <SyncNTP str="Sincronizar com NTP" /> <Setting str="Definir" /> <NTPServer str="ServidorNTP" /> <Test str="Teste" /> <NTPSyncInterval str="NTP Sinc Intervalo" /> <Hour str="Hora " /> <Timezone str="Fuso horrio" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="&amp;quot;GMT-12 (Eniwetok, Kwajalein)&amp;quot;" /> <Timezone3 str="&amp;quot;GMT-11 (Midway Isl., Samoa)&amp;quot;" /> <Timezone4 str="&amp;quot;GMT-10 (Hawaii, Aleutian Isl.)&amp;quot;" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="&amp;quot;GMT-08 (Las Vegas, So Francisco, Vancouver)&amp;quot;" /> <Timezone7 str="&amp;quot;GMT-07 (Calgary, Denver, Salt Lake City)&amp;quot;" /> <Timezone8 str="&amp;quot;GMT-06 (Chicago, Dallas, Cidade do Mexico, New Orleans)&amp;quot;" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="&amp;quot;GMT-05 (New York, Toronto, Washington DC)&amp;quot;" /> <Timezone11 str="GMT-04 (Paraguai)" /> <Timezone12 str="GMT-04 (Chile)" /> <Ti *mezone13 str="&amp;quot;GMT-04 (Charlottetown, Manaus)&amp;quot;" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="&amp;quot;GMT-03 (Brasilia, So Paulo)&amp;quot;" /> <Timezone16 str="&amp;quot;GMT-02 (Noronha, Mid-Atlantic)&amp;quot;" /> <Timezone17 str="&amp;quot;GMT-01 (Aores, Cabo Verde Isl.)&amp;quot;" /> <Timezone18 str="&amp;quot;GMT (Dublin, Lisboa, Londres, Reykjavik)&amp;quot;" /> <Timezone19 str="&amp;quot;GMT+01 (Amsterdo, Berlim, Roma, Estocolmo, Varsvia)&amp;quot;" /> <Timezone20 str="&amp;quot;GMT+02 (Atenas, Helsinkia, Istanbul, Riga)&amp;quot;" /> <Timezone21 str="GMT+02 (Egipto)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Libano)" /> <Timezone24 str="GMT+02 (Siria)" /> <Timezone25 str="&amp;quot;GMT+03 (Moscovo, Riade)&amp;quot;" /> <Timezone26 str="GMT+03 (Iraque)" /> <Timezone27 str="GMT+03:30 (Iro)" /> <Timezone28 str="&amp;quot;GMT+04 (Abu Dubai, Baku)&amp;quot;" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timez ? one30 str="&amp;quot;GMT+05 (Islamabad, Karachi, Tashkent)&amp;quot;" /> <Timezone31 str="&amp;quot;GMT+05:30 (Bombaim, Calcuta, Nova Deli)&amp;quot;" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="&amp;quot;GMT+06 (Novosibirsk, Omsk)&amp;quot;" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="&amp;quot;GMT+07 (Bangkok, Hanoi, Jakarta)&amp;quot;" /> <Timezone36 str="&amp;quot;GMT+08 (Pequim, Hong Kong, Xangai, Singapura, Taipei)&amp;quot;" /> <Timezone37 str="&amp;quot;GMT+09 (Seul, Osaka, Sapporo, Tokio)&amp;quot;" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="&amp;quot;GMT+10 (Canberra, Melbourne, Sydney)&amp;quot;" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="&amp;quot;GMT+12 (Auckland, Wellington)&amp;quot;" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone4 %7 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="&amp;quot;GMT+13 (Tongatapu, Nuku'alofa)&amp;quot;" /> <Timezone49 str="GMT+12:45 (Chatham Island)" /> <DST str="Horrio de Vero" /> <Disable str="Desactivar" /> <Enable str="Activar" /> <DSTStart str="Inicio da Hora de Vero" /> <DSTEnd str="Fim da Hora de Vero" /> <DSTOffset str="Compensar Hora de Vero" /> <AutoLogin str="Auto Login" /> <UID str="Nome utilizador" /> <PWD str="Senha" /> <System str="Sistema" /> <AutoFullScreen str="Auto Ecran Completo" /> <Language str="Idioma" /> <Audio str="udio" /> <InputGain str="Ganho Entrada" /> <OutputGain str="Ganho Sada" /> <KeyinNTPAddr str="Por favor digite Endereo Servidor NTP!" /> <Success str="Sucesso" /> <Fault str="Falha" /> <OK str="OK" /> <Cancel str="Cancelar" /> <SetDateTime str="Defina Data e Hora" /> <Date str="Data " /> <Time str="Hora" /> <AutoSetting str="Definio automtica" /> <CameraName str="Nome da Camera" /> <ModelName str="Nome do 0 Modelo" /> <IPAddress str="Endereo IP" /> <HTTPPort str="Porta HTTP" /> <RTSPPort str="Porta RTSP" /> <Camera str="Camera" /> <Schedule str="Agendar " /> <Network str="Rede" /> <User str="Utilizador" /> <MotionDetection str="Deteco Movimento" /> <Snapshot str="Instantneo" /> <Maintenance str="Manuteno" /> <Add str="Adicionar" /> <Delete str="Eliminar" /> <Update str="Actualizar" /> <Clear str="Limpar" /> <Search str="Pesquisar" /> <AutoDetect str="Deteo Automtica" /> <Detect str="Detectar" /> <MACAddress str="Endereo MAC" /> <Configuration str="Configurao" /> <Copy str="Copiar" /> <StartTime str="Hora Inicial" /> <EndTime str="Hora Final" /> <RecordType str="Tipo Gravao" /> <PreAlarm str="PrAlarme" /> <PostAlarm str="PsAlarme" /> <RTC str="O Tempo Todo" /> <DIDetect str="DI Deteco" /> <TimeSelErr str="Intervalo Tempo est incorrecto!" /> <NoSelSch str="Selecione por favor um agendamento!" /> <Warning str="Aviso" /> <WeekCopyToAl 3 l str="Todos agendamentos da semana sero os mesmos com os selecionados" /> <DHCP str="Obter automticamente endereo IP (DHCP)" /> <SubnetMask str="Mascara Sub-rede" /> <Gateway str="Gateway" /> <DNS_DHCP str="Obter DNS atravs do DHCP" /> <PrimaryDNS str="DNS Primrio" /> <SecondaryDNS str="DNS Secundrio" /> <PPPoE str="PPPoE" /> <Status str="Status (Estado)" /> <Start str="Comear" /> <Stop str="Parar" /> <Server str="Servidor" /> <IPUsed str="Este endereo est a ser usado!" /> <IPNoUsed str="Pode usar este endereo!" /> <Group str="Grupo" /> <Description str="Descrio" /> <ConfirmPWD str="Confirme a Senha" /> <LiveView str="Ver ao Vivo" /> <Playback str="Reproduzir" /> <Record str="Gravar" /> <PTZ str="PTZ" /> <TwoWayAudio str="udio Bi-direcional" /> <CheckConfirmPWD str="Por favor verifique e confirme novamente a senha." /> <UIDEmpty str="Por favor edite o nome utilizador." /> <UIDRepeat str="Voc adicionou o mesmo nome utilizador. Por favor altere-o!"  &/> <NoSelUID str="Por favor seleccione a conta!" /> <MotionID str="Movimento ID" /> <Name str="Nome" /> <Included str="Includo" /> <Excluded str="Excludo" /> <ObjectSize str="Tamanho do Objeto" /> <Sensitivity str="Sensibilidade" /> <NoSelCamera str="Por favor seleccione a Camera!" /> <OverMaxMotion10 str="&amp;quot;O movimento mximo 10,&amp;quot;" /> <NoSelMotion str="Por favor selecione um movimento." /> <MotionSettingEnpty str="Por favor preencha primeiro a configurao do movimento." /> <SourceSnapshotList str="Lista Fonte Instantneo" /> <SourceSnapshotPreview str="Fonte Pr-visualizao Instantnea" /> <DestinationSnapshotList str="Lista Instantnea Destino" /> <DestinationSnapshotPreview str="Pr-visualizar Destino Instantneo" /> <NoFindSD str="Insira por favor o Carto SD!" /> <NoSelImg str="Por favor seleccione a imagem!" /> <SameSnapshotImgName str="Tem o mesmo nome do ficheiro no carto SD.Ir substituir o ficheiro!" /> <IsAutoSetting str="Pretende agora  &definir automticamente a camera?" /> <GetParamError str="Obter Erro dos Parmetros!" /> <CameraNameEmpty str="Digite por favor o Nome da Camera!" /> <IPAddressEmpty str="Digite por favor o Endereo IP!" /> <UIDEmpty str="Digite por favor o Nome Utilizador!" /> <HttpPortEmpty str="Digite por favor a Porta Http!" /> <CameraNameTheSame str="O Nome da Camara o mesmo!" /> <CamParam str="Parmetros da Camera" /> <Profile str="Perfil" /> <FPS str="FPS" /> <Protocol str="Protocolo" /> <EnableAudio str="Activar udio" /> <AudioRecord str="Gravar udio" /> <InputError str="Erro Entrada" /> <DefaultSetting str="Configurao por Defeito" /> <FactoryDefaultSetting str="Configurao por Defeito de Fbrica" /> <Default str="Padro" /> <BackupSetting str="Configurar Backup" /> <Backup str="Backup" /> <RestoreSetting str="Restaurar as Configuraes" /> <Restore str="Restaurar " /> <FirmwareUpgrade str="Actualizar Firmware" /> <Upgrade str="Actualizar" /> <Browse str="Navegar  3 " /> <SystemRestart str="Reiniciar o Sistema" /> <Restart str="Reiniciar " /> <HDInformation str="Hard Disk Informao" /> <SDInformation str="Carto SD Informao" /> <TotalCapacity str="Capacidade Total" /> <FreeCapacity str="Capacidade Livre" /> <UsedCapacity str="Capacidade Usada" /> <UsedPercent str="Percentagem Usada" /> <Format str="Formato" /> <NoFind str="No Encontra" /> <NoMount str="No Montada" /> <IsDefaultSetting str="&amp;quot;Sistema ir definir a configurao padro incluindo a rede, confirme por favor este procedimento&amp;quot;" /> <NoBackupDevice str="Por favor insira o dispositivo externo de backup." /> <NoFindConfigFile str="No foi possvel encontrar o ficheiro de Configurao." /> <ConfigFile str="Ficheiro de Configurao" /> <ConfigFileVerErr str="Erro de Configurao da Verso do Ficheiro." /> <IsRestart str="&amp;quot;Sistema ir Reiniciar ,por favor confirme este procedimento.&amp;quot;" /> <NoFindFirmware str="No foi possvel encontrar qualq  0 uer firmware!" /> <FirmwareFile str="Ficheiro Firmware" /> <IsFormatHD str="&amp;quot;Todos os dados sero perdidos , pretende continuar.&amp;quot;" /> <OpenFirmwareUpgradeLogErr str="No possvel abrir firmware_upgrade.log" /> <Playback str="Reproduzir" /> <PlaybackTime str="Tempo de Reproduo" /> <Play str="Play" /> <Reverse str="Reverso" /> <Pause str="Pausa" /> <Wait str="Aguarde por favor!" /> <Mute str="Mudo" /> <LiveAudio str="udio ao Vivo" /> <PlaybackAudio str="Reproduo de udio" /> <ConvertToAvi str="Converter Para Avi" /> <NoFindRecord str="No encontra a Gravao" /> <TimePeriod str="Perodo de Tempo" /> <SaveTo str="Salvar Para" /> <BackupDeviceFull str="&amp;quot;O dispositivo de Backup pode estar cheio, verifique-o por favor.&amp;quot;" /> <SavePath str="Salve o Caminho" /> <Login str="Login" /> <Logout str="Logout" /> <PictureSet str="Definir a Imagem" /> <Rotation str="Rotao" /> <Normal str="Normal" /> <Mirror str="Espelho" /> <Vertica  %Flip str="Vertical Flip" /> <ColorLevel str="Nvel de Cr" /> <Brightness str="Brilho" /> <Contrast str="Contraste" /> <Sharpness str="Nitidez" /> <RateControl str="Taxa Controle" /> <Quality str="Qualidade" /> <Bitrate str="Bitrate" /> <VideoOffset str="Vdeo Offset" /> <De-Noise str="De-Rudo" /> <None str="Nenhum" /> <Method str="Mtodo" /> <AutoMode str="Auto Modo" /> <DayMode str="Modo Dia" /> <NightMode str="Modo Noite" /> <Base str="Base" /> <Picture str="Figura" /> <OutOfRange str="Fora Do Intervalo" /> <SystemClose str="Desligar o Sistema ..." /> <On str="On (Ligado)" /> <Off str="Off (Desligado)" /> <Vendor str="Vendedor" /> <ModelName str="Nome do Modelo" /> <FriendlyName str="Nome Amigvel" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Intervalo da Porta" /> <ExternalIPAddress str="Endereo IP Externo" /> <Information str="Informao" /> <SelOverPlayerMaxCam str="Selecione mais %d camera!" /> <Event str="Evento" /> <Event_List  ? str="Lista de Eventos" /> <Motion str="Movimento" /> <DI str="Entrada Digital" /> <DO str="Sada Digital" /> <Event_Schedule_List str="Lista Eventos Agendados" /> <Action_List str="Lista Aces" /> <Alarm_Trigger_Type str="Tipo Alarme" /> <Alarm_Seconds str="Alarme Segundos " /> <Buzzer str="Sirene" /> <UnKnow str="Desconhecido" /> <Display_On_CH str="Exibir no Canal" /> <Action_Type str="Tipo de Ao" /> <ERR_MSG_NO_CAM str="Escolha primeiro por favor uma camera ou local!" /> <ERR_MSG_NO_EVENT str="Selecione primeiro por favor um evento!" /> <ERR_MSG_NO_EVENT_SCH str="Selecione primeiro por favor um evento agendado!" /> <ERR_MSG_NO_ACTION str="Selecione primeiro por favor uma ao!" /> <ERR_MSG_TIME_PERIOD str="&amp;quot;Erro na configurao do perodo do tempo, verifique as configuraes por favor!&amp;quot;" /> <ERR_MSG_TIME_CONFILT str="&amp;quot;Conflito na configurao do perodo do tempo, verifique as configuraes por favor!&amp;quot;" /> <WeekDays str="Dias da Sema  *na" /> <AlarmSetting str="Configurar Alarme" /> <AlarmCondition str="Condio Alarme" /> <Alarm_True str="TRUE" /> <Alarm_False str="FALSE" /> <Alarm_Seconds str="Alarme Segundos" /> <Alarm_Manual_Stop str="Paragem Manual" /> <Local str="Local" /> <DI_Setting str="DI Configurao" /> <System_Setting str="Configurao Sistema" /> <Log_Viewer str="Visualizar o Log" /> <Event_Log str="Log de Eventos" /> <Device str="Dispositivo " /> <Log_Type str="Tipo Log" /> <Motion_Alarm str="Alarme Movimento" /> <DI_Alarm str="DI Alarme" /> <Input str="Entrada " /> <Limit_Record str="Limitar Gravao" /> <Remark str="Comentrio" /> <Total str="Total" /> <HDD_Err_Alarm str="Alarme Erro HDD" /> <Disconnect_Alarm str="Desligar o Alarme" /> <Schedule_Trigger str="Agendamento Acionado" /> <Block_Alarm str="Bloquear Alarme" /> <Blur_Alarm str="Alarme Desfocagem" /> <Camera_Move_Alarm str="Alarme Movimento Camera" /> <Address_Book str="Livro de Endereos" /> <Phone str="Telef )one" /> <E_MAIL str="E-Mail" /> <Notification str="Notificao" /> <SMTP_Config str="Configurar SMTP" /> <SMTP_Server str="Servidor" /> <SMTP_Port str="Porta" /> <From str="De" /> <SendMailWithoutPicture str="Enviar Mail Sem Imagem" /> <ServerRequireAuthentication str="Servidor Requer Autenticao" /> <SSL str="Servidor Requer Conexo Segura(SSL)" /> <Send_Test str="Enviar Test" /> <FTP_Config str="Configurar FTP" /> <FTP_Server str="Servidor" /> <FTP_Port str="Porta" /> <Retry str="Repetir" /> <RecycleDays str="Reciclar Dias" /> <RecycleSize str="Reciclar Tamanho" /> <Path str="Caminho" /> <AllowCreateFolder str="Permite Criar Pasta" /> <HTTP_Config str="Configurar HTTP" /> <HTTP_IP str="IP " /> <HTTP_UID str="Conta" /> <HTTP_PWD str="Senha" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Endereo" /> <Proxy_UID str="Proxy Conta" /> <Proxy_PWD str="Proxy Senha" /> <Proxy_Port str="Proxy Porta" /> <TCP_Config str="Configurar TCP" /> <TCP_Server st < r="Servidor" /> <TCP_Port str="Porta" /> <Alarm_Config str="Configurar Alarme" /> <frame str="Quadro" /> <SnapshotInterval str="Intervalo Instantneo" /> <SendInterval str="Enviar Intervalo" /> <SnapshotTempFolder str="Instantneo Pasta Temp" /> <Mail str="Mail" /> <Subject str="Assunto" /> <body str="Corpo" /> <MS str="MS" /> <second str="Segundo" /> <EventDetect str="Deteco Eventos" /> <EventForceRecord str="Forar Gravao Eventos" /> <EventSetting str="Configurar Eventos" /> <MergeSeconds str="Imergir Segundos" /> <Display str="Exibir " /> <Division str="Diviso" /> <FullScreen str="Ecr Completo" /> <ResetDIVDefault str="Redefinir Diviso Padro" /> <CancelFullScreen str="Cancelar Ecr Completo" /> <Function str="Funo" /> <SystemManagement str="Gerir Sistema" /> <PTZControl str="PTZControl" /> <Volume str="Volume" /> <Monitor str="Monitor" /> <CancelMute str="Cancelar Mute" /> <TwoWayAudioON str="Iniciar udio Bi-direcional" /> <TwoWayAudioOFF  str="Parar udio Bi-direcional" /> <Resolution str="Resoluo" /> <Style str="Estilo" /> <Simple str="Simples" /> <Professional str="Profissional" /> <Output str="Sada " /> <SettoOpen str="Configurar Abertura" /> <SettoClose str="Configurar Fecho" /> <Preset str="Predefinido" /> <Zoom str="Zoom" /> <Wide str="Ampla" /> <Tele str="Tele" /> <Advanced str="Avanado" /> <IsDeletePreset str="Prima 'OK' ir Eliminar Preset." /> <System_Log str="Log do Sistema" /> <PTZ_SPEED str="PTZ Velocidade" /> <PTZ_HOME str="PTZ Home" /> <PTZ_UP str="PTZ Cima" /> <PTZ_DOWN str="PTZ Baixo" /> <PTZ_LEFT str="PTZ Esquerda" /> <PTZ_RIGHT str="PTZ Direita" /> <PTZ_UP_RIGHT str="PTZ Cima Direita" /> <PTZ_UP_LEFT str="PTZ Cima Esquerda" /> <PTZ_DOWN_LEFT str="PTZ Baixo Esquerda" /> <PTZ_DOWN_RIGHT str="PTZ Baixo Direita" /> <PTZ_TOUR_GO str="PTZ Ir ao Tour" /> <PTZ_TOUR_STOP str="PTZ Parar o Tour" /> <PTZ_FOCUS_UP str="PTZ Focar em Cima" /> <PTZ_FOCUS_DOWN str="PTZ Focar em Bai   xo" /> <PTZ_IRIS_UP str="PTZ Iris em Cima" /> <PTZ_IRIS_DOWN str="PTZ Iris em Baixo" /> <PTZ_FOCUS_AUTO str="PTZ Auto Focus" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ Iniciar Navegao" /> <PTZ_AUTOPAN_STOP str="PTZ Parar Navegao" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="Inicializao do Sistema" /> <SYS_LOG_SYSTEM_SHUTDOWN str="Encerrar o Sistema" /> <SYS_LOG_USER_LOGIN str="Utilizador Login" /> <SYS_LOG_USER_LOGOUT str="Utilizador Logout" /> <SYS_LOG_START_SCH_REC str="Iniciar Agendamento de Gravao" /> <SYS_LOG_END_SCH_REC str="Terminar Agendamento de Gravao" /> <SYS_LOG_START_SCH_ALARM str="Iniciar Agendamento Alarme" /> <SYS_LOG_END_SCH_ALARM str="Terminar Agendamento Alarme" /> <SYS_LOG_ENTER_SYS_SETUP str="Entrar na Configurao do Sistema" /> <SYS_LOG_EXIT_SYS_SETUP str="Sar da Configurao do Sistema" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Entrar na Configurao Agendamento  Gravao" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Sar da Configurao Agendamento Gravao" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Entrar na Configurao Agendamento Alarme" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Sar da Configurao Agendamento Alarme" /> <SYS_LOG_RTSP_GET_CONNECT str="Obter Conexo" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Perda Conexo" /> <SYS_LOG_SERVER_HTTP_START str="Iniciar Servidor HTTP" /> <SYS_LOG_SERVER_HTTP_STOP str="Parar Servidor HTTP" /> <SYS_LOG_SERVER_RTSP_START str="Iniciar Servidor RTSP" /> <SYS_LOG_SERVER_RTSP_STOP str="Parar Servidor RTSP" /> <SYS_LOG_SERVER_RPB_START str="Iniciar Servidor Reproduo Remoto" /> <SYS_LOG_SERVER_RPB_STOP str="Parar Servidor Reproduo Remoto" /> <DiskManagement str="Gesto do Disco" /> <DeviceType str="Tipo do Dispositivo" /> <Partition str="Partio" /> <FileSystem str="FileSystem (Sistema Ficheiros)" /> <IsPartition str="&amp;quot;O Sistema ir recrear a Partio, confirme por favor este procedimento.&amp;quot;" />  <Image str="Imagem" /> <Brightness str="Brilho" /> <Contrast str="Contraste" /> <Saturation str="Saturao" /> <Sharpness str="Nitidez" /> <Hue str="Tonalidade" /> <NoSeldesti str="Por favor selecione o Destino!" /> <NoSelSource str="Por favor selecione a Lista de Fontes!" /> <Time_Range str="Intervalo Ficheiro do Tempo" /> <Event_Snapshot str="Evento Instantneos" /> <EventSnapshotViewer str="Evento Visualizao Instantneos" /> <Event_Time str="Hora do Evento" /> <Event_Type str="Tipo de Evento" /> <Change_Resolution str="&amp;quot;Resoluo do Ecr foi alterada , Pretende alterar?&amp;quot;" /> <Select_All str="Selecionar Todos" /> <InitNetowrk str="Inicializar o Modulo de Rede" /> <InitSystemDate str="Inicializar Modulo Data e Hora" /> <InitDisk str="Inicializar Modulo Disco" /> <InitRTSP str="Inicializar Modulo RTSP" /> <NoVideo str="Nenhum Vdeo" /> <Modify str="Modificar" /> <DisplayCount str="Exibir Contagem" /> <Mount str="Montar" /> <Unmount str="Desm  ontar" /> <EditEmpty str="Confirme por favor se as configuraes esto corretas!" /> <Account str="Conta" /> <FindListLog str="&amp;quot;Encontrada excesso %d registos , Exibir apenas primeiro %d registos.&amp;quot;" /> <Trigger_Interval_Seconds str="Acionar Intervalo em Segundos" /> <Alarm_Always str="Alarme Sempre" /> <LowFPS str="Baixo Bitrate FPS" /> <WithFPS str="Como acima" /> <ShowPW str="Mostrar Senha" /> <SelOverMaxPlayHours str="Selecionada maior %d horas" /> <SelectedCamera str="Camera Selecionada" /> <Codec str="Codec" /> <Switchto str="Mudar para" /> <Filter str="Filtro" /> <AutoSettingNote str="Entre por favor a regra de filtragem ou mantenha vazia para pesquisar todos" /> <TemplateSetting str="Definir o Padro" /> <SearchByEvent str="Pesquisar Por Evento" /> <Control str="Control" /> <SwitchCamera str="Mudar a Camera" /> <Preview str="Pr-visualizar" /> <SequentialSearch str="Pesquisa Sequncial" /> <Split str="Dividir" /> <PreSearch str="Pesquisa Pr via" /> <SeekTo str="Procurar Para" /> <ShowInformation str="Mostrar Informao" /> <Bitrate_Log str="Bitrate Log" /> <Save str="Salvar " /> <PlaybackControlPad str="Pad Controle Reproduo" /> <FormatFault str="Falha a Formatar" /> <LowBitrateSetting str="Definir Baixo Bitrate" /> <NotConfigured str="No Configurado" /> <Application str="Aplicao" /> <NameOrMailEmpty str="Nome ou E-Mail est em branco" /> <ONVIF_Auth str="ONVIF Autenticao" /> <PIR_Alarm str="PIR Alarme" /> <CameraTamper str="Adulterao da Camera" /> <AudioDetection str="Deteco udio" /> <AutoSwitch str="Auto Switch" /> <CancelAutoSwitch str="Cancelar Auto Switch" /> <MailRepeat str="Voc adicionou o mesmo E-Mail. Altere-o por favor!" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Sobre tudo" /> <PASSED str="PASSOU" /> <FAILED str="FALHOU" /> <Raw_Read_Error_Rate str="Erro Taxa Matria Leitura" /> <Throughput_Performance str="Desempenho do Rendimento" /> <Spin_Up_Time str="Tempo Acelarao" / > <Start_Stop_Count str="Comear e Parar a Contagem" /> <Reallocated_Sector_Ct str="Contagem Sectores Realocados" /> <Seek_Error_Rate str="Taxa Erro de Busca" /> <Seek_Time_Performance str="Desempenho do Tempo de Busca" /> <Power_On_Hours str="Horas Ligadas" /> <Spin_Retry_Count str="Contagem Tentativas Rotao" /> <Calibration_Retry_Count str="Contagem Tentativas Calibrao" /> <Power_Cycle_Count str="Contagem Ciclos Energia" /> <Power_Off_Retract_Count str="Contagem Desligar Retrair" /> <Load_Cycle_Count str="Contagem Ciclos de Carga" /> <Temperature_Celsius str="Temperatura Celsius" /> <Reallocated_Event_Count str="Contagem Eventos Realocados" /> <Current_Pending_Sector str="Sector Actual Pendente" /> <Offline_Uncorrectable str="Desligado Irrecupervel" /> <UDMA_CRC_Error_Count str="Erro Contagem UDMA CRC" /> <Multi_Zone_Error_Rate str="Erro Taxa Multi Zona" /> <SMART_RAW_VALUE str="Valor Raw" /> <SMART_WORST str="Referncia" /> <SMART_Event str="HDD S.M.A.R.T" /> <D  isplayRatio str="Exibir o Rcio" /> <FitWindow str="Caber na Janela" /> <KeepRatio str="Manter o Rcio" /> <Joystick str="Joystick" /> <Joystick_Information str="Informao do Joystick" /> <Joystick_Model str="Modelo do Joystick" /> <Axis_Count str="Axis Contagem" /> <Button_Count str="Boto Contagem" /> <Axis_X str="Axis X Valor" /> <Axis_Y str="Axis Y Valor" /> <Axis_Z str="Axis Z Valor" /> <Buttons_Status str="Boto Status" /> <Joystick_Buttons_Setting str="Configurar Botes Joystick" /> <Button str="Boto" /> <Next_Division str="Prxima Diviso" /> <Previous_Division str="Diviso Anterior" /> <Next_Window str="Prxima Janela" /> <Previous_Window str="Janela Anterior" /> <Switch_Division_One str="Mudar Uma Diviso" /> <Axis_Z_ID str="Axis Z ID" /> <RAID_Err_Alarm str="RAID Alarme de Erro" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEy  eCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Finanlizar conexo"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="O sistema no pode carregar as informaes de configurao."/> <Refresh str="Por favor atualize!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Fazendo Backup, aguarde..."/> <Converting str="Convertendo, aguarde..."/> <ShowDate str="Mostrar Data"/> <ShowTime str="Mostrar Horrio"/> <Subtitle str="Subtitle"/> <PreSecond str="Segundo anterior"/> <PreFrame str="Quadro anterior"/> <NextSecond str="Segundo posterior"/> <NextFrame str="Quadro posterior"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Zoom digital" /> <MotionSearch str="Busca por movimento" /> <TimeSplit str="Intervalo de tempo" /> <ShowDetailWindow str="Mostrar Jan ela de Detalhe" /> <FirstPage str="Primeira pgina" /> <PrePage str="Pgina anterior" /> <NextPage str="Pgina seguinte" /> <LastPage str="ltima pgina" /> <DetailPicture str="Detalhe da imagem" /> <SelectTime str="Selecione horrio" /> <ErrStartEndTm str="Erro na configurao do tempo inicial ou final."/> <SearchSet str="Estabelecer busca" /> <ShowSearchImage str="Mostrar imagem" /> <ShowDetectMark str="Mostrar deteco" /> <DetectInterval str="Intervalo de Deteco" /> <Exit str="Sair" /> <Grayscale str="Escala monocromtica cinza" /> <Softness str="Suave" /> <Reset str="Restaurar" /> <Print str="Imprimir" /> <RetryAgain str="Por favor tente novamente mais tarde!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="udio bidirecional em uso!"/> <Weekly str="Semanal"/> <SAVEAS str="Save As..."/>  <Send_To str="Enviar para"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Mostrar mensagem na imagem ao vivo"/> <ACTION_DESC_MAIL str="Enviar e-mail quando houver um evento"/> <ACTION_DESC_VOICE str="Soar alarme quando houver um evento"/> <ACTION_DESC_DO str="Acionar Sada I/O quando houver um evento"/> <ACTION_DESC_FTP str="Carregar as imagens para um servidor FTP"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detectar situao da Deteco de Movimento"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detectar situao de mudana na Entrada I/O"/> <EV  ENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Seleo de eventos de alarme"/> <CREATE_NEW_FOLDER str="Criar uma nova pasta"/> <CHANGE_NAME str="Trocar nome"/> <TIME_SET_ERROR str="Horrio incorreto, verifique a configurao."/> <Export str="Exportar"/> <SEL_VIEW_CH str="Selecionar canal de exibio"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Iniciar todos os monitoramentos"/> <UPDATE_FAIL str="Configuraes no puderam ser carregadas, tente novamente!"/> <DI_REC_TRIGGER str="Gravao por I/O de entrada acionada por:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Falha ao acessar parametros no equipamento. O sistema ir usar os parametros padres"/> <NO_CAM_NAME str="Voc no inseriu um ttulo para esta cmera. O sistema deve utilizar o ttulo padro?"/> <ERR_SETUP str="Informaes de configurao incorretas. Reconfigure com os dados corretos."/> <DEL_CAM_COFIRM str="Voc tem certeza que quer deletar o equipamento '%s' da lista?"/> <ADD_CAM_ERR_ALREADY_HAS str="J existe um equipamento com nome '%s' na lista. Reconfigure com outro nome."/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Exibir camera ao vivo"/> <SHOW_PB_CAM str="Exibir reproduo da cmera"/> <DELETE_CAM str="Remover exibiao ao vivo"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect R  AID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>  lang_greece.xmlėRR̗R%<root> <Font Name="unifont" /> <LanguageName str="" /> <LanguageNameEng str="Greece" /> <Sch_Monitor str=" " /> <Alarm_Monitor str=" " /> <Week0 str="" /> <Week1 str="" /> <Week2 str="" /> <Week3 str="" /> <Week4 str="" /> <Week5 str="" /> <Week6 str="" /> <WeekS0 str="" /> <WeekS1 str="" /> <WeekS2 str="" /> <WeekS3 str="" /> <WeekS4 str="" /> <WeekS5 str="" /> <WeekS6 str="" /> <Disk_Free str="" /> <Error str="" /> <LoginError str="&amp;quot; ,        &amp;quot;" /> <DeviceInfo str=" " /> <DeviceTitle str=" " /> <SoftwareVersion str=" " /> <Characters str="" /> <DateTimeInfo str="  " /> <CurrentDate str=" " /> <CurrentTime str=" " /> <Adjust str="*" /> <Manual str="" /> <SyncNTP str="  NTP" /> <Setting str="" /> <NTPServer str="NTPServer" /> <Test str="" /> <NTPSyncInterval str="NTP Sync " /> <Hour str="" /> <Timezone str=" " /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="&amp;quot;GMT-12 (Eniwetok, )&amp;quot;" /> <Timezone3 str="&amp;quot;GMT-11 (Midway Isl., )&amp;quot;" /> <Timezone4 str="&amp;quot;GMT-10 (, Aleutian Isl.)&amp;quot;" /> <Timezone5 str="GMT-09 ()" /> <Timezone6 str="&amp;quot;GMT-08 ( ,  , )&amp;quot;" /> <Timezone7 str="&amp;quot;GMT-07 (Calgary, ,   )&amp;quot;" /> <Timezone8 str="&amp;quot;GMT-06 (, , Mexico City, New Orleans)&amp;quot;" /> <Timezone9 str="GMT-05 ()" /> <Timezone10 str="&amp;quot;GMT-05 ( , , , DC)&amp;quot;" /> <Timezone11 str="GMT-04 ()" /> <Timezone12 st)r="GMT-04 ()" /> <Timezone13 str="&amp;quot;GMT-04 (Charlottetown, Manaus)&amp;quot;" /> <Timezone14 str="GMT-03: 30 (Newfoundland)" /> <Timezone15 str="&amp;quot;GMT-03 (Brazilia,  )&amp;quot;" /> <Timezone16 str="&amp;quot;GMT-02 (Noronha, Mid-Atlantic)&amp;quot;" /> <Timezone17 str="&amp;quot;GMT-01 (,    Isl.)&amp;quot;" /> <Timezone18 str="&amp;quot;GMT (, , , Reykjavik)&amp;quot;" /> <Timezone19 str="&amp;quot;GMT +01 (, , , , )&amp;quot;" /> <Timezone20 str="&amp;quot;GMT +02 (, , , )&amp;quot;" /> <Timezone21 str="GMT +02 ()" /> <Timezone22 str="GMT +02 ()" /> <Timezone23 str="GMT +02 ()" /> <Timezone24 str="GMT +02 ()" /> <Timezone25 str="&amp;quot;GMT +03 (, )&amp;quot;" /> <Timezone26 str="GMT +03 ()" /> <Timezone27 str="GMT +03:30 ()" /> <Timezone28 str="&amp;quot;GMT +04 (Abu , )&< amp;quot;" /> <Timezone29 str="GMT +04:30 ()" /> <Timezone30 str="&amp;quot;GMT +05 (, , )&amp;quot;" /> <Timezone31 str="&amp;quot;GMT +05:30 (, ,  )&amp;quot;" /> <Timezone32 str="GMT +05:45 ()" /> <Timezone33 str="&amp;quot;GMT +06 (, )&amp;quot;" /> <Timezone34 str="GMT +06:30 (Rangoon)" /> <Timezone35 str="&amp;quot;GMT +07 (, , )&amp;quot;" /> <Timezone36 str="&amp;quot;GMT +08 (,   ,  ,  , )&amp;quot;" /> <Timezone37 str="&amp;quot;GMT +09 (, , , )&amp;quot;" /> <Timezone38 str="GMT +09:30 (Darwin)" /> <Timezone39 str="GMT +09:30 ()" /> <Timezone40 str="GMT +10 (Hobart)" /> <Timezone41 str="&amp;quot;GMT +10 (, , )&amp;quot;" /> <Timezone42 str="GMT +11 (Solomon Isl.)" /> <Timezone43 str="GMT +11:30 (Norfolk)" /> <Timezone44 str="&amp;quot;GMT +12 (Auckland, Wellington)&amp;quot;&" /> <Timezone45 str="GMT +12 ()" /> <Timezone46 str="GMT +12 ()" /> <Timezone47 str="GMT +12 (Marshall Isl.)" /> <Timezone48 str="&amp;quot;GMT +13 (Tongatapu, )&amp;quot;" /> <Timezone49 str="GMT +12:45 (Chatham Island)" /> <DST str=" " /> <Disable str="" /> <Enable str="" /> <DSTStart str="  " /> <DSTEnd str="  " /> <DSTOffset str="  Offset" /> <AutoLogin str=" " /> <UID str=" " /> <PWD str="" /> <System str="" /> <AutoFullScreen str="  " /> <Language str="" /> <Audio str="" /> <InputGain str="Gain " /> <OutputGain str="Gain " /> <KeyinNTPAddr str=" Keyin   NTP!" /> <Success str="" /> <Fault str="" /> <OK str="OK" /> <Cancel str="" /> <SetDateTime str="  " /> <Date str="" /> <Time str="" /> <3 AutoSetting str=" " /> <CameraName str=" " /> <ModelName str=" " /> <IPAddress str=" IP" /> <HTTPPort str=" HTTP" /> <RTSPPort str=" RTSP" /> <Camera str="" /> <Schedule str="" /> <Network str="" /> <User str="" /> <MotionDetection str=" " /> <Snapshot str="" /> <Maintenance str="" /> <Add str="" /> <Delete str="" /> <Update str="" /> <Clear str="" /> <Search str="" /> <AutoDetect str=" " /> <Detect str="" /> <MACAddress str=" MAC" /> <Configuration str="" /> <Copy str="" /> <StartTime str=" " /> <EndTime str=" " /> <RecordType str=" " /> <PreAlarm str="" /> <PostAlarm str="PostAlarm" /> <RTC str="" /> <DIDetect str="DI " /> <TimeSelErr str="    0 !" /> <NoSelSch str="   !" /> <Warning str="" /> <WeekCopyToAll str="          " /> <DHCP str="   IP (DHCP)" /> <SubnetMask str=" " /> <Gateway str="" /> <DNS_DHCP str=" DNS   DHCP" /> <PrimaryDNS str=" DNS" /> <SecondaryDNS str=" DNS" /> <PPPoE str="PPPoE" /> <Status str="" /> <Start str="" /> <Stop str="" /> <Server str="" /> <IPUsed str="     !" /> <IPNoUsed str="     !" /> <Group str="" /> <Description str="" /> <ConfirmPWD str=" " /> <LiveView str=" " /> <Playback str="" /> <Record str="" /> <PTZ str="PTZ" /> <TwoWayAudio str="  " /> <CheckConfirmPWD str="     %." /> <UIDEmpty str="   ." /> <UIDRepeat str="    .    !" /> <NoSelUID str="  !" /> <MotionID str="ID " /> <Name str="" /> <Included str="" /> <Excluded str="" /> <ObjectSize str=" " /> <Sensitivity str="" /> <NoSelCamera str="  !" /> <OverMaxMotion10 str="    10." /> <NoSelMotion str="   ." /> <MotionSettingEnpty str="     ." /> <SourceSnapshotList str="  Snapshot" /> <SourceSnapshotPreview str="  Snapshot" /> <DestinationSnapshotList str="  Snapshot" /> <DestinationSnapshotPreview str="  Snapshot" /> <NoFindSD str="    SD!" /> <NoSelImg str="  !" /> <SameSnapshotImgName str="%      SD .    !" /> <IsAutoSetting str="     ;" /> <GetParamError str="  !" /> <CameraNameEmpty str=" keyin  !" /> <IPAddressEmpty str=" keyin  IP!" /> <UIDEmpty str=" keyin  !" /> <HttpPortEmpty str=" keyin Http !" /> <CameraNameTheSame str="    !" /> <CamParam str=" " /> <Profile str="" /> <FPS str="FPS" /> <Protocol str="" /> <EnableAudio str=" " /> <AudioRecord str=" " /> <InputError str=" " /> <DefaultSetting str=" " /> <FactoryDefaultSetting str=" " /> <Default str="" /> <BackupSetting str="  " /> <Backup str="  " /> <RestoreSetting str=" " /> <Restore str=" 0 " /> <FirmwareUpgrade str=" Firmware" /> <Upgrade str="" /> <Browse str="" /> <SystemRestart str="  " /> <Restart str="" /> <HDInformation str="  " /> <SDInformation str="SD Card " /> <TotalCapacity str=" " /> <FreeCapacity str=" " /> <UsedCapacity str=" " /> <UsedPercent str=" " /> <Format str="" /> <NoFind str=" " /> <NoMount str=" " /> <IsDefaultSetting str="&amp;quot;       :  ,      &amp;quot;" /> <NoBackupDevice str="    backup." /> <NoFindConfigFile str="      ." /> <ConfigFile str="  " /> <ConfigFileVerErr str="   ." /> <IsRestart str="&am 3 p;quot;   ,      .&amp;quot;" /> <NoFindFirmware str="     firmware!" /> <FirmwareFile str=" Firmware" /> <IsFormatHD str="&amp;quot;    ,     contiue.&amp;quot;" /> <OpenFirmwareUpgradeLogErr str="    firmware_upgrade.log" /> <Playback str="" /> <PlaybackTime str=" " /> <Play str="" /> <Reverse str="" /> <Pause str="" /> <Wait str=" !" /> <Mute str="" /> <LiveAudio str="LiveAudio" /> <PlaybackAudio str=" " /> <ConvertToAvi str="  AVI" /> <NoFindRecord str="  Record" /> <TimePeriod str=" " /> <SaveTo str=" " /> <BackupDeviceFull str="&amp;quot;   ,   .&amp;quot;" /> <SavePath str="Save Path" /> <Login str="" /> <Logout str=" &" /> <PictureSet str="Set Picture" /> <Rotation str="" /> <Normal str="" /> <Mirror str="" /> <VerticaFlip str="Vertica Flip" /> <ColorLevel str=" " /> <Brightness str="" /> <Contrast str="" /> <Sharpness str="" /> <RateControl str="   " /> <Quality str="" /> <Bitrate str="Bitrate" /> <VideoOffset str="Offset " /> <De-Noise str="De-Noise" /> <None str="" /> <Method str="" /> <AutoMode str=" Auto" /> <DayMode str=" " /> <NightMode str=" " /> <Base str="" /> <Picture str="" /> <OutOfRange str="Out Of Range" /> <SystemClose str="    ..." /> <On str="" /> <Off str=" " /> <Vendor str="" /> <ModelName str=" " /> <FriendlyName str=" " /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str=" " /> <Externa < lIPAddress str=" IP Address" /> <Information str="" /> <SelOverPlayerMaxCam str=" % d !" /> <Event str="" /> <Event_List str=" " /> <Motion str="" /> <DI str=" " /> <DO str=" " /> <Event_Schedule_List str="Event List " /> <Action_List str=" " /> <Alarm_Trigger_Type str=" " /> <Alarm_Seconds str=" " /> <Buzzer str="" /> <UnKnow str="" /> <Display_On_CH str="  " /> <Action_Type str=" " /> <ERR_MSG_NO_CAM str="       !" /> <ERR_MSG_NO_EVENT str="    !" /> <ERR_MSG_NO_EVENT_SCH str="      !" /> <ERR_MSG_NO_ACTION str="    !" /> <ERR_MSG_TIME_PERIOD str="&amp;quot;    ,     !&amp;quot;" ) /> <ERR_MSG_TIME_CONFILT str="&amp;quot;    ,   !&amp;quot;" /> <WeekDays str=" " /> <AlarmSetting str=" " /> <AlarmCondition str=" " /> <Alarm_True str="" /> <Alarm_False str="FALSE" /> <Alarm_Seconds str=" " /> <Alarm_Manual_Stop str=" " /> <Local str="" /> <DI_Setting str="DI " /> <System_Setting str=" " /> <Log_Viewer str="Log Viewer" /> <Event_Log str=" " /> <Device str="" /> <Log_Type str=" " /> <Motion_Alarm str=" " /> <DI_Alarm str="DI " /> <Input str="" /> <Limit_Record str=" " /> <Remark str="" /> <Total str="" /> <HDD_Err_Alarm str="HDD  " /> <Disconnect_Alarm str=" " /> <Schedule_Trigger str=" Trigger" /> <Block_Alarm str*=" Block" /> <Blur_Alarm str="Blur " /> <Camera_Move_Alarm str="  Move" /> <Address_Book str=" " /> <Phone str="" /> <E_MAIL str="E-Mail" /> <Notification str="" /> <SMTP_Config str=" SMTP" /> <SMTP_Server str="" /> <SMTP_Port str="" /> <From str="" /> <SendMailWithoutPicture str=" Mail  " /> <ServerRequireAuthentication str="   " /> <SSL str="Server  Conntion Secure (SSL)" /> <Send_Test str=" Test" /> <FTP_Config str="FTP " /> <FTP_Server str="" /> <FTP_Port str="" /> <Retry str="" /> <RecycleDays str="RecycleDays" /> <RecycleSize str="RecycleSize" /> <Path str="" /> <AllowCreateFolder str="  " /> <HTTP_Config str="HTTP " /> <HTTP_IP str="IP" /> <HTTP_UID str="" /> <HTTP_PWD str="" /> <HTTP_CGI str="CGI? " /> <Proxy_Address str=" " /> <Proxy_UID str=" " /> <Proxy_PWD str=" " /> <Proxy_Port str=" " /> <TCP_Config str=" TCP" /> <TCP_Server str="" /> <TCP_Port str="" /> <Alarm_Config str=" " /> <frame str="" /> <SnapshotInterval str=" Snapshot" /> <SendInterval str=" " /> <SnapshotTempFolder str="  Temp" /> <Mail str="" /> <Subject str="" /> <body str="" /> <MS str="MS" /> <second str="" /> <EventDetect str=" Event" /> <EventForceRecord str="  Force" /> <EventSetting str=" Event" /> <MergeSeconds str=" " /> <Display str="" /> <Division str="" /> <FullScreen str=" " /> <ResetDIVDefault str="  Division" /> <CancelFullScreen str=" Full Screen" /> <Function str="" /> <SystemManagement str=" " /> <PTZControl str="PTZControl" /> <Volume str="" /> <Monitor str="" /> <CancelMute str="  " /> <TwoWayAudioON str="   " /> <TwoWayAudioOFF str="   " /> <Resolution str="" /> <Style str="" /> <Simple str="" /> <Professional str="" /> <Output str="" /> <SettoOpen str=" " /> <SettoClose str="  " /> <Preset str="Preset" /> <Zoom str="Zoom" /> <Wide str="" /> <Tele str="Tele" /> <Advanced str="" /> <IsDeletePreset str=" OK   Preset." /> <System_Log str=" " /> <PTZ_SPEED str="PTZ " /> <PTZ_HOME str="PTZ " /> <PTZ_UP str="PTZ Up" /> <PTZ_DOWN str="PTZ Down" /> <PTZ_LEFT str="PTZ " /> <PTZ_RIGHT str="PTZ " /> <PTZ_UP_RIGHT str="PTZ  " /> <PTZ_UP_LEFT str="PTZ   " /> <PTZ_DOWN_LEFT str="PTZ  " /> <PTZ_DOWN_RIGHT str="PTZ  " /> <PTZ_TOUR_GO str="PTZ Tour Go" /> <PTZ_TOUR_STOP str="PTZ Tour " /> <PTZ_FOCUS_UP str="PTZ Focus Up" /> <PTZ_FOCUS_DOWN str="PTZ Focus Down" /> <PTZ_IRIS_UP str="PTZ Iris Up" /> <PTZ_IRIS_DOWN str="PTZ Iris Down" /> <PTZ_FOCUS_AUTO str="PTZ  " /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ  " /> <PTZ_AUTOPAN_STOP str="PTZ Navigation " /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="  " /> <SYS_LOG_SYSTEM_SHUTDOWN str="   " /> <SYS_LOG_USER_LOGIN str=" " /> <SYS_LOG_USER_LOGOUT str=" " /> <SYS_LOG_START_SCH_REC str="  " /> <SYS_LOG_END_SCH_REC str="  " /> <SYS_LOG_START_SCH_ALARM str="  " /> <SYS_LOG_EN  D_SCH_ALARM str="  " /> <SYS_LOG_ENTER_SYS_SETUP str="   " /> <SYS_LOG_EXIT_SYS_SETUP str="    " /> <SYS_LOG_ENTER_SCH_REC_SETUP str="   " /> <SYS_LOG_EXIT_SCH_REC_SETUP str="   " /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="   " /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="   " /> <SYS_LOG_RTSP_GET_CONNECT str=" " /> <SYS_LOG_RTSP_LOSE_CONNECT str="  " /> <SYS_LOG_SERVER_HTTP_START str="HTTP  " /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP  " /> <SYS_LOG_SERVER_RTSP_START str="RTSP  " /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP  " /> <SYS_LOG_SERVER_RPB_START str="   " /> <SYS_LOG_SERVER_RPB_STOP str="Remote   " /> <DiskManagement str=" " /> <DeviceType str=" " /> <Partition str="" /> <FileSystem str="FileSystem" /> <IsPartition str="&amp;quot;   - Partition,      .&amp;quot;" /> <Image str="" /> <Brightness str="" /> <Contrast str="" /> <Saturation str="" /> <Sharpness str="" /> <Hue str="" /> <NoSeldesti str="   !" /> <NoSelSource str="   !" /> <Time_Range str="  " /> <Event_Snapshot str=" Event" /> <EventSnapshotViewer str=" Snapshot Viewer" /> <Event_Time str=" Event" /> <Event_Type str=" " /> <Change_Resolution str="&amp;quot;    ,   ;&amp;quot;" /> <Select_All str=" All" /> <InitNetowrk str="  " /> <InitSystemDate str="Module   " /> <Ini tDisk str=" Disk " /> <InitRTSP str="RTSP  " /> <NoVideo str="  " /> <Modify str="" /> <DisplayCount str=" " /> <Mount str="" /> <Unmount str="" /> <EditEmpty str="       !" /> <Account str="" /> <FindListLog str="&amp;quot;  % d ,   % d .&amp;quot;" /> <Trigger_Interval_Seconds str="Trigger  " /> <Alarm_Always str=" " /> <LowFPS str="Low FPS Bitrate" /> <WithFPS str=" " /> <ShowPW str="  " /> <SelOverMaxPlayHours str=" % d " /> <SelectedCamera str=" " /> <Codec str="Codec" /> <Switchto str=" " /> <Filter str="" /> <AutoSettingNote str="            " /> <TemplateSetting str=" " /> <SearchByEvent str="  " /> <Control str="" /> <SwitchCamera str="  " /> <Preview str="" /> <SequentialSearch str=" " /> <Split str="" /> <PreSearch str=" " /> <SeekTo str=" " /> <ShowInformation str=" " /> <Bitrate_Log str=" bitrate" /> <Save str="" /> <PlaybackControlPad str="  Pad" /> <FormatFault str=" Format" /> <LowBitrateSetting str="  Bitrate" /> <NotConfigured str="  " /> <Application str="" /> <NameOrMailEmpty str="  E-Mail  " /> <ONVIF_Auth str="Authentication ONVIF" /> <PIR_Alarm str=" PIR" /> <CameraTamper str="Tamper " /> <AudioDetection str=" " /> <AutoSwitch str=" Auto" /> <CancelAutoSwitch str=" Switch Auto" /> <MailRepeat str="     e-mail.    !" /> <SMART str="S.M.A.R.T" /> <OVERALL str="  " /> <PASSED str="PASSED" /> <FAILED str="" /> <Raw_Read_Error_Rate str="   " /> <Throughput_Performance str=" Throughput" /> <Spin_Up_Time str="Spin Up " /> <Start_Stop_Count str="Start Stop Count" /> <Reallocated_Sector_Ct str="  " /> <Seek_Error_Rate str="  " /> <Seek_Time_Performance str="  " /> <Power_On_Hours str="Power On " /> <Spin_Retry_Count str="Spin  Count" /> <Calibration_Retry_Count str="  " /> <Power_Cycle_Count str=" Count " /> <Power_Off_Retract_Count str="Power Off  " /> <Load_Cycle_Count str="Load Cycle Count" /> <Temperature_Celsius str=" " /> <Reallocated_Event_Count str=" Count Event" /> <Current_Pending_Sector str="  " /> <Offline_Uncorrectable str="  " /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="   " /> <SMART_RAW_VALUE str=" Value" /> <SMART_WORST str="" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str=" " /> <FitWindow str="  " /> <KeepRatio str=" " /> <Joystick str="" /> <Joystick_Information str=" Joystick" /> <Joystick_Model str=" Joystick" /> <Axis_Count str=" Count" /> <Button_Count str="Count Button" /> <Axis_X str=" X Value" /> <Axis_Y str=" Y Value" /> <Axis_Z str=" Z Value" /> <Buttons_Status str=" " /> <Joystick_Buttons_Setting str="Joystick  " /> <Button str="" /> <Next_Division str=" Division" /> <Previous_Division str=" Division" /> <Next_Window str=" " /> <Previous_Window str="  " /> <Switch_Division_One str=" Division One" /> <Axis_Z_ID str=" Z ID" /> <RAID_Err_Alarm str="RAID  " /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str=" "/> <ConnectFail str=" "/> <GetSettingValueErr str="  "/> <Refresh str=" !"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="  .  ."/> <Converting str="  .  ."/> <ShowDate str=" "/> <ShowTime str=" "/> <Subtitle str=""/> <PreSecond str=". ."/> <PreFrame str=". "/> <NextSecond str=". ."/> <NextFrame str=". "/> <LowBitrate str=" "/> <DigitalZoom str=" " /> <MotionSearch str=" " /> <TimeSplit str=" " /> <ShowDetailWindow str=" " /> <FirstPage str="" /> <PrePage str="" /> <NextPage str="" /> <LastPage str="" /> <DetailPicture str="" /> <SelectTime str=" " /> <ErrStartEndTm str="    !" /> <SearchSet str=" " /> <ShowSearchImage str="  " /> <ShowDetectMark str="  " /> <DetectInterval str=" .:" /> <Exit str="" /> <Grayscale str=" " /> <Softness str="" /> <Reset str="" /> <Print str="" /> <RetryAgain str="  !" /> <FirmwareUpgrade_msg str=" ,   "/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="  !"/> <Weekly str=""/> <SAVEAS str=" "/> <Send_To str=" "/> <ACTION_DESC_SNAPSHOT str="  "/> <ACTION_DESC_RECORD str="  "/> <ACTION_DESC_DISPLAY str="     "/> <ACTION_DESC_MAIL str="   "/> <ACTION_DESC_VOICE str="    "/> <ACTION_DESC_DO str="    "/> <ACTION_DESC_FTP str="    FTP"/> <ACTION_DESC_BUZZER str="  "/> <ACTION_DESC_TCP str="    TCP"/> <ACTION_DESC_HTTP str="    HTTP"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="     "/> <EVENT_DESC_BLOCK str="      "/> <EVENT_DESC_BLUR str="    "/> <EVENT_DESC_CAM_MOVE str="    "/> <EVENT_DESC_DI str="     "/> <EVENT_DESC_HDD_ERR str="   "/> <EVENT_DESC_DISCONNECT str="  "/> <EVENT_DESC_FORCE str=" / "/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="  "/> <CREATE_NEW_FOLDER str=" "/> <CHANGE_NAME str=" "/> <TIME_SET_ERROR str="  ,  "/> <Export str=""/> <SEL_VIEW_CH str=" "/> <SYSTEM_UPDATEMESSAGE str="     40 ."/> <START_MONITOR_ALL str="  "/> <UPDATE_FAIL str="   ,   !"/> <DI_REC_TRIGGER str="   :"/> <PASTE str=""/> <PASTE_MON_FRI str="    "/> <PASTE_SAT_SUN str="    "/> <PASTE_ALL_CAM str="     "/> <APPLY_ALL str="  "/> <UN_SELECT_ALL str=" "/> <GET_PARAM_FAIL_USE_DEFAULT str="  ,    !"/> <NO_CAM_NAME str="   ,    ;"/> <ERR_SETUP str="  ,  "/> <DEL_CAM_COFIRM str="       '%s'   ;"/> <ADD_CAM_ERR_ALREADY_HAS str=" '%s'    ,   "/> <MOTION_GET_DATA_ERR str="  "/> <SHOW_LIVE_CAM str="  "/> <SHOW_PB_CAM str="   "/> <DELETE_CAM str="  "/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>0 lang_czech.xmlėR]R̗R0<root> <Font Name="unifont" /> <LanguageName str=" esko" /> <LanguageNameEng str="Czech" /> <Sch_Monitor str="Plny" /> <Alarm_Monitor str="Alarmy" /> <Week0 str="Nedle" /> <Week1 str="Pondl" /> <Week2 str="ter" /> <Week3 str="StYeda" /> <Week4 str=" tvrtek" /> <Week5 str="Ptek" /> <Week6 str="Sobota" /> <WeekS0 str="Ne" /> <WeekS1 str="Po" /> <WeekS2 str="t" /> <WeekS3 str="St" /> <WeekS4 str=" t" /> <WeekS5 str="P" /> <WeekS6 str="So" /> <Disk_Free str="Voln" /> <Error str="Chyba" /> <LoginError str="Chyba pYihlaen. `patn jmno nebo heslo." /> <DeviceInfo str="Info zdroje" /> <DeviceTitle str="Jmno zdroje" /> <SoftwareVersion str="SW verze" /> <Characters str="Znako" /> <DateTimeInfo str="Date Time Info" /> <CurrentDate str="Aktuln datum" /> <CurrentTime str="aktuln as" /> <Adjust str="Upravit" /> <Manual str="Ru n" /> <SyncNTP str="Synchronizovat s NTP" /> <Setting str="Nastaven" /> <NTPServer str="NTPServer" /> <Tes?t str="Test" /> <NTPSyncInterval str="NTP Sync Interval" /> <Hour str="Hodin" /> <Timezone str=" asov psmo" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="&amp;quot;GMT-12 (Eniwetok, Kwajalein)&amp;quot;" /> <Timezone3 str="&amp;quot;GMT-11 (Midway Isl., Samoa)&amp;quot;" /> <Timezone4 str="&amp;quot;GMT-10 (Hawaii, Aleutian Isl.)&amp;quot;" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="&amp;quot;GMT-08 (Las Vegas, San Francisco, Vancouver)&amp;quot;" /> <Timezone7 str="&amp;quot;GMT-07 (Calgary, Denver, Salt Lake City)&amp;quot;" /> <Timezone8 str="&amp;quot;GMT-06 (Chicago, Dallas, Mexico City, New Orleans)&amp;quot;" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="&amp;quot;GMT-05 (New York, Toronto, Washington DC)&amp;quot;" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="&amp;quot;GMT-04 (Charlottetown, Manaus)&amp;quot;" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezon<e15 str="&amp;quot;GMT-03 (Brazilia, Sao Paulo)&amp;quot;" /> <Timezone16 str="&amp;quot;GMT-02 (Noronha, Mid-Atlantic)&amp;quot;" /> <Timezone17 str="&amp;quot;GMT-01 (Azores, Cap Verde Isl.)&amp;quot;" /> <Timezone18 str="&amp;quot;GMT (Dublin, Lisbon, London, Reykjavik)&amp;quot;" /> <Timezone19 str="&amp;quot;GMT+01 (Amsterdam, Berlin, Rome, Stockholm, Warsaw)&amp;quot;" /> <Timezone20 str="&amp;quot;GMT+02 (Athens, Helsinki, Istanbul, Riga)&amp;quot;" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="&amp;quot;GMT+03 (Moscow, Riyadh)&amp;quot;" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="&amp;quot;GMT+04 (Abu Dubai, Baku)&amp;quot;" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="&amp;quot;GMT+05 (Islamabad, Karachi, Tashkent)&amp;quot;" /> <Timezone31 str="&amp;quot;GMT+05:30 (Bombay, Calcutta, New) Delhi)&amp;quot;" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="&amp;quot;GMT+06 (Novosibirsk, Omsk)&amp;quot;" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="&amp;quot;GMT+07 (Bangkok, Hanoi, Jakarta)&amp;quot;" /> <Timezone36 str="&amp;quot;GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)&amp;quot;" /> <Timezone37 str="&amp;quot;GMT+09 (Seoul, Osaka, Sapporo, Tokyo)&amp;quot;" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="&amp;quot;GMT+10 (Canberra, Melbourne, Sydney)&amp;quot;" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="&amp;quot;GMT+12 (Auckland, Wellington)&amp;quot;" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="&amp;quot;GMT+13 (Tongatapu, Nuku'alofa)&amp;quot;" /> <Timezone49 str="GMT3+12:45 (Chatham" /> <DST str="Daylight Saving Time" /> <Disable str="Vypnout" /> <Enable str="Zapnout" /> <DSTStart str="Daylight Saving Time Start" /> <DSTEnd str="Daylight Saving Time Konec" /> <DSTOffset str="Daylight Saving Time Offset" /> <AutoLogin str="Auto Login" /> <UID str="U~ivatelsk jmno" /> <PWD str="Heslo" /> <System str="System" /> <AutoFullScreen str="Auto Full Screen" /> <Language str="Jazyk" /> <Audio str="Audio" /> <InputGain str="Vstupn zeslen" /> <OutputGain str="Vstupn zeslen" /> <KeyinNTPAddr str="Prosm vlo~te NTP server adresu" /> <Success str="span" /> <Fault str="Chyba" /> <OK str="OK" /> <Cancel str="Zruait" /> <SetDateTime str="Nastaven data a asu" /> <Date str="Datum" /> <Time str=" as" /> <AutoSetting str="Auto nastaven" /> <CameraName str="Jmno kamery" /> <ModelName str="Model" /> <IPAddress str="IP adresa" /> <HTTPPort str="HTTP Port" /> <RTSPPort str="RTSP Port" /> <Camera str="kamera" /> <Schedule & str="Plnovn" /> <Network str="Se" /> <User str="U~ivatel" /> <MotionDetection str="Detekce pohybu" /> <Snapshot str="Snmek" /> <Maintenance str="Maintenance" /> <Add str="PYidat" /> <Delete str="Vymazat" /> <Update str="Update" /> <Clear str="Vy istit" /> <Search str="Hledat" /> <AutoDetect str="Auto detekce" /> <Detect str="Detekce" /> <MACAddress str="MAC Address" /> <Configuration str="Konfigurace" /> <Copy str="Koprovat" /> <StartTime str="Po te n as" /> <EndTime str="Koncov as" /> <RecordType str="Druh nahrvn" /> <PreAlarm str="PreAlarm" /> <PostAlarm str="PostAlarm" /> <RTC str="Round Clock" /> <DIDetect str="DI detekce" /> <TimeSelErr str=" asov rozsah je neplatn!" /> <NoSelSch str="&amp;quot;Prosm, zvolte pln.&amp;quot;" /> <Warning str="Varovn" /> <WeekCopyToAll str="Tdenn pln bude stejn jako zvolen." /> <DHCP str="Zskat IP adresu automaticky (DHCP)." /> <SubnetMask str="Subnet Mask" /> <Gateway str="Gateway" /> <DN% S_DHCP str="Zskat IP adresu z DHCP." /> <PrimaryDNS str="Primary DNS" /> <SecondaryDNS str="Secondary DNS" /> <PPPoE str="PPPoE" /> <Status str="Stav" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Server" /> <IPUsed str="Tato adresa se pou~v." /> <IPNoUsed str="Tuto adresu mo~ete pou~t." /> <Group str="Skupina" /> <Description str="Popis" /> <ConfirmPWD str="Potvrzen hesla" /> <LiveView str="Live View" /> <Playback str="playback" /> <Record str="nahrvn" /> <PTZ str="PTZ" /> <TwoWayAudio str="Obousmrn audio" /> <CheckConfirmPWD str="&amp;quot;Prosm, znovu zkontrolujte heslo.&amp;quot;" /> <UIDEmpty str="ZmHte u~ivatelsk jmno" /> <UIDRepeat str="&amp;quot;PYidali jste stejn jmno. Prosm, zmHte ho.&amp;quot;" /> <NoSelUID str="&amp;quot;Prosm, zvolte pYstup.&amp;quot;" /> <MotionID str="Motion ID" /> <Name str="Jmno" /> <Included str="V etn" /> <Excluded str="Mimo" /> <ObjectSize str="Velikost objektu" /> <Sensitivity str="Cit0livost" /> <NoSelCamera str="&amp;quot;Prosm, zvolte kameru&amp;quot;" /> <OverMaxMotion10 str="Maximum detekc je 10." /> <NoSelMotion str="&amp;quot;Prosm, zvolte detekci.&amp;quot;" /> <MotionSettingEnpty str="Nejprve nastavte detekci" /> <SourceSnapshotList str="Seznam zdrojo snapshoto" /> <SourceSnapshotPreview str="Snapshot Preview" /> <DestinationSnapshotList str="Destination Snapshot List" /> <DestinationSnapshotPreview str="Destination Snapshot Preview" /> <NoFindSD str="&amp;quot;Prosm, vlo~te SD kartu&amp;quot;" /> <NoSelImg str="&amp;quot;Prosm, zvolte obraz.&amp;quot;" /> <SameSnapshotImgName str="Stejn jmno souboru. Bude pYehrn." /> <IsAutoSetting str="Chcete automaticky nastavit kameru?" /> <GetParamError str="Get Parameter Error!" /> <CameraNameEmpty str="Vlo~te jmno kamery." /> <IPAddressEmpty str="Vlo~te IP adresu" /> <UIDEmpty str="Vlo~te jmno" /> <HttpPortEmpty str="Vlo~te HTTP port" /> <CameraNameTheSame str="Stejn jmno kamery" /> <CamParam0 str="Parametry kamery" /> <Profile str="Profil" /> <FPS str="FPS" /> <Protocol str="Protokol" /> <EnableAudio str="zapnout audio" /> <AudioRecord str="nahrvn zvuku" /> <InputError str="Input Error" /> <DefaultSetting str="Doporu en nastaven" /> <FactoryDefaultSetting str="Tovrn nastaven" /> <Default str="Doporu en" /> <BackupSetting str="Nastaven zlohy" /> <Backup str="Zloha" /> <RestoreSetting str="nastaven obnoven" /> <Restore str="obnoven" /> <FirmwareUpgrade str="Firmware Upgrade" /> <Upgrade str="Upgrade" /> <Browse str="Prochzet" /> <SystemRestart str="System Restart" /> <Restart str="Restart" /> <HDInformation str="Informace o HDD" /> <SDInformation str="informace o SD kart" /> <TotalCapacity str="celkov kapacita" /> <FreeCapacity str="Voln kapacita" /> <UsedCapacity str="Pou~it kapacita" /> <UsedPercent str="Vyu~ito %" /> <Format str="Format" /> <NoFind str="nenalezeno" /> <NoMount str="nenalezeno" /> <IsDefaultSetting str="S % ystm se nastav do tovrnho nastaven. Potvrte." /> <NoBackupDevice str="&amp;quot;Prosm, vlo~te extern zaYzen.&amp;quot;" /> <NoFindConfigFile str="Nenalezen konfigura n soubor." /> <ConfigFile str="Konfigura n soubor" /> <ConfigFileVerErr str="Verze konfigura nho souboru" /> <IsRestart str="&amp;quot;Restart, potvrte.&amp;quot;" /> <NoFindFirmware str="Nenalezen firmware!" /> <FirmwareFile str="Soubor firmwaru" /> <IsFormatHD str="vaechna data budou smazna. Potvrte" /> <OpenFirmwareUpgradeLogErr str="Nejde otevYt firmware_upgrade.log" /> <Playback str="Playback" /> <PlaybackTime str="Playback Time" /> <Play str="Play" /> <Reverse str="Reverse" /> <Pause str="Pause" /> <Wait str="&amp;quot;prosm, ekejte&amp;quot;" /> <Mute str="Mute" /> <LiveAudio str="LiveAudio" /> <PlaybackAudio str="Playback Audio" /> <ConvertToAvi str="Konvertovat do AVI" /> <NoFindRecord str="nenalezen zznam" /> <TimePeriod str=" asov obdob" /> <SaveTo str="Ulo~it do" /> < & BackupDeviceFull str="Zlohovac zaYzen je pln. Zkontrolujte." /> <SavePath str="Cesta ulo~en" /> <Login str="Login" /> <Logout str="Logout" /> <PictureSet str="nastaven obrazu" /> <Rotation str="Rotace" /> <Normal str="Normal" /> <Mirror str="Zrcadlo" /> <VerticaFlip str="Vertikln oto en" /> <ColorLevel str="roveH barev" /> <Brightness str="Jas" /> <Contrast str="Kontrast" /> <Sharpness str="Ostrost" /> <RateControl str="Vzdlen ovldn" /> <Quality str="Kvalita" /> <Bitrate str="Bitrate" /> <VideoOffset str="Video Offset" /> <De-Noise str="De-Noise" /> <None str="None" /> <Method str="Metoda" /> <AutoMode str="Auto md" /> <DayMode str="Denn md" /> <NightMode str="no n md" /> <Base str="Base" /> <Picture str="Obraz" /> <OutOfRange str="Mimo rozsah" /> <SystemClose str="System Shutdown ..." /> <On str="On" /> <Off str="Off" /> <Vendor str="Vrobce" /> <ModelName str="Model" /> <FriendlyName str="Jmno" /> <UPnPTraversal str="UPnP  3Traversal" /> <PortRange str="Rozsah porto" /> <ExternalIPAddress str="Extern IP adresa" /> <Information str="Informace" /> <SelOverPlayerMaxCam str="Bylo zvoleno mnoho kamer" /> <Event str="Udlost" /> <Event_List str="Seznam udlost" /> <Motion str="Motion" /> <DI str="Digitln vstup" /> <DO str="Digitln vstup" /> <Event_Schedule_List str="Pln udlost" /> <Action_List str="Seznam akc" /> <Alarm_Trigger_Type str="Typ alarmu" /> <Alarm_Seconds str="VteYiny alarmu" /> <Buzzer str="Bodk" /> <UnKnow str="neznm" /> <Display_On_CH str="Zobrazit na kanlu" /> <Action_Type str="Typ akce" /> <ERR_MSG_NO_CAM str="Nejprve zvolte kameru" /> <ERR_MSG_NO_EVENT str="nejprve zvolte udlost" /> <ERR_MSG_NO_EVENT_SCH str="nejprve zvolte pln." /> <ERR_MSG_NO_ACTION str="nejprve zvolte akci" /> <ERR_MSG_TIME_PERIOD str="Zkontrolujte nastaven periody." /> <ERR_MSG_TIME_CONFILT str="Konflikt nastaven periody." /> <WeekDays str="Dny tdne" /> <AlarmSetting str="Nasta ) ven alarmu" /> <AlarmCondition str="nastaven podmnek" /> <Alarm_True str="Pravda" /> <Alarm_False str="Nepravda" /> <Alarm_Seconds str="VteYiny alarmu" /> <Alarm_Manual_Stop str="Manual Stop" /> <Local str="Local" /> <DI_Setting str="DI nastaven" /> <System_Setting str="Nastaven systmu" /> <Log_Viewer str="Log Viewer" /> <Event_Log str="Log udlost" /> <Device str="Zdroj" /> <Log_Type str="Typ logu" /> <Motion_Alarm str="Pohybov alarm" /> <DI_Alarm str="DI alarm" /> <Input str="Vstup" /> <Limit_Record str="Limit nahrvn" /> <Remark str="Poznmka" /> <Total str="celkem" /> <HDD_Err_Alarm str="HDD Error Alarm" /> <Disconnect_Alarm str="Alarm odpojen" /> <Schedule_Trigger str="Plnovan spouat " /> <Block_Alarm str="Alarm blokovn" /> <Blur_Alarm str="Alarm rozostYen" /> <Camera_Move_Alarm str="Alarm pohybu kamery" /> <Address_Book str="AdresY" /> <Phone str="Telefon" /> <E_MAIL str="E-Mail" /> <Notification str="Potvrzen" /> <SMTP_Config < str="Nastaven SMTP" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="Z (od)" /> <SendMailWithoutPicture str="Poslat mail bez obrazu" /> <ServerRequireAuthentication str="Server vy~aduje ovYen" /> <SSL str="Server Require Secure Conntion(SSL)" /> <Send_Test str="Poslat test" /> <FTP_Config str="FTP nastaven" /> <FTP_Server str="Server" /> <FTP_Port str="Port" /> <Retry str="Retry" /> <RecycleDays str="RecycleDays" /> <RecycleSize str="RecycleSize" /> <Path str="Cesta ulo~en" /> <AllowCreateFolder str="Umo~nit vytvoYen adresYe" /> <HTTP_Config str="HTTP nastaven" /> <HTTP_IP str="IP" /> <HTTP_UID str=" et" /> <HTTP_PWD str="heslo" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Address" /> <Proxy_UID str="Proxy Account" /> <Proxy_PWD str="Proxy Password" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="TCP nastaven" /> <TCP_Server str="Server" /> <TCP_Port str="Port" /> <Alarm_Config str="nastaven alarmu" /> <frame s?tr="Frame" /> <SnapshotInterval str="Snapshot Interval" /> <SendInterval str="Zaslat interval" /> <SnapshotTempFolder str="Snapshot Temp Folder" /> <Mail str="Poata" /> <Subject str="PYedmt" /> <body str="tlo" /> <MS str="MS" /> <second str="Druh" /> <EventDetect str="Event Detection" /> <EventForceRecord str="Event Force Record" /> <EventSetting str="Event Setting" /> <MergeSeconds str="Merge Seconds" /> <Display str="Display" /> <Division str="Division" /> <FullScreen str="Cel obrazovka" /> <ResetDIVDefault str="Reset Division Default" /> <CancelFullScreen str="Zruait celou obrazovku" /> <Function str="Funkce" /> <SystemManagement str="System Management" /> <PTZControl str="Ovldn PTZ" /> <Volume str="Hlasitost" /> <Monitor str="Dohled" /> <CancelMute str="Zruait mute" /> <TwoWayAudioON str="za t obousmrn audio" /> <TwoWayAudioOFF str="zkon it obousmrn audio" /> <Resolution str="Rozliaen" /> <Style str="Styl" /> <Simple str="Jednoduch" /> * <Professional str="profesionln" /> <Output str="Vstup" /> <SettoOpen str="Nastavit na otevYeno" /> <SettoClose str="nastavit na zavYeno" /> <Preset str="pYednastaven" /> <Zoom str="Zoom" /> <Wide str="Wide" /> <Tele str="Tele" /> <Advanced str="Pokro il" /> <IsDeletePreset str="OK zrua pYednastaven" /> <System_Log str="System Log" /> <PTZ_SPEED str="PTZ rychlost" /> <PTZ_HOME str="PTZ home pozice" /> <PTZ_UP str="PTZ nahoru" /> <PTZ_DOWN str="PTZ dolo" /> <PTZ_LEFT str="PTZ doleva" /> <PTZ_RIGHT str="PTZ doprava" /> <PTZ_UP_RIGHT str="PTZ doprava nahoru" /> <PTZ_UP_LEFT str="PTZ doleva nahoru" /> <PTZ_DOWN_LEFT str="PTZ doleva dolo" /> <PTZ_DOWN_RIGHT str="PTZ doprava dolo" /> <PTZ_TOUR_GO str="PTZ Tour Go" /> <PTZ_TOUR_STOP str="PTZ Tour Stop" /> <PTZ_FOCUS_UP str="PTZ Focus Up" /> <PTZ_FOCUS_DOWN str="PTZ Focus Down" /> <PTZ_IRIS_UP str="PTZ Iris Up" /> <PTZ_IRIS_DOWN str="PTZ Iris Down" /> <PTZ_FOCUS_AUTO str="PTZ Auto Focus" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ navigace Start" /> <PTZ_AUTOPAN_STOP str="PTZ navigace Stop" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="Spouatn systmu" /> <SYS_LOG_SYSTEM_SHUTDOWN str="vypnut systmu" /> <SYS_LOG_USER_LOGIN str="User Login" /> <SYS_LOG_USER_LOGOUT str="User Logout" /> <SYS_LOG_START_SCH_REC str="Pln za tku nahrvn" /> <SYS_LOG_END_SCH_REC str="Pln konce nahrvn" /> <SYS_LOG_START_SCH_ALARM str="Start Alarm Schedule" /> <SYS_LOG_END_SCH_ALARM str="End Alarm Schedule" /> <SYS_LOG_ENTER_SYS_SETUP str="Enter System Setup" /> <SYS_LOG_EXIT_SYS_SETUP str="Exit System Setup" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Enter Record Schedule Setup" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Exit Record Schedule Setup" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Enter Alarm Schedule Setup" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Exit Alarm Schedule Setup" /> <SYS_LOG_RTSP_GET_CONNECT str="Zskat spo jen" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Ztraceno spojen" /> <SYS_LOG_SERVER_HTTP_START str="HTTP Server Start" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP Server Stop" /> <SYS_LOG_SERVER_RTSP_START str="RTSP Server Start" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP Server Stop" /> <SYS_LOG_SERVER_RPB_START str="Remote Playback Server Start" /> <SYS_LOG_SERVER_RPB_STOP str="Remote Playback Server Stop" /> <DiskManagement str="Disk Management" /> <DeviceType str="Druh zdroje" /> <Partition str="Partition" /> <FileSystem str="FileSystem" /> <IsPartition str="Systm znovu vytvoY partition. Potvrte." /> <Image str="Obraz" /> <Brightness str="Jas" /> <Contrast str="kontrast" /> <Saturation str="Saturace" /> <Sharpness str="Ostrost" /> <Hue str="Odstn" /> <NoSeldesti str="&amp;quot;Prosm, zvolte umstn&amp;quot;" /> <NoSelSource str="&amp;quot;Prosm, zvolte zrdoj.&amp;quot;" /> <Time_Range str="File Time Range" /> <Event_Snapshot str="Event Snapshot" /> <EventSnapshotView er str="Event Snapshot Viewer" /> <Event_Time str="Event Time" /> <Event_Type str="Event Type" /> <Change_Resolution str="Zmna rozliaen. Opravdu chcete zmnit?" /> <Select_All str="Zvolit vae" /> <InitNetowrk str="Network Module Initialize" /> <InitSystemDate str="Date Time Module Initialize" /> <InitDisk str="Disk Module Initialize" /> <InitRTSP str="RTSP Module Initialize" /> <NoVideo str="No Video" /> <Modify str="Zmnit" /> <DisplayCount str="Po et zznamo" /> <Mount str="Mount" /> <Unmount str="Unmount" /> <EditEmpty str="&amp;quot;Prosm, potvrte nastaven.&amp;quot;" /> <Account str=" et" /> <FindListLog str="Nalezeno %d zznamo. Zobrazit jen %d zznam." /> <Trigger_Interval_Seconds str="Interval spouat e (vteYiny)" /> <Alarm_Always str="Alarm v~dy" /> <LowFPS str="Low Bitrate FPS" /> <WithFPS str="Jako nahoYe" /> <ShowPW str="Ukzat heslo" /> <SelOverMaxPlayHours str="Zvoleno pYes %d hodin" /> <SelectedCamera str="Zvolen kamera" /> <Codec str="Kode k" /> <Switchto str="Switch to" /> <Filter str="Filtr" /> <AutoSettingNote str="Zvolte filtr nebo bude zobrazeno vae." /> <TemplateSetting str="Template Setting" /> <SearchByEvent str="Vyhledvn podle udlosti" /> <Control str="Ovldn" /> <SwitchCamera str="Zmnit kameru" /> <Preview str="Nhled" /> <SequentialSearch str="Sekven n vyhledvn" /> <Split str="Rozdlit" /> <PreSearch str="Pre Search" /> <SeekTo str="Skok na" /> <ShowInformation str="Ukzat informace" /> <Bitrate_Log str="Bitrate Log" /> <Save str="Ulo~it do" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting" /> <NotConfigured str="nenakonfigurovno" /> <Application str="Aplikace" /> <NameOrMailEmpty str="Jmno nebo email je przdn" /> <ONVIF_Auth str="ONVIF Authentication" /> <PIR_Alarm str="PIR Alarm" /> <CameraTamper str="Camera Tamper" /> <AudioDetection str="Audio detekce" /> <AutoSwitch str="Auto Switc h" /> <CancelAutoSwitch str="Zruait auto switch" /> <MailRepeat str="&amp;quot;Zadali jste existujc email. Prosm, zmHte.&amp;quot;" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Over all" /> <PASSED str="PASSED" /> <FAILED str="FAILED" /> <Raw_Read_Error_Rate str="Raw Read Error Rate" /> <Throughput_Performance str="Throughput Performance" /> <Spin_Up_Time str="Spin Up Time" /> <Start_Stop_Count str="Start Stop Count" /> <Reallocated_Sector_Ct str="Reallocated Sectors Count" /> <Seek_Error_Rate str="Seek Error Rate" /> <Seek_Time_Performance str="Seek Time Performance" /> <Power_On_Hours str="Power On Hours" /> <Spin_Retry_Count str="Spin Retry Count" /> <Calibration_Retry_Count str="Calibration Retry Count" /> <Power_Cycle_Count str="Power Cycle Count" /> <Power_Off_Retract_Count str="Power Off Retract Count" /> <Load_Cycle_Count str="Load Cycle Count" /> <Temperature_Celsius str="Temperature Celsius" /> <Reallocated_Event_Count str="Reallocated Event Count" /> <Current_Pending_Sector str="Current Pending Sector" /> <Offline_Uncorrectable str="Offline Uncorrectable" /> <UDMA_CRC_Error_Count str="UDMA CRC Error Count" /> <Multi_Zone_Error_Rate str="Multi Zone Error Rate" /> <SMART_RAW_VALUE str="Raw Value" /> <SMART_WORST str="Reference" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Pomr stran" /> <FitWindow str="Fit Window" /> <KeepRatio str="Keep Ratio" /> <Joystick str="Joystick" /> <Joystick_Information str="Joystick Information" /> <Joystick_Model str="Joystick Model" /> <Axis_Count str="Po et os" /> <Button_Count str="Po et tla tek" /> <Axis_X str="Hodnota osy X" /> <Axis_Y str="Hodnota osy Y" /> <Axis_Z str="Hodnota osy Z" /> <Buttons_Status str="Stav tla tek" /> <Joystick_Buttons_Setting str="Nastaven tla tek" /> <Button str="Tla tko" /> <Next_Division str="Dala divize" /> <Previous_Division str="PYedchoz divize" /> <Next_Window str="Dala okno" /> <Previous_Window str="PYedchoz okno" /> <Switch_Division_One str="Zmnit divizi 1" /> <Axis_Z_ID str="ID osy Z" /> <RAID_Err_Alarm str="RAID Error Alarm" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Lost Connect"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="Can't Get Setting Value!"/> <Refresh str="Please Refresh!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backuping, Please wait."/> <Converting str="Converting. Please wait."/> <ShowDate str="Show Date"/> <ShowTime str="Show Time"/> <Subtitle str="Subtitle"/> <PreSecond str="Pre Second"/> <PreFrame str="Pre Frame"/> <NextSecond str="Next Second"/> <NextFr ame str="Next Frame"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Motion Search" /> <TimeSplit str="Time Split" /> <ShowDetailWindow str="Show Detail Window" /> <FirstPage str="First Page" /> <PrePage str="Pre Page" /> <NextPage str="Next Page" /> <LastPage str="Last Page" /> <DetailPicture str="Detail Picture" /> <SelectTime str="Select Time" /> <ErrStartEndTm str="Start or End Time Error" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Show Search Image" /> <ShowDetectMark str="Show Detect Mark" /> <DetectInterval str="Detect Interval" /> <Exit str="Exit" /> <Grayscale str="Grayscale" /> <Softness str="Softness" /> <Reset str="Reset" /> <Print str="Print" /> <RetryAgain str="Please try again later!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WA YAUDIOUSED str="Two Way Audio Used!"/> <Weekly str="Weekly"/> <SAVEAS str="Save As..."/> <Send_To str="Send to"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Display Message on Live Preview"/> <ACTION_DESC_MAIL str="Send Notice Mail on Event Triggered"/> <ACTION_DESC_VOICE str="Play Alarm Sound on Event Triggered"/> <ACTION_DESC_DO str="Trigger Digital Output on Event Triggered"/> <ACTION_DESC_FTP str="Upload Images To FTP Site"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detect digital inuput change status"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarm Event Selection"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="Change Name"/> <TIME_SET_ERROR str="Time setting error, please check time setting"/> <Export str="Export"/> <SEL_VIEW_CH str="Select View Channel"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Start Monitor All"/> <UPDATE_FAIL str="Can not upload setting , please try again later!"/> <DI_REC_TRIGGER str="DI Record trigger by:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="Camera name is empty, Do you want to use default name?"/> <ERR_SETUP str="Configuration data error, please re-check"/> <DEL_CAM_COFIRM str="Are you sure want to delete '%s' from list?"/> <ADD_CAM_ERR_ALREADY_HAS str="It's already has '%s' at list,please re-check Configuration"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Show Live Camera"/> <SHOW_PB_CAM str="Show Playback Camera"/> <DELETE_CAM str="Remove Camera display"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>) lang_english.xmlėRaR̗R<root> <Font Name="wenquanyi" /> <LanguageName str="English" /> <LanguageNameEng str="English" /> <Sch_Monitor str="Schedule Monitoring" /> <Alarm_Monitor str="Alarm Monitoring" /> <Week0 str="Sunday" /> <Week1 str="Monday" /> <Week2 str="Tuesday" /> <Week3 str="Wednesday" /> <Week4 str="Thursday" /> <Week5 str="Friday" /> <Week6 str="Saturday" /> <WeekS0 str="Sun" /> <WeekS1 str="Mon" /> <WeekS2 str="Tue" /> <WeekS3 str="Wed" /> <WeekS4 str="Thu" /> <WeekS5 str="Fri" /> <WeekS6 str="Sat" /> <Disk_Free str="Free" /> <Error str="Error" /> <LoginError str="Login error, no match user or incorrect password" /> <DeviceInfo str="Device Info" /> <DeviceTitle str="Device Title" /> <SoftwareVersion str="Software Version" /> <Characters str="Characters" /> <DateTimeInfo str="Date Time Info" /> <CurrentDate str="Current Date" /> <CurrentTime str="Current Time" /> <Adjust str="Adjust" /> <Manual str="Manual" /> <SyncNTP str="Synchronize with NTP" /> <Setting str="Setting" /> <NTPServer str="NTPServer" /> <Test str="Test" /> <NTPSyncInterval str="NTP Sync Interval" /> <Hour str="Hour" /> <Timezone str="Timezone" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="GMT-12 (Eniwetok, Kwajalein)" /> <Timezone3 str="GMT-11 (Midway Isl., Samoa)" /> <Timezone4 str="GMT-10 (Hawaii, Aleutian Isl.)" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="GMT-08 (Las Vegas, San Francisco, Vancouver)" /> <Timezone7 str="GMT-07 (Calgary, Denver, Salt Lake City)" /> <Timezone8 str="GMT-06 (Chicago, Dallas, Mexico City, New Orleans)" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="GMT-05 (New York, Toronto, Washington DC)" /> <Timezone11 str="GMT-04 (Paraguay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="GMT-04 (Charlottetown, Manaus)" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="GMT-03 (Brazilia, Sao Paulo)" /> <Timezone16 str="GMT-02 (Noronha, Mid-Atlantic)" /> <Timezone17 str="GMT-01 (Azores, Cap Verde Isl.)" /> <Timezone18 str="GMT (Dublin, Lisbon, London, Reykjavik)" /> <Timezone19 str="GMT+01 (Amsterdam, Berlin, Rome, Stockholm, Warsaw)" /> <Timezone20 str="GMT+02 (Athens, Helsinki, Istanbul, Riga)" /> <Timezone21 str="GMT+02 (Egypt)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lebanon)" /> <Timezone24 str="GMT+02 (Syria)" /> <Timezone25 str="GMT+03 (Moscow, Riyadh)" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Iran)" /> <Timezone28 str="GMT+04 (Abu Dubai, Baku)" /> <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="GMT+05 (Islamabad, Karachi, Tashkent)" /> <Timezone31 str="GMT+05:30 (Bombay, Calcutta, New Delhi)" /> <Timezone32 str="GMT+05:45 (Kathmandu)" /> <Timezone33 str="GMT+06 (Novosibirsk, Omsk)" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="GMT+07 (Bangkok, Hanoi, Jakarta)" /> <Timezone36 str="GMT+08 (Beijing, Hong Kong, Shanghai, Singapore, Taipei)" /> <Timezon  e37 str="GMT+09 (Seoul, Osaka, Sapporo, Tokyo)" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaide)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="GMT+10 (Canberra, Melbourne, Sydney)" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="GMT+12 (Auckland, Wellington)" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="GMT+13 (Tongatapu, Nuku'alofa)" /> <Timezone49 str="GMT+13:45 (Chatham" /> <DST str="Daylight Saving Time" /> <Disable str="Disable" /> <Enable str="Enable" /> <DSTStart str="Daylight Saving Time Start" /> <DSTEnd str="Daylight Saving Time End" /> <DSTOffset str="Daylight Saving Time Offset" /> <AutoLogin str="Auto Login" /> <UID str="Username" /> <PWD str="Password" /> <System str="System" /> <AutoFullScreen str="Auto Full Screen" /> <Language str="Language" /> <Audio str="Audio" /> <InputGain str="Input Gain" /> <OutputGain str="Output Gain" /> <KeyinNTPAddr str="Please Keyin NTP Server Address!" /> <Success str="Success" /> <Fault str="Fault" /> <OK str="OK" /> <Cancel str="Cancel" /> <SetDateTime str="Set Date Time" /> <Date str="Date" /> <Time str="Time" /> <AutoSetting str="Auto Setting" /> <CameraName str="Camera Name" /> <ModelName str="Model Name" /> <IPAddress str="IP Address" /> <HTTPPort str="HTTP Port" /> <RTSPPort str="RTSP Port" /> <Camera str="Camera" /> <Schedule str="Schedule" /> <Network str="Network" /> <User str="User" /> <MotionDetection str="Motion Detection" /> <Snapshot str="Snapshot" /> <Maintenance str="Maintenance" /> <Add str="Add" /> <Delete str="Delete" /> <Update str="Update" /> <Clear str="Clear" /> <Search str="Search" /> <AutoDetect str="Auto Detect" /> <Detect str="Detect" /> <MACAddress str="MAC Address" /> <Configuration str="Configuration" /> <Copy str="Copy" /> <StartT ime str="Start Time" /> <EndTime str="End Time" /> <RecordType str="Record Type" /> <PreAlarm str="PreAlarm" /> <PostAlarm str="PostAlarm" /> <RTC str="Round the Clock" /> <DIDetect str="DI Detection" /> <TimeSelErr str="Time range is incorrect!" /> <NoSelSch str="Please select one schedule!" /> <Warning str="Warning" /> <WeekCopyToAll str="All week schedule will the same with selected" /> <DHCP str="Obtain IP address automatically (DHCP)" /> <SubnetMask str="Subnet Mask" /> <Gateway str="Gateway" /> <DNS_DHCP str="Obtain DNS from DHCP" /> <PrimaryDNS str="Primary DNS" /> <SecondaryDNS str="Secondary DNS" /> <PPPoE str="PPPoE" /> <Status str="Status" /> <Start str="Start" /> <Stop str="Stop" /> <Server str="Server" /> <IPUsed str="This address is in use!" /> <IPNoUsed str="This address can use!" /> <Group str="Group" /> <Description str="Description" /> <ConfirmPWD str="Confirm Password" /> <LiveView str="Live View" /> <Playback str="Playback" /> <Reco rd str="Record" /> <PTZ str="PTZ" /> <TwoWayAudio str="Two Way Audio" /> <CheckConfirmPWD str="Please check confirm password again." /> <UIDEmpty str="Please edit username." /> <UIDRepeat str="You add the same user name. Please change it!" /> <NoSelUID str="Please select account!" /> <MotionID str="Motion ID" /> <Name str="Name" /> <Included str="Included" /> <Excluded str="Excluded" /> <ObjectSize str="Object Size" /> <Sensitivity str="Sensitivity" /> <NoSelCamera str="Please select Camera!" /> <OverMaxMotion10 str="The maximum motions is 10." /> <NoSelMotion str="Please select a motion." /> <MotionSettingEnpty str="Please fill motion setting first." /> <SourceSnapshotList str="Source Snapshot List" /> <SourceSnapshotPreview str="Source Snapshot Preview" /> <DestinationSnapshotList str="Destination Snapshot List" /> <DestinationSnapshotPreview str="Destination Snapshot Preview" /> <NoFindSD str="Please insert the SD Card!" /> <NoSelImg str="Please select Image!" /> <SameSnapshotImgName str="Have the same file name in SD card.Will replace the file!" /> <IsAutoSetting str="Do you want to auto setting the carmea now?" /> <GetParamError str="Get Parameter Error!" /> <CameraNameEmpty str="Please keyin Camera Name!" /> <IPAddressEmpty str="Please keyin IP Address!" /> <UIDEmpty str="Please keyin Username!" /> <HttpPortEmpty str="Please keyin Http Port!" /> <CameraNameTheSame str="Camera Name is the same!" /> <CamParam str="Camera Parameter" /> <Profile str="Profile" /> <FPS str="FPS" /> <Protocol str="Protocol" /> <EnableAudio str="Enable Audio" /> <AudioRecord str="Audio Record" /> <InputError str="Input Error" /> <DefaultSetting str="Default Setting" /> <FactoryDefaultSetting str="Factory Default Setting" /> <Default str="Default" /> <BackupSetting str="Backup Setting" /> <Backup str="Backup" /> <RestoreSetting str="Restore Setting" /> <Restore str="Restore" /> <FirmwareUpgrade str="Firmware Upgrade" /> <Upgrade str="Upgrade" /> <Browse str="Browse" /> <SystemRestart str="System Restart" /> <Restart str="Restart" /> <HDInformation str="Hard Disk Information" /> <SDInformation str="SD Card Information" /> <TotalCapacity str="Total Capacity" /> <FreeCapacity str="Free Capacity" /> <UsedCapacity str="Used Capacity" /> <UsedPercent str="Used Percent" /> <Format str="Format" /> <NoFind str="No Find" /> <NoMount str="No Mount" /> <IsDefaultSetting str="System will set the default setting include network ,please confirm this procedure" /> <NoBackupDevice str="Please insert external backup device." /> <NoFindConfigFile str="Can't find Configuration file." /> <ConfigFile str="Configuration file" /> <ConfigFileVerErr str="Configuration File Version Error." /> <IsRestart str="System will Restart ,please confirm this procedure." /> <NoFindFirmware str="Can't find any firmware!" /> <FirmwareFile str="Firmware File" /> <IsFormatHD str="All data will be lost , are you want to contiue." /> <OpenFirmwar  eUpgradeLogErr str="Can't open firmware_upgrade.log" /> <Playback str="Playback" /> <PlaybackTime str="Playback Time" /> <Play str="Play" /> <Reverse str="Reverse" /> <Pause str="Pause" /> <Wait str="Please Wait!" /> <Mute str="Mute" /> <LiveAudio str="LiveAudio" /> <PlaybackAudio str="Playback Audio" /> <ConvertToAvi str="Convert To Avi" /> <NoFindRecord str="No Find Record" /> <TimePeriod str="Time Period" /> <SaveTo str="Save To" /> <BackupDeviceFull str="Backup device maybe full, please check it." /> <SavePath str="Save Path" /> <Login str="Login" /> <Logout str="Logout" /> <PictureSet str="Picture Set" /> <Rotation str="Rotation" /> <Normal str="Normal" /> <Mirror str="Mirror" /> <VerticaFlip str="Vertica Flip" /> <ColorLevel str="Color Level" /> <Brightness str="Brightness" /> <Contrast str="Contrast" /> <Sharpness str="Sharpness" /> <RateControl str="Rate Control" /> <Quality str="Quality" /> <Bitrate str="Bitrate" /> <VideoOffset str="Video O  ffset" /> <De-Noise str="De-Noise" /> <None str="None" /> <Method str="Method" /> <AutoMode str="Auto Mode" /> <DayMode str="Day Mode" /> <NightMode str="Night Mode" /> <Base str="Base" /> <Picture str="Picture" /> <OutOfRange str="Out Of Range" /> <SystemClose str="System Shutdown ..." /> <On str="On" /> <Off str="Off" /> <Vendor str="Vendor" /> <ModelName str="Model Name" /> <FriendlyName str="Friendly Name" /> <UPnPTraversal str="UPnP Traversal" /> <PortRange str="Port Range" /> <ExternalIPAddress str="External IP Address" /> <Information str="Information" /> <SelOverPlayerMaxCam str="Select over %d camera!" /> <Event str="Event" /> <Event_List str="Event List" /> <Motion str="Motion" /> <DI str="Digital Input" /> <DO str="Digital Output" /> <Event_Schedule_List str="Event Schedule List" /> <Action_List str="Action List" /> <Alarm_Trigger_Type str="Alarm Type" /> <Alarm_Seconds str="Alarm Seconds" /> <Buzzer str="Buzzer" /> <UnKnow str="UnKnow"  /> <Display_On_CH str="Display on Channel" /> <Action_Type str="Action Type" /> <ERR_MSG_NO_CAM str="Please select a camera or local first!" /> <ERR_MSG_NO_EVENT str="Please select a event first!" /> <ERR_MSG_NO_EVENT_SCH str="Please select a event schedule first!" /> <ERR_MSG_NO_ACTION str="Please select a action first!" /> <ERR_MSG_TIME_PERIOD str="Time periods setting error, please check setting!" /> <ERR_MSG_TIME_CONFILT str="Time periods setting conflict, please check setting!" /> <WeekDays str="Week Days" /> <AlarmSetting str="Alarm Setting" /> <AlarmCondition str="Alarm Condition" /> <Alarm_True str="True" /> <Alarm_False str="False" /> <Alarm_Seconds str="Alarm Seconds" /> <Alarm_Manual_Stop str="Manual Stop" /> <Local str="Local" /> <DI_Setting str="DI Setting" /> <System_Setting str="System Setting" /> <Log_Viewer str="Log Viewer" /> <Event_Log str="Event Log" /> <Device str="Device" /> <Log_Type str="Log Type" /> <Motion_Alarm str="Motion Alarm" />    <DI_Alarm str="DI Alarm" /> <Input str="Input" /> <Limit_Record str="Limit Record" /> <Remark str="Remark" /> <Total str="Total" /> <HDD_Err_Alarm str="HDD Error Alarm" /> <Disconnect_Alarm str="Disconnect Alarm" /> <Schedule_Trigger str="Schedule Trigger" /> <Block_Alarm str="Block Alarm" /> <Blur_Alarm str="Blur Alarm" /> <Camera_Move_Alarm str="Camera Move Alarm" /> <Address_Book str="Address Book" /> <Phone str="Phone" /> <E_MAIL str="E-Mail" /> <Notification str="Notification" /> <SMTP_Config str="SMTP Setting" /> <SMTP_Server str="Server" /> <SMTP_Port str="Port" /> <From str="From" /> <SendMailWithoutPicture str="Send Mail Without Picture" /> <ServerRequireAuthentication str="Server Require Authentication" /> <SSL str="Server Require Secure Conntion(SSL)" /> <Send_Test str="Send Test" /> <FTP_Config str="FTP Setting" /> <FTP_Server str="Server" /> <FTP_Port str="Port" /> <Retry str="Retry" /> <RecycleDays str="RecycleDays" /> <RecycleSize str="Rec ycleSize" /> <Path str="Path" /> <AllowCreateFolder str="Allow Create Folder" /> <HTTP_Config str="HTTP Setting" /> <HTTP_IP str="IP" /> <HTTP_UID str="Account" /> <HTTP_PWD str="Password" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Proxy Address" /> <Proxy_UID str="Proxy Account" /> <Proxy_PWD str="Proxy Password" /> <Proxy_Port str="Proxy Port" /> <TCP_Config str="TCP Setting" /> <TCP_Server str="Server" /> <TCP_Port str="Port" /> <Alarm_Config str="Alarm Setting" /> <frame str="Frame" /> <SnapshotInterval str="Snapshot Interval" /> <SendInterval str="Send Interval" /> <SnapshotTempFolder str="Snapshot Temp Folder" /> <Mail str="Mail" /> <Subject str="Subject" /> <body str="Body" /> <MS str="MS" /> <second str="Second" /> <EventDetect str="Event Detection" /> <EventForceRecord str="Event Force Record" /> <EventSetting str="Event Setting" /> <MergeSeconds str="Merge Seconds" /> <Display str="Display" /> <Division str="Division" /> <FullScreen str="Full Screen" /> <ResetDIVDefault str="Reset Division Default" /> <CancelFullScreen str="Cancel Full Screen" /> <Function str="Function" /> <SystemManagement str="System Management" /> <PTZControl str="PTZControl" /> <Volume str="Volume" /> <Monitor str="Monitor" /> <CancelMute str="Cancel Mute" /> <TwoWayAudioON str="Start Two Way Audio" /> <TwoWayAudioOFF str="Stop Two Way Audio" /> <Resolution str="Resolution" /> <Style str="Style" /> <Simple str="Simple" /> <Professional str="Professional" /> <Output str="Output" /> <SettoOpen str="Set to Open" /> <SettoClose str="Set to Close" /> <Preset str="Preset" /> <Zoom str="Zoom" /> <Wide str="Wide" /> <Tele str="Tele" /> <Advanced str="Advanced" /> <IsDeletePreset str="Press 'OK' will Delete Preset." /> <System_Log str="System Log" /> <PTZ_SPEED str="PTZ Speed" /> <PTZ_HOME str="PTZ Home" /> <PTZ_UP str="PTZ Up" /> <PTZ_DOWN str="PTZ Down" /> <PTZ_LEFT str="PTZ Left" /> <PTZ_RIGHT str="PTZ Right" />  <PTZ_UP_RIGHT str="PTZ Up Right" /> <PTZ_UP_LEFT str="PTZ Up Left" /> <PTZ_DOWN_LEFT str="PTZ Down Left" /> <PTZ_DOWN_RIGHT str="PTZ Down Right" /> <PTZ_TOUR_GO str="PTZ Tour Go" /> <PTZ_TOUR_STOP str="PTZ Tour Stop" /> <PTZ_FOCUS_UP str="PTZ Focus Up" /> <PTZ_FOCUS_DOWN str="PTZ Focus Down" /> <PTZ_IRIS_UP str="PTZ Iris Up" /> <PTZ_IRIS_DOWN str="PTZ Iris Down" /> <PTZ_FOCUS_AUTO str="PTZ Auto Focus" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="PTZ Navigation Start" /> <PTZ_AUTOPAN_STOP str="PTZ Navigation Stop" /> <PTZ_ZOOM_IN str="PTZ Zoom In" /> <PTZ_ZOOM_OUT str="PTZ Zoom Out" /> <SYS_LOG_SYSTEM_INIT str="System Initialization" /> <SYS_LOG_SYSTEM_SHUTDOWN str="System Shutdown" /> <SYS_LOG_USER_LOGIN str="User Login" /> <SYS_LOG_USER_LOGOUT str="User Logout" /> <SYS_LOG_START_SCH_REC str="Start Record Schedule" /> <SYS_LOG_END_SCH_REC str="End Record Schedule" /> <SYS_LOG_START_SCH_ALARM str="Start Alarm Schedule" /> <SYS_LOG_END_SCH_AL*ARM str="End Alarm Schedule" /> <SYS_LOG_ENTER_SYS_SETUP str="Enter System Setup" /> <SYS_LOG_EXIT_SYS_SETUP str="Exit System Setup" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Enter Record Schedule Setup" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Exit Record Schedule Setup" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Enter Alarm Schedule Setup" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Exit Alarm Schedule Setup" /> <SYS_LOG_RTSP_GET_CONNECT str="Get Connection" /> <SYS_LOG_RTSP_LOSE_CONNECT str="Lost Connection" /> <SYS_LOG_SERVER_HTTP_START str="HTTP Server Start" /> <SYS_LOG_SERVER_HTTP_STOP str="HTTP Server Stop" /> <SYS_LOG_SERVER_RTSP_START str="RTSP Server Start" /> <SYS_LOG_SERVER_RTSP_STOP str="RTSP Server Stop" /> <SYS_LOG_SERVER_RPB_START str="Remote Playback Server Start" /> <SYS_LOG_SERVER_RPB_STOP str="Remote Playback Server Stop" /> <DiskManagement str="Disk Management" /> <DeviceType str="Device Type" /> <Partition str="Partition" /> <FileSystem str="FileSystem" /> <IsPartition? str="System will re-creat Partition, please confirm this procedure." /> <Image str="Image" /> <Brightness str="Brightness" /> <Contrast str="Contrast" /> <Saturation str="Saturation" /> <Sharpness str="Sharpness" /> <Hue str="Hue" /> <NoSeldesti str="Please select Destination!" /> <NoSelSource str="Please select Source List!" /> <Time_Range str="File Time Range" /> <Event_Snapshot str="Event Snapshot" /> <EventSnapshotViewer str="Event Snapshot Viewer" /> <Event_Time str="Event Time" /> <Event_Type str="Event Type" /> <Change_Resolution str="Resolution has been changed, please click 'OK' to confirm." /> <Select_All str="Select All" /> <InitNetowrk str="Network Module Initialize" /> <InitSystemDate str="Date Time Module Initialize" /> <InitDisk str="Disk Module Initialize" /> <InitRTSP str="RTSP Module Initialize" /> <NoVideo str="No Video" /> <Modify str="Modify" /> <DisplayCount str="Display Count" /> <Mount str="Mount" /> <Unmount str="Unmount" /> <EditEmpt< y str="Please confirm the settings are correct!" /> <Account str="Account" /> <FindListLog str="Found over %d records , Display first %d record only." /> <Trigger_Interval_Seconds str="Trigger Interval Seconds" /> <Alarm_Always str="Always Alarm" /> <LowFPS str="Low Bitrate FPS" /> <WithFPS str="As above" /> <ShowPW str="Show Password" /> <SelOverMaxPlayHours str="Selected over %d hours" /> <SelectedCamera str="Selected Camera" /> <Codec str="Codec" /> <Switchto str="Switch to" /> <Filter str="Filter" /> <AutoSettingNote str="Please enter the filtering rule or keep empty to search all" /> <TemplateSetting str="Template Setting" /> <SearchByEvent str="Search By Event" /> <Control str="Control" /> <SwitchCamera str="Switch Camera" /> <Preview str="Preview" /> <SequentialSearch str="Sequential Search" /> <Split str="Split" /> <PreSearch str="Pre Search" /> <SeekTo str="Seek To" /> <ShowInformation str="Show Information" /> <Bitrate_Log str="Bitrate Log" /> <Save )str="Save" /> <PlaybackControlPad str="Playback Control Pad" /> <FormatFault str="Format Fault" /> <LowBitrateSetting str="Low Bitrate Setting"/> <NotConfigured str="Not Configured"/> <Application str="Application"/> <NameOrMailEmpty str="Name or E-Mail is empty"/> <ONVIF_Auth str="ONVIF Authentication"/> <PIR_Alarm str="PIR Alarm"/> <CameraTamper str="Camera Tamper"/> <AudioDetection str="Audio Detection"/> <AutoSwitch str="Auto Switch"/> <CancelAutoSwitch str="Cancel Auto Switch"/> <MailRepeat str="You add the same E-Mail. Please change it!"/> <SMART str="S.M.A.R.T"/> <OVERALL str="Over all"/> <PASSED str="PASSED"/> <FAILED str="FAILED"/> <Raw_Read_Error_Rate str="Raw Read Error Rate"/> <Throughput_Performance str="Throughput Performance"/> <Spin_Up_Time str="Spin Up Time"/> <Start_Stop_Count str="Start Stop Count"/> <Reallocated_Sector_Ct str="Reallocated Sectors Count"/> <Seek_Error_Rate str="Seek Error Rate"/> <Seek_Time_Performance str="Seek Time Performan3 ce"/> <Power_On_Hours str="Power On Hours"/> <Spin_Retry_Count str="Spin Retry Count"/> <Calibration_Retry_Count str="Calibration Retry Count"/> <Power_Cycle_Count str="Power Cycle Count"/> <Power_Off_Retract_Count str="Power Off Retract Count"/> <Load_Cycle_Count str="Load Cycle Count"/> <Temperature_Celsius str="Temperature Celsius"/> <Reallocated_Event_Count str="Reallocated Event Count"/> <Current_Pending_Sector str="Current Pending Sector"/> <Offline_Uncorrectable str="Offline Uncorrectable"/> <UDMA_CRC_Error_Count str="UDMA CRC Error Count"/> <Multi_Zone_Error_Rate str="Multi Zone Error Rate"/> <SMART_RAW_VALUE str="Raw Value"/> <SMART_WORST str="Reference"/> <SMART_Event str="HDD S.M.A.R.T"/> <DisplayRatio str="Display Ratio"/> <FitWindow str="Fit Window"/> <KeepRatio str="Keep Ratio"/> <Joystick str="Joystick"/> <Joystick_Information str="Joystick Information"/> <Joystick_Model str="Joystick Model"/> <Axis_Count str="Axis Count"/> <Button_Count str="Butt&on Count"/> <Axis_X str="Axis X Value"/> <Axis_Y str="Axis Y Value"/> <Axis_Z str="Axis Z Value"/> <Buttons_Status str="Buttons Status"/> <Joystick_Buttons_Setting str="Joystick Buttons Setting"/> <Button str="Button"/> <Next_Division str="Next Division"/> <Previous_Division str="Previous Division"/> <Next_Window str="Next Window"/> <Previous_Window str="Previous Window"/> <Switch_Division_One str="Switch Division One"/> <Axis_Z_ID str="Axis Z ID"/> <RAID_Err_Alarm str="RAID Error Alarm"/> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePosition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Lost Connect"/> <ConnectFail str="Connect Fail"/> <GetSettingValueErr str="Can't Get Setting Value!"/> <Refresh str="Pl%ease Refresh!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Backuping, Please wait."/> <Converting str="Converting. Please wait."/> <ShowDate str="Show Date"/> <ShowTime str="Show Time"/> <Subtitle str="Subtitle"/> <PreSecond str="Pre Second"/> <PreFrame str="Pre Frame"/> <NextSecond str="Next Second"/> <NextFrame str="Next Frame"/> <LowBitrate str="Low LowBitrate"/> <DigitalZoom str="Digital Zoom" /> <MotionSearch str="Motion Search" /> <TimeSplit str="Time Split" /> <ShowDetailWindow str="Show Detail Window" /> <FirstPage str="First Page" /> <PrePage str="Pre Page" /> <NextPage str="Next Page" /> <LastPage str="Last Page" /> <DetailPicture str="Detail Picture" /> <SelectTime str="Select Time" /> <ErrStartEndTm str="Error Start Time or End Time!" /> <SearchSet str="Search Setting" /> <ShowSearchImage str="Show Search Image" /> <ShowDetectMark str="Show Detect Mark" /> <DetectInterval str0 ="Detect Interval" /> <Exit str="Exit" /> <Grayscale str="Grayscale" /> <Softness str="Softness" /> <Reset str="Reset" /> <Print str="Print" /> <RetryAgain str="Please try again later!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Two Way Audio Used!"/> <Weekly str="Weekly"/> <SAVEAS str="Save As..."/> <Send_To str="Send to"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTION_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Display Message on Live Preview"/> <ACTION_DESC_MAIL str="Send Notice Mail on Event Triggered"/> <ACTION_DESC_VOICE str="Play Alarm Sound on Event Triggered"/> <ACTION_DESC_DO str="Trigger Digital Output on Event Triggered"/> <ACTION_DESC_FTP str="Upload Images To FTP Site"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggere0 d"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Detect the image motoin status"/> <EVENT_DESC_BLOCK str="Detect camera blocked"/> <EVENT_DESC_BLUR str="Detect camera disfocus"/> <EVENT_DESC_CAM_MOVE str="Detect camera direction moved"/> <EVENT_DESC_DI str="Detect digital inuput change status"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera disconnected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Alarm Event Selection"/> <CREATE_NEW_FOLDER str="Create New Folder"/> <CHANGE_NAME str="Change Name"/> <TIME_SET_ERROR str="Time setting error, please check time setting"/> <Export str="Export"/> <SEL_VIEW_CH str="Select View Channel"/> % <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Start Monitor All"/> <UPDATE_FAIL str="Can not upload setting , please try again later!"/> <DI_REC_TRIGGER str="DI Record trigger by:"/> <PASTE str="Paste"/> <PASTE_MON_FRI str="Paste on Monday to Friday"/> <PASTE_SAT_SUN str="Paste on Saturday to Sunday"/> <PASTE_ALL_CAM str="Paste to all camera"/> <APPLY_ALL str="Apply all"/> <UN_SELECT_ALL str="Cancel all"/> <GET_PARAM_FAIL_USE_DEFAULT str="Get Device Parameter Fail , System will use default value!"/> <NO_CAM_NAME str="Camera name is empty, Do you want to use default name?"/> <ERR_SETUP str="Configuration data error, please re-check"/> <DEL_CAM_COFIRM str="Are you sure want to delete '%s' from list?"/> <ADD_CAM_ERR_ALREADY_HAS str="It's already has '%s' at list,please re-check Configuration"/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Show Live Camera"/> <SHOW_PB_CAM str="Show P&layback Camera"/> <DELETE_CAM str="Remove Camera display"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root> 0 lang_spanish.xmlėRHR̗R0<root> <Font Name="DejaVu Sans" /> <LanguageName str="Espaol" /> <LanguageNameEng str="Spanish" /> <Sch_Monitor str="Programacin de monitoreo" /> <Alarm_Monitor str="Monitoreo de alarma" /> <Week0 str="Domingo" /> <Week1 str="Lunes" /> <Week2 str="Martes" /> <Week3 str="Mircoles" /> <Week4 str="Jueves" /> <Week5 str="Viernes" /> <Week6 str="Sbado" /> <WeekS0 str="Domingo" /> <WeekS1 str="Lunes" /> <WeekS2 str="Martes" /> <WeekS3 str="Mircoles" /> <WeekS4 str="Jueves" /> <WeekS5 str="Viernes" /> <WeekS6 str="Sbado" /> <Disk_Free str="Gratuito" /> <Error str="Error" /> <LoginError str="&amp;quot;Error de inicio de sesin, usuario o contrasea incorrectos&amp;quot;" /> <DeviceInfo str="Informacin del dispositivo" /> <DeviceTitle str="Titulo del dispositivo" /> <SoftwareVersion str="Versin de software" /> <Characters str="Caracteres" /> <DateTimeInfo str="Fecha Hora Informacin" /> <CurrentDate str="Fecha actual" /> <CurrentTime str="Hora actual" /> <Adjust str="Ajustar" /> <Manual str="Manual" /> <SyncNTP str="Sincronizar con NTP" /> <Setting str="Ajuste" /> <NTPServer str="Servidor NTP" /> <Test str="Prueba" /> <NTPSyncInterval str="Intervalo NTP sincronizado " /> <Hour str="Hora" /> <Timezone str="Zona horaria" /> <Timezone0 str="GMT-14" /> <Timezone1 str="GMT-13" /> <Timezone2 str="&amp;quot;GMT-12 (Eniwetok, Kwajalein)&amp;quot;" /> <Timezone3 str="&amp;quot;GMT-11 (Midway Isl., Samoa)&amp;quot;" /> <Timezone4 str="&amp;quot;GMT-10 (Hawaii, Aleutiana Isla.)&amp;quot;" /> <Timezone5 str="GMT-09 (Alaska)" /> <Timezone6 str="&amp;quot;GMT-08 (Las Vegas, San Francisco, Vancouver)&amp;quot;" /> <Timezone7 str="&amp;quot;GMT-07 (Calgary, Denver, Salt Lake City)&amp;quot;" /> <Timezone8 str="&amp;quot;GMT-06 (Chicago, Dallas, Mxico City, New Orleans)&amp;quot;" /> <Timezone9 str="GMT-05 (Cuba)" /> <Timezone10 str="&amp;quot;GMT-05 (Nueva York, Toronto, Washington DC)&amp;quot;" /> <Timezone11 str="GMT-04 (Parag uay)" /> <Timezone12 str="GMT-04 (Chile)" /> <Timezone13 str="&amp;quot;GMT-04 (Charlottetown, Manaos)&amp;quot;" /> <Timezone14 str="GMT-03:30 (Newfoundland)" /> <Timezone15 str="&amp;quot;GMT-03 (Brasilia, San Pablo)&amp;quot;" /> <Timezone16 str="&amp;quot;GMT-02 (Noronha, Mid-Atlantic)&amp;quot;" /> <Timezone17 str="&amp;quot;GMT-01 (Islas Azores, Cabo Verde)&amp;quot;" /> <Timezone18 str="&amp;quot;GMT (Dubln, Lisboa, Londres, Reikiavik)&amp;quot;" /> <Timezone19 str="&amp;quot;GMT+01 (Amsterdam, Berln, Roma, Estocolmo, Warsaw)&amp;quot;" /> <Timezone20 str="&amp;quot;GMT+02 (Atenas, Helsinki, Estambul, Riga)&amp;quot;" /> <Timezone21 str="GMT+02 (Egipto)" /> <Timezone22 str="GMT+02 (Israel)" /> <Timezone23 str="GMT+02 (Lbano)" /> <Timezone24 str="GMT+02 (Siria)" /> <Timezone25 str="&amp;quot;GMT+03 (Mosc, Riyadh)&amp;quot;" /> <Timezone26 str="GMT+03 (Iraq)" /> <Timezone27 str="GMT+03:30 (Irn)" /> <Timezone28 str="&amp;quot;GMT+04 (Abu Dubai, Baku)&amp;quot;" />  <Timezone29 str="GMT+04:30 (Kabul)" /> <Timezone30 str="&amp;quot;GMT+05 (Islamabad, Karachi, Tashkent)&amp;quot;" /> <Timezone31 str="&amp;quot;GMT+05:30 (Bombay, Calcutta, New Delhi)&amp;quot;" /> <Timezone32 str="GMT+05:45 (Katmand)" /> <Timezone33 str="&amp;quot;GMT+06 (Novosibirsk, Omsk)&amp;quot;" /> <Timezone34 str="GMT+06:30 (Rangoon)" /> <Timezone35 str="&amp;quot;GMT+07 (Bangkok, Hani, Yakarta)&amp;quot;" /> <Timezone36 str="&amp;quot;GMT+08 (Beijing, Hong Kong, Shanghi, Singapur, Taipei)&amp;quot;" /> <Timezone37 str="&amp;quot;GMT+09 (Sel, Osaka, Sapporo, Tokio)&amp;quot;" /> <Timezone38 str="GMT+09:30 (Darwin)" /> <Timezone39 str="GMT+09:30 (Adelaida)" /> <Timezone40 str="GMT+10 (Hobart)" /> <Timezone41 str="&amp;quot;GMT+10 (Canberra, Melbourne, Sydney)&amp;quot;" /> <Timezone42 str="GMT+11 (Solomon Isl.)" /> <Timezone43 str="GMT+11:30 (Norfolk)" /> <Timezone44 str="&amp;quot;GMT+12 (Auckland, Wellington)&amp;quot;" /> <Timezone45 str="GMT+12 (Fiji)" /> <Timezone46 str="GMT+12 (Kamchatka)" /> <Timezone47 str="GMT+12 (Marshall Isl.)" /> <Timezone48 str="&amp;quot;GMT+13 (Tongatapu, Nuku'alofa)&amp;quot;" /> <Timezone49 str="GMT+12:45 (Chatham Island)" /> <DST str="Tiempo de ahorro de luz" /> <Disable str="Habilitar" /> <Enable str="Deshabilitar" /> <DSTStart str="Comenzar tiempo de ahorro de luz" /> <DSTEnd str="Finalizar tiempo de ahorro de luz" /> <DSTOffset str="Offset tiempo de ahorro de luz" /> <AutoLogin str="Conexin automtica" /> <UID str="Nombre de usuario" /> <PWD str="Contrasea" /> <System str="Sistema" /> <AutoFullScreen str="Pantalla completa automtica" /> <Language str="Idioma" /> <Audio str="Audio" /> <InputGain str="Ganancia de entrada" /> <OutputGain str="Ganancia de salida" /> <KeyinNTPAddr str="Por favor reingrese la direccin del servidor NTP" /> <Success str="Exitosa" /> <Fault str="Fall" /> <OK str="OK" /> <Cancel str="Cancelar" /> <SetDateTime str="Establecer fecha y hora" /> <Date str=" Fecha" /> <Time str="Hora" /> <AutoSetting str="Auto Ajuste" /> <CameraName str="Nombre de cmara" /> <ModelName str="Nombre de modelo" /> <IPAddress str="Direccin IP" /> <HTTPPort str="Puerto HTTP" /> <RTSPPort str="Puerto RTSP" /> <Camera str="Cmara" /> <Schedule str="Programa" /> <Network str="Red" /> <User str="Usuario" /> <MotionDetection str="Deteccin de movimientos" /> <Snapshot str="Instantnea" /> <Maintenance str="Mantenimiento" /> <Add str="Agregar" /> <Delete str="Borrar" /> <Update str="Actualizar" /> <Clear str="Despejar" /> <Search str="Bsqueda" /> <AutoDetect str="Deteccin automtica" /> <Detect str="Detectar" /> <MACAddress str="Direccin MAC" /> <Configuration str="Configuracin" /> <Copy str="Copiar" /> <StartTime str="Hora de comienzo" /> <EndTime str="Hora de finalizacin" /> <RecordType str="Tipo de grabacin" /> <PreAlarm str="Alarma previa" /> <PostAlarm str="Alarma posterior" /> <RTC str="Todo el da" /> <DIDetect str= "Deteccin DI" /> <TimeSelErr str="El rango de tiempo es incorrecto!" /> <NoSelSch str="Por favor seleccione una programacin!" /> <Warning str="Advertencia" /> <WeekCopyToAll str="Todos los programas semanales sern iguales al seleccionado" /> <DHCP str="Obtener la direccin IP automticamente (DHCP) " /> <SubnetMask str="Mscara de subred" /> <Gateway str="Gateway" /> <DNS_DHCP str="Obtener DNS desde DHCP" /> <PrimaryDNS str="DNS Primaria" /> <SecondaryDNS str="DNS Secundaria" /> <PPPoE str="PPPoE" /> <Status str="Estado" /> <Start str="Comienzo" /> <Stop str="Detener" /> <Server str="Servidor" /> <IPUsed str="Esta direccin ya est en uso!" /> <IPNoUsed str="Esta direccin puede usarse!" /> <Group str="Grupo" /> <Description str="Descripcin" /> <ConfirmPWD str="Confirmar contrasea" /> <LiveView str="Visualizacin en vivo" /> <Playback str="Reproduccin" /> <Record str="Grabacin" /> <PTZ str="PTZ" /> <TwoWayAudio str="Audio doble va " /> <CheckConfirmPWD str="Por favor confirmar la contrasea nuevamente" /> <UIDEmpty str="Por favor editar el nombre de usuario" /> <UIDRepeat str="Usted agreg el mismo nombre de usuario. Por favor cmbielo!" /> <NoSelUID str="Por favor seleccione una cuenta!" /> <MotionID str="Identificacin de movimiento" /> <Name str="Nombre" /> <Included str="Incluido" /> <Excluded str="Excluido" /> <ObjectSize str="Tamao del objeto" /> <Sensitivity str="Sensibilidad" /> <NoSelCamera str="Por favor seleccione una cmara!" /> <OverMaxMotion10 str="El mximo de movimientos es 10" /> <NoSelMotion str="Por favor seleccione un movimiento" /> <MotionSettingEnpty str="Por favor complete el ajuste de movimiento primero" /> <SourceSnapshotList str="Lista de instantneas" /> <SourceSnapshotPreview str="Vista previa de instantneas" /> <DestinationSnapshotList str="Lista de destino de instantneas " /> <DestinationSnapshotPreview str="Destino de vista previa de instantneas" /> <NoFindSD str="Por favor inserte la tarjeta SD!" /> <NoSelImg str="Por favor seleccione una imagen!" /> <SameSnapshotImgName str="Tiene el mismo nombre de archivo en la tarjeta SD. Remplazar el archivo!" /> <IsAutoSetting str="Desea realizar el ajuste automtico de la cmara ahora?" /> <GetParamError str="Obtuvo error en el parmetro!" /> <CameraNameEmpty str="Por favor ingrese el nombre de cmara!" /> <IPAddressEmpty str="Por favor ingrese la direccin IP!" /> <UIDEmpty str="Por favor ingrese el nombre de usuario!" /> <HttpPortEmpty str="Por favor ingrese el puerto HTTP!" /> <CameraNameTheSame str="El nombre de la cmara es el mismo!" /> <CamParam str="Parmetro de cmara" /> <Profile str="Perfil" /> <FPS str="FPS" /> <Protocol str="Protocolo" /> <EnableAudio str="Habilitar audio" /> <AudioRecord str="Grabacin de audio" /> <InputError str="Error de ingreso" /> <DefaultSetting str="Configuracin predeterminada" /> <FactoryDefaultSetting str="Configuracin predeterminada de fbrica" /> <D  efault str="Predeterminada" /> <BackupSetting str="Configuracin de respaldo" /> <Backup str="Respaldo" /> <RestoreSetting str="Restaurar configuracin " /> <Restore str="Restaurar" /> <FirmwareUpgrade str="Actualizacin de firmware" /> <Upgrade str="Actualizacin" /> <Browse str="Navegar" /> <SystemRestart str="Reinicio de sistema" /> <Restart str="Reiniciar" /> <HDInformation str="Informacin de disco rgido" /> <SDInformation str="Informacin de tarjeta SD" /> <TotalCapacity str="Capacidad total" /> <FreeCapacity str="Capacidad libre" /> <UsedCapacity str="Capacidad utilizada" /> <UsedPercent str="Porcentaje utilizado" /> <Format str="Formato" /> <NoFind str="No encontrado" /> <NoMount str="Sin montaje" /> <IsDefaultSetting str="&amp;quot;El sistema establecer la configuracin predeterminada incluyendo la red, por favor confirme este procedimiento&amp;quot;" /> <NoBackupDevice str="Por favor inserte el dispositivo de respaldo externo" /> <NoFindConfigFile str="No   se puede encontrar el archivo de configuracin" /> <ConfigFile str="Archivo de configuracin" /> <ConfigFileVerErr str="Error en la versin del archivo de configuracin " /> <IsRestart str="&amp;quot;El sistema se reiniciar, por favor confirme este procedimiento&amp;quot;" /> <NoFindFirmware str="No se puede encontrar el firmware!" /> <FirmwareFile str="Archivo de firmware" /> <IsFormatHD str="&amp;quot;Se perdern todos los datos, desea continuar?&amp;quot;" /> <OpenFirmwareUpgradeLogErr str="No se puede abrir firmware_upgrade.log" /> <Playback str="Reproduccin" /> <PlaybackTime str="Tiempo de reproduccin" /> <Play str="Reproducir" /> <Reverse str="Marcha atrs" /> <Pause str="Pausa" /> <Wait str="Aguarde por favor!" /> <Mute str="Silencio" /> <LiveAudio str="Audio en vivo" /> <PlaybackAudio str="Reproduccin de audio" /> <ConvertToAvi str="Convertir a AVI" /> <NoFindRecord str="No se encontr la grabacin" /> <TimePeriod str="Perodo de tiempo" /> <SaveTo str="G uardar a" /> <BackupDeviceFull str="&amp;quot;Dispositivo de respaldo posiblemente completo, por favor revselo&amp;quot;" /> <SavePath str="Guardar la ruta" /> <Login str="Conectarse" /> <Logout str="Desconectarse" /> <PictureSet str="Establecer imagen" /> <Rotation str="Rotacin" /> <Normal str="Normal" /> <Mirror str="Espejo" /> <VerticaFlip str="Voltear verticalmente" /> <ColorLevel str="Nivel de color" /> <Brightness str="Brillo" /> <Contrast str="Contraste" /> <Sharpness str="Nitidez" /> <RateControl str="Control de la frecuencia" /> <Quality str="Calidad" /> <Bitrate str="Promedio de bit" /> <VideoOffset str="Video Offset" /> <De-Noise str="De-ruido" /> <None str="Ninguno" /> <Method str="Mtodo" /> <AutoMode str="Modo automtico" /> <DayMode str="Modo da" /> <NightMode str="Modo noche" /> <Base str="Base" /> <Picture str="Imagen" /> <OutOfRange str="Fuera de rango" /> <SystemClose str="Apagando sistema& " /> <On str="Encendido" /> <Off str="Apa  gado" /> <Vendor str="Fabricante" /> <ModelName str="Nombre de modelo" /> <FriendlyName str="Nombre amigable" /> <UPnPTraversal str="UPnP Trasversal" /> <PortRange str="Rango de puerto" /> <ExternalIPAddress str="Direccin IP externa" /> <Information str="Informacin" /> <SelOverPlayerMaxCam str="Seleccione ms %d cmaras!" /> <Event str="Evento" /> <Event_List str="Lista de eventos" /> <Motion str="Movimiento" /> <DI str="Entrada digital" /> <DO str="Salida digital" /> <Event_Schedule_List str="Lista de programa de eventos" /> <Action_List str="Lista de acciones" /> <Alarm_Trigger_Type str="Tipo de alarma" /> <Alarm_Seconds str="Segundos de alarma" /> <Buzzer str="Zumbador" /> <UnKnow str="Desconocido" /> <Display_On_CH str="Mostrar en canal" /> <Action_Type str="Tipo de accin" /> <ERR_MSG_NO_CAM str="Por favor seleccione una cmara o local primero! " /> <ERR_MSG_NO_EVENT str="Por favor seleccione un evento primero!" /> <ERR_MSG_NO_EVENT_SCH str="Por favor   seleccione un programa de eventos primero!" /> <ERR_MSG_NO_ACTION str="Por favor seleccione una accin primero!" /> <ERR_MSG_TIME_PERIOD str="&amp;quot;Error en la configuracin de perodos de tiempo, por favor revise la configuracin!&amp;quot;" /> <ERR_MSG_TIME_CONFILT str="&amp;quot;Conflicto en la configuracin de perodos de tiempo, por favor revsela!&amp;quot;" /> <WeekDays str="Das de la semana" /> <AlarmSetting str="Configuracin de alarma" /> <AlarmCondition str="Condicin de alarma" /> <Alarm_True str="VERDADERO" /> <Alarm_False str="FALSO" /> <Alarm_Seconds str="Segundos de alarma" /> <Alarm_Manual_Stop str="Detencin manual" /> <Local str="Local" /> <DI_Setting str="Configuracin DI" /> <System_Setting str="Configuracin de sistema" /> <Log_Viewer str="Visualizador de sesin" /> <Event_Log str="Registro de eventos" /> <Device str="Dispositivo" /> <Log_Type str="Tipo de registro" /> <Motion_Alarm str="Alarma de movimiento" /> <DI_Alarm str="Alarma DI" /> <Input str="Ingreso" /> <Limit_Record str="Grabacin limitada" /> <Remark str="Observacin" /> <Total str="Total" /> <HDD_Err_Alarm str="Alarma de error HDD" /> <Disconnect_Alarm str="Alarma desconectada" /> <Schedule_Trigger str="Programacin de disparos" /> <Block_Alarm str="Bloqueo de alarma" /> <Blur_Alarm str="Alarma de borroneo" /> <Camera_Move_Alarm str="Alarma de movimiento de cmara" /> <Address_Book str="Libro de direcciones" /> <Phone str="Telfono" /> <E_MAIL str="E-Mail" /> <Notification str="Notificacin" /> <SMTP_Config str="Configuracin SMTP" /> <SMTP_Server str="Servidor" /> <SMTP_Port str="Puerto" /> <From str="Desde" /> <SendMailWithoutPicture str="Enviar mail sin imagen" /> <ServerRequireAuthentication str="El servidor requiere autenticacin" /> <SSL str="El servidor requiere una conexin segura (SSL)" /> <Send_Test str="Enviar prueba" /> <FTP_Config str="Configuracin FTP" /> <FTP_Server str="Servidor" /> <FTP_Port str="Puerto" /> <Ret ry str="Reintentar" /> <RecycleDays str="Das de reciclado" /> <RecycleSize str="Tamao de reciclado" /> <Path str="Camino" /> <AllowCreateFolder str="Permitir la creacin de carpeta" /> <HTTP_Config str="Configuracin HTTP" /> <HTTP_IP str="IP" /> <HTTP_UID str="Cuenta" /> <HTTP_PWD str="Contrasea" /> <HTTP_CGI str="CGI" /> <Proxy_Address str="Direccin de Proxy" /> <Proxy_UID str="Cuenta de Proxy" /> <Proxy_PWD str="Contrasea de Proxy" /> <Proxy_Port str="Puerto de Proxy" /> <TCP_Config str="Configuracin de TCP" /> <TCP_Server str="Servidor" /> <TCP_Port str="Puerto " /> <Alarm_Config str="Configuracin de alarma" /> <frame str="Cuadro" /> <SnapshotInterval str="Intervalo de instantnea" /> <SendInterval str="Enviar intervalo" /> <SnapshotTempFolder str="Carpeta de instantneas temporarias" /> <Mail str="Mail" /> <Subject str="Asunto" /> <body str="Cuerpo" /> <MS str="MS" /> <second str="Segundo" /> <EventDetect str="Deteccin de evento" /> <EventFo?rceRecord str="Forzar grabacin de eventos" /> <EventSetting str="Configuracin de evento" /> <MergeSeconds str="Combinar segundos" /> <Display str="Mostrar" /> <Division str="Divisin" /> <FullScreen str="Pantalla completa" /> <ResetDIVDefault str="Restablecer divisin por defecto" /> <CancelFullScreen str="Cancelar pantalla completa" /> <Function str="Funcin" /> <SystemManagement str="Administracin de sistema" /> <PTZControl str="Control de PTZ" /> <Volume str="Volumen" /> <Monitor str="Monitor" /> <CancelMute str="Cancelar silencio" /> <TwoWayAudioON str="Iniciar audio doble va" /> <TwoWayAudioOFF str="Detener audio doble va" /> <Resolution str="Resolucin" /> <Style str="Estilo" /> <Simple str="Simple" /> <Professional str="Profesional" /> <Output str="Salida" /> <SettoOpen str="Configurar al abrir" /> <SettoClose str="Configurar al cerrar" /> <Preset str="Preajuste" /> <Zoom str="Zoom" /> <Wide str="Ancho" /> <Tele str="Tele" /> <Advanced str="Ava* nzado" /> <IsDeletePreset str="Si presiona OK borrar la configuracin " /> <System_Log str="Registro del sistema" /> <PTZ_SPEED str="Velocidad de PTZ" /> <PTZ_HOME str="Inicio PTZ" /> <PTZ_UP str="PTZ arriba" /> <PTZ_DOWN str="PTZ abajo" /> <PTZ_LEFT str="PTZ izquierda" /> <PTZ_RIGHT str="PTZ derecha" /> <PTZ_UP_RIGHT str="PTZ arriba derecha" /> <PTZ_UP_LEFT str="PTZ arriba izquierda" /> <PTZ_DOWN_LEFT str="PTZ abajo izquierda" /> <PTZ_DOWN_RIGHT str="PTZ abajo derecha" /> <PTZ_TOUR_GO str="Ir a Tour PTZ" /> <PTZ_TOUR_STOP str="Detener Tour PTZ" /> <PTZ_FOCUS_UP str="PTZ enfoque arriba" /> <PTZ_FOCUS_DOWN str="PTZ enfoque abajo" /> <PTZ_IRIS_UP str="PTZ Iris arriba" /> <PTZ_IRIS_DOWN str="PTZ Iris abajo" /> <PTZ_FOCUS_AUTO str="PTZ autoenfoque" /> <PTZ_IRIS_AUTO str="PTZ Auto Iris" /> <PTZ_AUTOPAN_START str="Comenzar navegacin PTZ" /> <PTZ_AUTOPAN_STOP str="Detener navegacin PTZ" /> <PTZ_ZOOM_IN str="PTZ Zoom de acercamiento" /> <PTZ_ZOOM_OUT str="PTZ Zoom d) e alejamiento" /> <SYS_LOG_SYSTEM_INIT str="Inicializacin de sistema" /> <SYS_LOG_SYSTEM_SHUTDOWN str="Apagar sistema" /> <SYS_LOG_USER_LOGIN str="Usuario conectado" /> <SYS_LOG_USER_LOGOUT str="Usuario desconectado" /> <SYS_LOG_START_SCH_REC str="Iniciar programa de grabacin" /> <SYS_LOG_END_SCH_REC str="Finalizar programa de grabacin" /> <SYS_LOG_START_SCH_ALARM str="Iniciar alarma programada" /> <SYS_LOG_END_SCH_ALARM str="Finalizar alarma programada" /> <SYS_LOG_ENTER_SYS_SETUP str="Ingresar a configuracin de sistema" /> <SYS_LOG_EXIT_SYS_SETUP str="Salir de configuracin de sistema" /> <SYS_LOG_ENTER_SCH_REC_SETUP str="Ingresar a configuracin de programa de grabacin" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="Salir de configuracin de programa de grabacin" /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="Ingresar a configuracin de programa de alarma" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="Salir de configuracin de programa de alarma" /> <SYS_LOG_RTSP_GET_CONNECT str="Obtener conexin"< /> <SYS_LOG_RTSP_LOSE_CONNECT str="Conexin perdida" /> <SYS_LOG_SERVER_HTTP_START str="Iniciar servidor HTTP" /> <SYS_LOG_SERVER_HTTP_STOP str="Detener servidor HTTP" /> <SYS_LOG_SERVER_RTSP_START str="Iniciar servidor RTSP" /> <SYS_LOG_SERVER_RTSP_STOP str="Detener servidor RTSP" /> <SYS_LOG_SERVER_RPB_START str="Iniciar servidor de reproduccin remoto" /> <SYS_LOG_SERVER_RPB_STOP str="Detener servidor de reproduccin remoto" /> <DiskManagement str="Administracin de disco" /> <DeviceType str="Tipo de dispositivo" /> <Partition str="Particin" /> <FileSystem str="Sistema de archivo" /> <IsPartition str="&amp;quot;El sistema recrear una particin, por favor confirmar este procedimiento&amp;quot;" /> <Image str="Imagen" /> <Brightness str="Brillo" /> <Contrast str="Contraste" /> <Saturation str="Saturacin" /> <Sharpness str="Nitidez" /> <Hue str="Matiz" /> <NoSeldesti str="Por favor seleccione un destino!" /> <NoSelSource str="Por favor seleccione una lista fuente!& " /> <Time_Range str="Rango de tiempo del archivo" /> <Event_Snapshot str="Instantnea de evento" /> <EventSnapshotViewer str="Visualizador de instantneas de evento" /> <Event_Time str="Hora del evento" /> <Event_Type str="Tipo de evento" /> <Change_Resolution str="&amp;quot;La resolucin de la pantalla fue cambiada, Desea cambiarla?&amp;quot;" /> <Select_All str="Seleccionar todo" /> <InitNetowrk str="Inicializar el mdulo de red" /> <InitSystemDate str="Inicializar el mdulo de fecha y horario" /> <InitDisk str="Inicializar el mdulo de disco" /> <InitRTSP str="Inicializar el mdulo RTSP" /> <NoVideo str="Sin video" /> <Modify str="Modificar" /> <DisplayCount str="Mostrar contador" /> <Mount str="Montar" /> <Unmount str="Desmontar" /> <EditEmpty str="Por favor confirme que la configuracin es correcta!" /> <Account str="Cuenta" /> <FindListLog str="&amp;quot;Se encontraron ms de %d grabaciones, desplegar primero %d grabacin solamente&amp;quot;" /> <Trigger_Interv3al_Seconds str="Disparar segundos de intervalo" /> <Alarm_Always str="Siempre alarma" /> <LowFPS str="Baja de tasa de bits FPS" /> <WithFPS str="Como el anterior" /> <ShowPW str="Mostrar contrasea" /> <SelOverMaxPlayHours str="Seleccionar ms de %d horas" /> <SelectedCamera str="Cmara seleccionada" /> <Codec str="Cdec" /> <Switchto str="Cambiar a" /> <Filter str="Filtro" /> <AutoSettingNote str="Por favor introduzca la regla de filtrado o mantngala vaca para buscar todo" /> <TemplateSetting str="Plantilla de ajuste" /> <SearchByEvent str="Buscar por evento" /> <Control str="Control" /> <SwitchCamera str="Cambiar cmara" /> <Preview str="Vista previa" /> <SequentialSearch str="Bsqueda secuencial" /> <Split str="Dividida" /> <PreSearch str="Pre bsqueda" /> <SeekTo str="Buscar a" /> <ShowInformation str="Mostrar informacin" /> <Bitrate_Log str="Registro de promedio de bit" /> <Save str="Guardar" /> <PlaybackControlPad str="Pad de control de reproduccin" /> 0 <FormatFault str="Falla en formateo" /> <LowBitrateSetting str="Configuracin de promedio de bit baja" /> <NotConfigured str="No configurada" /> <Application str="Aplicacin " /> <NameOrMailEmpty str="El nombre o e-mail est vaco" /> <ONVIF_Auth str="Autenticacin ONVIF" /> <PIR_Alarm str="Alarma PIR" /> <CameraTamper str="Cmara bloqueada" /> <AudioDetection str="Deteccin de audio" /> <AutoSwitch str="Cambio automtico" /> <CancelAutoSwitch str="Cancelar switch automtico" /> <MailRepeat str="Usted agreg el mismo e-mail. Por favor cmbielo!" /> <SMART str="S.M.A.R.T" /> <OVERALL str="Por encima de todo" /> <PASSED str="PASADO" /> <FAILED str="FALL" /> <Raw_Read_Error_Rate str="Error en disco rgido" /> <Throughput_Performance str="Rendimiento de volumen de informacin" /> <Spin_Up_Time str="Tiempo de giro" /> <Start_Stop_Count str="Iniciar contador de paradas " /> <Reallocated_Sector_Ct str="Contar sectores reasignados" /> <Seek_Error_Rate str="Buscar promedio % de errores" /> <Seek_Time_Performance str="Buscar tiempo de rendimiento" /> <Power_On_Hours str="Horas de encendido" /> <Spin_Retry_Count str="Girar recuento de intentos" /> <Calibration_Retry_Count str="Calibracin recuento de reintentos" /> <Power_Cycle_Count str="Contador de ciclo de energa" /> <Power_Off_Retract_Count str="Contador de apagado retraccin" /> <Load_Cycle_Count str="Contador de ciclos de carga" /> <Temperature_Celsius str="Temperatura en Celsius" /> <Reallocated_Event_Count str="Contador de eventos reasignados" /> <Current_Pending_Sector str="Sector pendiente actual" /> <Offline_Uncorrectable str="Desconexin incorregible" /> <UDMA_CRC_Error_Count str="Error en contador UDMA CRC " /> <Multi_Zone_Error_Rate str="Error en promedio multizona" /> <SMART_RAW_VALUE str="Valor RAW" /> <SMART_WORST str="Referencia" /> <SMART_Event str="HDD S.M.A.R.T" /> <DisplayRatio str="Desplegar promedio" /> <FitWindow str="Ajustar la ventana" /> <KeepRatio str="Mantener pro% medio" /> <Joystick str="Joystick" /> <Joystick_Information str="Informacin de joystick" /> <Joystick_Model str="Modelo de joystick" /> <Axis_Count str="Cuenta Axis" /> <Button_Count str="Contador de botones" /> <Axis_X str="Valor X Axis" /> <Axis_Y str="Valor Y Axis" /> <Axis_Z str="Valor Z Axis" /> <Buttons_Status str="Botones de estado" /> <Joystick_Buttons_Setting str="Botones de ajuste de joystick" /> <Button str="Botn" /> <Next_Division str="Divisin siguiente" /> <Previous_Division str="Divisin previa" /> <Next_Window str="Prxima ventana" /> <Previous_Window str="Ventana previa" /> <Switch_Division_One str="Cambiar Divisin Uno" /> <Axis_Z_ID str="ID Axis Z" /> <RAID_Err_Alarm str="Alarma de error RAID" /> <Create str="Create"/> <Detail str="Detail"/> <Rebuild str="Rebuild"/> <EraseDisk str="This action will erase all data on disk, please confirm this procedure"/> <FishEyeCtrl str="FishEye Control"/> <FishEyeDispMode str="Display Mode"/> <FishEyePos0ition str="Position"/> <FishEyeWin str="Window"/> <InvalidFirmware str="Invalid Firmware!"/> <ConnectLost str="Conexin perdida"/> <ConnectFail str="Falla la conexin"/> <GetSettingValueErr str="No se puede obtener el valor de configuracin!"/> <Refresh str="Por favor Refresque!"/> <IE_Protected_Open str="IE Protected Mode is enabled, please add this URL to IE Trusted sites."/> <Backuping str="Haciendo Backup, por favor espere."/> <Converting str="Convirtiendo. Por favor espere"/> <ShowDate str="Mostrar Fecha"/> <ShowTime str="Mostrar Hora"/> <Subtitle str="Subtitle"/> <PreSecond str="Segundo anterior"/> <PreFrame str="Cuadro Previo"/> <NextSecond str="Segundo Prximo"/> <NextFrame str="Prximo Cuadro"/> <LowBitrate str="Low BitRate"/> <DigitalZoom str="Zoom Digital" /> <MotionSearch str="Buscar deteccin de movimiento" /> <TimeSplit str="Tiempo parcial" /> <ShowDetailWindow str="Mostrar Ventana de Detalles" /> <FirstPage str="Primer Pgina" /> <PrePage str="Pgin3a Previa" /> <NextPage str="Prxima Pgina" /> <LastPage str="ltima Pgina" /> <DetailPicture str="Detalle de la Imagen" /> <SelectTime str="Seleccionar Hora" /> <ErrStartEndTm str="Error en las horas de inicio o final!" /> <SearchSet str="Bsqueda" /> <ShowSearchImage str="Mostrar bsqueda de imagen" /> <ShowDetectMark str="Mostrar marca de deteccin" /> <DetectInterval str="Intervalo Deteccin:" /> <Exit str="Salir" /> <Grayscale str="Escala de grises" /> <Softness str="Suavizar" /> <Reset str="Resetear" /> <Print str="Imprimir" /> <RetryAgain str="Por favor intente luego!" /> <FirmwareUpgrade_msg str="Firmware Upgrade complete, Please reconnection"/> <SYSTEM_TIME_MSG str="Modify system time will re-start record service,please click 'Yes' to continue or 'No' to cancel"/> <TWO_WAYAUDIOUSED str="Usar Audio dos vias!"/> <Weekly str="Semanal"/> <SAVEAS str="Save As..."/> <Send_To str="Enviar a"/> <ACTION_DESC_SNAPSHOT str="Snapshot image on Event Triggered"/> <ACTI& ON_DESC_RECORD str="Record video on Event Triggered"/> <ACTION_DESC_DISPLAY str="Muestra un mensaje en la pantalla"/> <ACTION_DESC_MAIL str="Enva un e-mail sobre el evento accionado"/> <ACTION_DESC_VOICE str="Reproduce un sonido de alarma "/> <ACTION_DESC_DO str="Acciona una salida digital segn el evento accionado"/> <ACTION_DESC_FTP str="Subir imgenes a sitio FTP"/> <ACTION_DESC_BUZZER str="Buzzer on Event Triggered"/> <ACTION_DESC_TCP str="Upload Images To TCP Site"/> <ACTION_DESC_HTTP str="Upload Images To HTTP Site"/> <TCP str="TCP"/> <HTTP str="HTTP"/> <FTP str="FTP"/> <EVENT_DESC_MOTION str="Mostrar estado deteccin de movimiento"/> <EVENT_DESC_BLOCK str="Detectar cmara bloqueada"/> <EVENT_DESC_BLUR str="Detectar cmara desenfocada"/> <EVENT_DESC_CAM_MOVE str="Detectar cmara movida de direccin"/> <EVENT_DESC_DI str="Detecta cambio en el estado de la entrada digital"/> <EVENT_DESC_HDD_ERR str="Detect HDD Error"/> <EVENT_DESC_DISCONNECT str="Detect camera discon<nected"/> <EVENT_DESC_FORCE str="Detect Schedule Trigger"/> <EVENT_DESC_PIR str="PIR Alarm"/> <EVENT_DESC_TAMPER str="Camera Tamper"/> <EVENT_DESC_AUDIO_DETECTION str="Audio Detection"/> <ALARM_EVENT_SELECT str="Seleccin Eventos de Alarma"/> <CREATE_NEW_FOLDER str="Crear Nueva Carpeta"/> <CHANGE_NAME str="Cambiar Nombre"/> <TIME_SET_ERROR str="Error del seteo de hora, por favor verificar"/> <Export str="Exportar"/> <SEL_VIEW_CH str="Seleccionar Vista Canal"/> <SYSTEM_UPDATEMESSAGE str="Upload setting now, please re-connect after about 40 seconds."/> <START_MONITOR_ALL str="Inicio Monitoreo Todo"/> <UPDATE_FAIL str= "No se puede subir la configuracin, intente luego!"/> <DI_REC_TRIGGER str="Grabacin DI disparada por:"/> <PASTE str="Pegar"/> <PASTE_MON_FRI str="Pegar en Lunes a Viernes"/> <PASTE_SAT_SUN str="Pegar en Sbado y Domingo"/> <PASTE_ALL_CAM str="Pegar en todas las cmaras"/> <APPLY_ALL str="Aplicar todo"/> <UN_SELECT_ALL str="Cancelar todo"/> <GET_PARAM_FA) IL_USE_DEFAULT str= "Falla la obtencin de parmetros, el sistema usar los valores por defecto"/> <NO_CAM_NAME str="No indic el nombre de cmara, usar uno por defecto?"/> <ERR_SETUP str="Error de configuracin de datos, por favor verifique"/> <DEL_CAM_COFIRM str="Esta seguro que quiere borrar '%s' de la lista?"/> <ADD_CAM_ERR_ALREADY_HAS str="Ya tiene '%s' en la lista, por favor revise la configuracin "/> <MOTION_GET_DATA_ERR str="Get Motion Data fail!"/> <SHOW_LIVE_CAM str="Mostrar Cmara en Vivo"/> <SHOW_PB_CAM str="Mostrar reproduccin de cmara"/> <DELETE_CAM str="Quitar visin de la cmara"/> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root>0) lang_arabic.xmlėRVR̗R<root> <Font Name="unifont" /> <LanguageName str="Arabic" /> <LanguageNameEng str="Arabic" /> <Sch_Monitor str="E1'B() (1F'E, 'D,/HD 'D2EFI" /> <Alarm_Monitor str="E1'B() F8'E 'D*F(JG " /> <Week0 str="'D#-/" /> <Week1 str="'D%+FJF" /> <Week2 str="'D+D'+'!" /> <Week3 str="'D#1(9'!" /> <Week4 str="'D.EJ3" /> <Week5 str="'D,E9)" /> <Week6 str="'D3(*" /> <WeekS0 str="'D#-/" /> <WeekS1 str="'D%+FJF" /> <WeekS2 str="'D+D'+'!" /> <WeekS3 str="'D#1(9'!" /> <WeekS4 str="'D.EJ3" /> <WeekS5 str="'D,E9)" /> <WeekS6 str="'D3(*" /> <Disk_Free str="E3'-) 'DB15" /> <Error str=".7#" /> <LoginError str=".7# *3,JD 'D/.HD  %3E 'DE3*./E #H CDE) 'DE1H1 :J1 5-J-)" /> <DeviceInfo str="(J'F'* 'D,G'2" /> <DeviceTitle str="9FH'F 'D,G'2" /> <SoftwareVersion str="F3.) 'D(1F'E," /> <Characters str="'D1EH2" /> <DateTimeInfo str="(J'F'* 'DHB* H'D*'1J." /> <CurrentDate str="'D*'1J. 'D-'DI" /> <CurrentTime str="'DHB* 'D-'DI" /> <Adjust str="'D8(7" /> <Manual str="J/HI" /> <Syn cNTP str="E*2'EF E9 (1H*HCHD *HBJ* 'D4(C)" /> <Setting str="'D%9/'/ / 8(7 .J'1" /> <NTPServer str=".'/E (1H*HCHD *HBJ* 'D4(C)" /> <Test str="%.*('1" /> <NTPSyncInterval str="'DHB* 'DA'5D 'D2EFI D(1H*HCHD *HBJ* 'D4(C)" /> <Hour str="'D3'9)" /> <Timezone str="'D*HBJ*" /> <Timezone0 str="*HBJ* :1JFJ*4 -14" /> <Timezone1 str="*HBJ* :1JFJ*4 -13" /> <Timezone2 str="*HBJ* :1JFJ*4 - 12 (%FJH*HC  CH','DJF )" /> <Timezone3 str="*HBJ* :1JFJ*4 - 11 ( ,2J1) EJ/H'I  3'EH' )" /> <Timezone4 str="*HBJ* :1JFJ*4 - 10 ( G'H'I  ,21 #DH*J'F )" /> <Timezone5 str="*HBJ* :1JFJ*4 - 09 ( #D'3C' )" /> <Timezone6 str="*HBJ* :1JFJ*4 - 08 ( D'3 AJ:'3  3'F A1'F3J3CH  A'FCHA1)" /> <Timezone7 str="*HBJ* :1JFJ*4 - 07 ( C'D:'1I  /FA1  3HD* DJC 3J*I )" /> <Timezone8 str="*HBJ* :1JFJ4 - 06 ( 4JC':H  /'D'3  E/JF) EC3JCH  FJH #H1DJF2 )" /> <Timezone9 str="*HBJ* :1JFJ*4 - 05 ( CH(' )" /> <Timezone10 str="*HBJ* :1JFJ*4 - 05 ( FJHJH1C  *H1HF*H  H'4F7F /I 3I )" /> <Timezone11 str="*HBJ* :1JFJ*4 -03 ( ('1':H'I )" /> <Timezone12 str="*HBJ* :1JFJ*4 - 04 ( *4JDI )" /> <Timezone13 str="*HBJ* :1JFJ*4 - 04 ( *4'1DH* *'HF  E'F'H3 )" /> <Timezone14 str="*HBJ* :1JFJ*4 - 03:30 ( FJHA'HF/D'F/ )" /> <Timezone15 str="*HBJ* :1JFJ*4 - 03 ( (1'2JDJ'  3'H ('HDH )" /> <Timezone16 str="*HBJ* :1JFJ*4 - 02 ( FH1HG'  %BDJE 'D#7D3I 'D#H37 )" /> <Timezone17 str="*HBJ* :1JFJ*4 - 01 ( ,21 'D#2H1  ,21 'D1#3 'D#.61)" /> <Timezone18 str="*HBJ* :1JFJ*4 ( /(DF  D4(HFG  DF/F  1JCJ'AJC )" /> <Timezone19 str="*HBJ* :1JFJ*4 +01 ( #E3*1/'E  (1DJF  1HE'  3*HCGHDE  H'13H )" /> <Timezone20 str="*HBJ* :1JFJ*4 +02 ( #+JF'  GD3FCI  %37F(HD  1J:' )" /> <Timezone21 str="*HBJ* :1JFJ*4 + 02 ( E51 )" /> <Timezone22 str="*HBJ* :1JFJ*4 +02 (AD37JF )" /> <Timezone23 str="*HBJ* :1JFJ*4 + 02 ( D(F'F )" /> <Timezone24 str="*HBJ* :1JFJ*4 + 02 ( 3H1J' )" /> <Timezone25 str="*HBJ* :1JFJ*4 + 03 ( EH3CH  'D1J'6 )" /> <Timezone26 str="*HBJ* :1JFJ*4 + 03 ( 'D91'B )" /> <Timezone27 str="*HBJ* :1JFJ*4 + 03:30 ( %J1'F )" />  <Timezone28 str="*HBJ* :1JFJ*4 + 04 (#(H8(I  ('CH )" /> <Timezone29 str="*HBJ* :1JFJ*4 + 04:30 (C'(D )" /> <Timezone30 str="*HBJ* :1JFJ*4 + 05 ( %3D'E #('/  C1'*4I  74BF/ )" /> <Timezone31 str="*HBJ* :1JFJ*4 + 5:30 ( EHE('I  CDC*'  FJH/DGI )" /> <Timezone32 str="*HBJ* :1JFJ*4 +05:45 ( C'*E'F/H )" /> <Timezone33 str="*HBJ* :1JFJ*4 +06 ( FHAH3J(J13C  #HE3C )" /> <Timezone34 str="*HBJ* :1JFJ*4 + 06:30 ( 1'F:HF )" /> <Timezone35 str="*HBJ* :1JFJ*4 + 07 ( ('FCHC  G'FHI  ,'C'1*' )" /> <Timezone36 str="*HBJ* :1JFJ*4 + 08 ( (CJF  GHF, CHF,  4F:G'I  3F:'AH1)  *'J(JG )" /> <Timezone37 str="*HBJ* :1JFJ*4 + 09 ( 3J&HD  #H3'C'  3'(H1H  7HCJH )" /> <Timezone38 str="*HBJ* :1JFJ*4 + 09:30 ( /'1HJF )" /> <Timezone39 str="*HBJ* :1JFJ*4 +9:30 ( #/JDJ/ )" /> <Timezone40 str="*HBJ* :1JFJ*4 + 10 ( GH('1* )" /> <Timezone41 str="*HBJ* :1JFJ*4 + 10 ( C'F(1'  ED(H1F  3J/FI )" /> <Timezone42 str="*HBJ* :1JFJ*4 + 11 ( ,21 3DJE'F )" /> <Timezone43 str="*HBJ* :1JFJ*4 + 11:30 ( FH1AHDC )" /> <Timezone44 str="*HBJ* :1JFJ*4 + 12 ( #HCD'F/  HJDJF:*HF )" /> <Timezone45 str="*HBJ* :1JFJ*4 + 12 ( AJ,I )" /> <Timezone46 str="*HBJ* :1JFJ*4+12 ( 4(G ,2J1) C'E4'*C' )" /> <Timezone47 str="*HBJ* :1JFJ*4 + 12 ( ,21 E'14'D )" /> <Timezone48 str="*HBJ* :1JFJ*4 +13 ( *HF,'  FHCH #DHA' )" /> <Timezone49 str="*HBJ* :1JFJ*4 + 12:45 ( ,2J1) *4'*'E )" /> <DST str="'D*HBJ* 'D5JAI" /> <Disable str="E97D" /> <Enable str="EA9D " /> <DSTStart str="(/'J) 'D*HBJ* 'D5JAI" /> <DSTEnd str="FG'J) 'D*HBJ* 'D5JAI" /> <DSTOffset str="A1B 'D*HBJ* 'D5JAI" /> <AutoLogin str="*3,JD 'D/.HD 'D*DB'&I" /> <UID str="%3E 'DE3*./E" /> <PWD str="CDE) 'DE1H1" /> <System str="'DF8'E" /> <AutoFullScreen str="H69 ED! 'D4'4) 'D*DB'&I " /> <Language str="'DD:)" /> <Audio str="'D5H*" /> <InputGain str="-,E 'D%/.'D" /> <OutputGain str="-,E 'D%.1'," /> <KeyinNTPAddr str="(1,'! %/.'D 9FH'F .'/E (1H*HCHD *HBJ* 'D4(C)" /> <Success str="*E (F,'-" /> <Fault str=".7#" /> <OK str="EH'AB" /> <Cancel str= "%D:'!" /> <SetDateTime str="8(7 'DHB* 'D*'1J." /> <Date str="'D*'1J. " /> <Time str="'DHB*" /> <AutoSetting str="'D8(7 'D*DB'&I" /> <CameraName str="'3E 'DC'EJ1'" /> <ModelName str="'3E 'DFEH0, " /> <IPAddress str="9FH'F (1H*HCHD 'D%F*1F*" /> <HTTPPort str="EFA0 (1H*HCHD FBD 'DF5 'DA'&B ( %*4 *I *I (I )" /> <RTSPPort str="EFA0 (1H*HCHD 31J'F 'DE9DHE'* AI 'D2EF 'D-BJBI " /> <Camera str="'DC'EJ1'" /> <Schedule str="'D,/HD 'D2EFI" /> <Network str="'D4(C)" /> <User str="'DE3*./E" /> <MotionDetection str="#C*4'A -1C) #H *:JJ1" /> <Snapshot str="DB7)" /> <Maintenance str="5J'F) / *-/J+" /> <Add str="%6'A)" /> <Delete str="E3- / -0A" /> <Update str="*-/J+" /> <Clear str="E3- / %D:'!" /> <Search str="(-+" /> <AutoDetect str="%C*4'A *DB'&I" /> <Detect str="%C*4'A" /> <MACAddress str="9FH'F E'C ( 'D*-CE ('DH5HD %DI 'DH3'&7 )" /> <Configuration str="%9/'/" /> <Copy str="F3. " /> <StartTime str="HB* 'D(/!" /> <EndTime str="HB* 'DFG'J) " /> <RecordType str="FH9 'D 3,D " /> <PreAlarm str="B(D 'D*F(JG " /> <PostAlarm str="(9/ 'D*(JG" /> <RTC str="9DI E/'1 'D3'9) " /> <DIDetect str="%C*4'A 'D%3*J1'/ 'D1BEI DI" /> <TimeSelErr str="'DF7'B 'D2EFI :J1 5-J-" /> <NoSelSch str="(1,'! %.*J'1 *HBJ* 2EFI H'-/" /> <Warning str="%F0'1" /> <WeekCopyToAll str="3JCHF 'D*HBJ* 'D2EFI 7H'D 'D#3(H9 GH FA3 'D*HBJ* 'D0I *E %.*J'1G" /> <DHCP str="'D-5HD 9DI 9FH'F (1H*HCHD 'D%F*1F* *DB'&J'K ( (1H*HCHD 'D*4CJD 'D/JF'EI )" /> <SubnetMask str="BF'9 'D4(C) 'DA19J)" /> <Gateway str="(H'J) / E/.D" /> <DNS_DHCP str="'D-5HD 9DI F8'E #3E'! 'DF7'B'* EF (1H*HCHD 'D*4CJD 'D/JF'EI " /> <PrimaryDNS str="F8'E #3E'! 'DF7'B'* 'D#HDI / 'D#3'3I" /> <SecondaryDNS str="F8'E #3E'! 'DF7'B'* 'D+'FI / 'D+'FHI" /> <PPPoE str="(1H*HCHD 'DFB7) #DI 'DFB7) 9(1 'D%J+1F*" /> <Status str="'DH69 / 'D-'D)" /> <Start str="'D(/'J)" /> <Stop str="'D*HBA" /> <Server str="'D.'/E" /> <IPUsed str="G0' 'D9FH'F BJ/ 'D%3*./'E" /> <IPNoUsed str="JECF %3*./'E G0' 'D9FH'F " /> <Group str="'DE,EH9)" /> <Description str="'DH5A" /> <ConfirmPWD str="*#CJ/ CDE) 'DE1H1" /> <LiveView str="916 E('41" /> <Playback str="#9'/) *4:JD" /> <Record str="*3,JD 'D/.HD 'D*DB'&I" /> <PTZ str="C'EJ1' E1'B() E*-1C) D#B5I -E'J) EECF)" /> <TwoWayAudio str="'*,'GJF DD5H*" /> <CheckConfirmPWD str="(1,'! E1',9) *#CJ/ CDE) 'DE1H1 E1) #.1I" /> <UIDEmpty str="(1,'! *9/JD %3E 'DE3*./E " /> <UIDRepeat str="DB/ BE* (%6'A) FA3 %3E 'DE3*./E (1,'! *:JJ1G " /> <NoSelUID str="(1,'! %.*J'1 'D-3'( " /> <MotionID str="*:JJ1 1BE 'D*91JA" /> <Name str="'D%3E" /> <Included str="E/1," /> <Excluded str=":J1 E/1," /> <ObjectSize str="-,E 'DC'&F / 'DG/A" /> <Sensitivity str="'D-3'3J) / 'D*#+1" /> <NoSelCamera str="(1,'! %.*J'1 C'EJ1'" /> <OverMaxMotion10 str="'D-/ 'D#B5I DD-1C'* GH 10" /> <NoSelMotion str="(1,'! %.*J'1 *#+J1 -1CI" /> <MotionSettingEnpty str="(1,'! ED! '9/'/ 'D-1C) #HD'K" /> <SourceSnapshotList str="B'&E) 916 'DE5/1" /> <SourceSnapshotPreview str="E9'JF) 916 'DE5/1" /> <DestinationSnapshotList str="B'&E) 916 'DEC'F 'DEB5H/" /> <DestinationSnapshotPreview str="E9'JF) 916 'DEC'F 'DEB5H/" /> <NoFindSD str="(1,'! %/1', (7'B) 'D-E'J) 'D1BEJ) / (7'B) 'D0'C1) 'D1BEJ) 'DE$EF)" /> <NoSelImg str="(1,'! %.*J'1 5H1)" /> <SameSnapshotImgName str="DH,H/ %3E FA3 'DEDA AI (7'B) 'D-E'J) 'D1BEJ) . 3J*E %3*(/'D 'DEDA !" /> <IsAutoSetting str="GD *1J/ 8(7 'DC'EJ1' *DB'&J'N 'D#F " /> <GetParamError str="'D-5HD 9DI .7# 'DE9'ED" /> <CameraNameEmpty str="(1,'! %/.'D %3E 'DC'EJ1'" /> <IPAddressEmpty str="(1,'! %/.'D 9FH'F (1H*HCHD 'D%F*1F*" /> <UIDEmpty str="(1,'! %/.'D %3E 'DE3*./E" /> <HttpPortEmpty str="(1,'! %/.'D EFA0 (1H*HCHD FBD 'DF5 'DA'&B ( %*4 *I *I (I )" /> <CameraNameTheSame str="%3E 'DC'EJ1' E*C11 !" /> <CamParam str="E*:J1 'DC'EJ1'" /> <Profile str="3,D 'DE3*./E" /> <FPS str="'D%7'1'* AI 'D+'FJ)" /> <Protocol str="(1H*HCHD " /> <EnableAudio str="*A9JD 'DAJ/JH" /> <AudioRecord str="*3,JD 'D5H*" /> <InputError str=".7# %/.'D" /> <DefaultSetting str="'D8(7 'D%A*  1'6I" /> <FactoryDefaultSetting str="'D8(7 'D%A*1'6I DDE5F9 " /> <Default str="'D%A*1'6I" /> <BackupSetting str="8(7 'DF3.) 'D%-*J'7J)" /> <Backup str="'DF3.) 'D%-*J'7J) " /> <RestoreSetting str="8(7 'D%3*1,'9 / 'D%3*9'/)" /> <Restore str="'D%3*1,'9" /> <FirmwareUpgrade str="*-/J+ 'D(1F'E, 'D+'(*" /> <Upgrade str="*-/J+" /> <Browse str="*5A-" /> <SystemRestart str="%9'/) *4:JD 'DF8'E" /> <Restart str="%9'/) 'D*4:JD " /> <HDInformation str="(J'F'* 'DB15 'D5D(" /> <SDInformation str="(J'F'* (7'B) 'D-E'J) 'D1BEJ) / (7'B) 'D0'C1) 'D1BEJ) 'DE$EF)" /> <TotalCapacity str="'D39) 'DCDJ) " /> <FreeCapacity str="'D39) 'DA'1:)" /> <UsedCapacity str="'D39) 'DE3*./E)" /> <UsedPercent str="'DF3() 'DE3*./E)" /> <Format str="*F3JB" /> <NoFind str="D' JH,/" /> <NoMount str="D' JH,/ *+(J*" /> <IsDefaultSetting str="3JBHE 'DF8'E (8(7 'D%9/'/ 'D*DB'&I E*6EF'K 'D4(C)  (1,'! *#CJ/ 0DC 'D%,1'!" /> <NoBackupDevice str="(1,'! %/.'D ,G'2 'DF3. 'D%-*J'7I 'D.'1,I" /> <NoFindConfigFile str="D  ' JECF %J,'/ EDA 'D*91JA" /> <ConfigFile str="EDA 'D*91JA" /> <ConfigFileVerErr str=".7# AI F3.) EDA 'D*91JA" /> <IsRestart str="3HA J*E %9'/) *4:JD 'DF8'E  (1,'! *#CJ/ 0DC 'D%,1'!" /> <NoFindFirmware str="D' JECF %J,'/ EDA +'(*" /> <FirmwareFile str="'DEDA 'D+'(*" /> <IsFormatHD str="3HA J*E AB/ ,EJ9 'D(J'F'*  GD *1J/ 'D%3*E1'1 " /> <OpenFirmwareUpgradeLogErr str="D' JECF A*- 3,D *-/J+ 'DEDA 'D+'(* _ " /> <Playback str="%9'/) *4:JD " /> <PlaybackTime str="HB* %9'/) 'D*4:JD" /> <Play str="'D*4:JD" /> <Reverse str="'D9C3" /> <Pause str="*HBA" /> <Wait str="(1,'! 'D%F*8'1" /> <Mute str="5'E*" /> <LiveAudio str="5H* E('41" /> <PlaybackAudio str="%9'/) *4:JD 'D5H*" /> <ConvertToAvi str="'D*-HJD %DI */'.D 'D5H* H'DAJ/JH ( %JG AI #I )" /> <NoFindRecord str="D' JH,/ *3,JD" /> <TimePeriod str="'DA*1) 'D2EFJ)" /> <SaveTo str="-A8 AI" /> <BackupDeviceFull str="1(E' *CHF ,G'2 'DF3. 'D%-*J'7I EE*D#  (1,'! E1',9*G ." /> <SavePath str="-A8 'DE3'1" /> <Login str="'D/.HD" / > <Logout str="'D.1H," /> <PictureSet str="E,EH9) 'D5H1" /> <Rotation str="'D*/HJ1" /> <Normal str="'DH69 'D7(J9I" /> <Mirror str="9C3 'D6H! #H 'D5H1) " /> <VerticaFlip str="BD( 'D5H1) 9EH/J'K" /> <ColorLevel str="/1,) 'DDHF" /> <Brightness str="'D37H9" /> <Contrast str="'D*('JF" /> <Sharpness str="'DH6H- #H 'D/B) " /> <RateControl str="E9/D 'D*-CE" /> <Quality str="'D,H/)" /> <Bitrate str="E9/D %13'D 'D(*'* / 319) 'D(*'*" /> <VideoOffset str="E9'/D) 'DAJ/JH" /> <De-Noise str=".A6 'D5H*" /> <None str="D' JH,/" /> <Method str="'D71JB)" /> <AutoMode str="'DFE7 'D*DB'&I" /> <DayMode str="'DFE7 'DFG'1I" /> <NightMode str="'DFE7 'DDJDI " /> <Base str="'DB'9/)" /> <Picture str="'D5H1)" /> <OutOfRange str=".'1, 'DF7'B / 'D%7'1" /> <SystemClose str="%:D'B 'DF8'E" /> <On str="*4:JD" /> <Off str="%:D'B " /> <Vendor str="EB/E 'D./E)" /> <ModelName str="%3E 'DFEH0," /> <FriendlyName str="'D%3E 3GD 'D%3*./'E" /> <UPnPTraversal str="E3- / %-5'! /9E 'D*1CJ( H'D*4:J  D 'D9'DEI " /> <PortRange str="F7'B 'DEFA0" /> <ExternalIPAddress str="9FH'F (1H*HCHD 'D%F*1F* 'D.'1,I" /> <Information str="'D(J'F'*" /> <SelOverPlayerMaxCam str="'D%.*J'1 EF (JF C'EJ1' %d" /> <Event str="'D-/+" /> <Event_List str="B'&E) 'D-/+" /> <Motion str="'D-1C)" /> <DI str="'D%/.'D 'D1BEI" /> <DO str="'D%.1', 'D1BEI" /> <Event_Schedule_List str="B'&E) *HBJ* 'D-/+" /> <Action_List str="B'&E) 'DF4'7 #H 'D9ED" /> <Alarm_Trigger_Type str="FH9 'D*F(JG" /> <Alarm_Seconds str="D-8'* 'D*F(JG" /> <Buzzer str="'D%F0'1 'D5H*I" /> <UnKnow str=":J1 E91HA" /> <Display_On_CH str="'D916 9DI 'DBF')" /> <Action_Type str="FH9 'D9ED" /> <ERR_MSG_NO_CAM str="(1,'! %.*J'1 'DC'EJ1' #H 'DE5/1 'DE-DI #HD'K . " /> <ERR_MSG_NO_EVENT str="(1,'! %.*J'1 'D-/+ #HD'K . " /> <ERR_MSG_NO_EVENT_SCH str="(1,'! %.*J'1 *HBJ* 'D-/+ #HD'K . " /> <ERR_MSG_NO_ACTION str="(1,'! %.*J'1 'D-/+ #HD'K . " /> <ERR_MSG_TIME_PERIOD str=".7# AI 8(7 'DA*1'* 'D2EFJ) . (1,'! E1',9) 'D%9/'/ !" /> <ERR_MSG_TIME_ CONFILT str="*9'16 8(7 'DA*1'* 'D2EFJ)  (1,'! E1',9) 'D%9/'/ !" /> <WeekDays str="#J'E 'D#3(H9" /> <AlarmSetting str="8(7 'D*F(JG" /> <AlarmCondition str="H69 / -'D) 'D*F(JG " /> <Alarm_True str="5-J- " /> <Alarm_False str=".7#" /> <Alarm_Seconds str="D-8'* 'D*F(JG" /> <Alarm_Manual_Stop str="%JB'A J/HI" /> <Local str="E-DI" /> <DI_Setting str="8(7 'D%3*J1'/ 'D1BEI DI" /> <System_Setting str="8(7 'DF8'E" /> <Log_Viewer str="9'16 'D3,D" /> <Event_Log str="3,D 'D-/+" /> <Device str="'D,G'2 / 'D#/')" /> <Log_Type str="FH9 'D3,D " /> <Motion_Alarm str="*F(JG 'D-1C)" /> <DI_Alarm str="*F(JG 'D%3*J1'/ 'D1BEI DI" /> <Input str="'D%/.'D" /> <Limit_Record str="*3,JD 'D-/" /> <Remark str="ED'-8) / *9DJB" /> <Total str="'DF8'E 'D%,E'DI" /> <HDD_Err_Alarm str="*F(JG ('D.7# AI 'DB15 'D5D(" /> <Disconnect_Alarm str="*F(JG 9/E 'D%*5'D" /> <Schedule_Trigger str="%4'1) (/! 'D*HBJ* " /> <Block_Alarm str="*F(JG 'D -81" /> <Blur_Alarm str="*F(JG (9/E 'DH6H-" /> <Camera_Move_Alarm str="*F(JG *-1C 'DC'EJ1'" /> <Address_Book str="C*'( 'D9F'HJF" /> <Phone str="'DG'*A" /> <E_MAIL str="'D(1J/ 'D%DC*1HFI" /> <Notification str="'D%49'1" /> <SMTP_Config str="8(7 (1H*HCHD %13'D 'D(1J/ 'D(3J7" /> <SMTP_Server str="'D.'/E" /> <SMTP_Port str="'DEFA0" /> <From str="'D4CD / 'DFE7 / 'D%7'1" /> <SendMailWithoutPicture str="%13'D (1J/ %DC*1HFI (/HF 5H1)" /> <ServerRequireAuthentication str="'D*H+JB 'DE7DH( DD.'/E" /> <SSL str="'D.'/E J*7D( 'D%*5'D 'D#EF ( (1H*HCHD 7(B) 'DEF'A0 'D#EF) )" /> <Send_Test str="%13'D 'D%.*('1" /> <FTP_Config str="8(7 (1H*HCHD FBD 'DEDA'*" /> <FTP_Server str="'D.'/E" /> <FTP_Port str="'DEFA0 " /> <Retry str="'DE-'HD) E1) #.1I" /> <RecycleDays str="#J'E %9'/) 'D/H1'F" /> <RecycleSize str="-,E 'D/H1'F" /> <Path str="'DE3'1" /> <AllowCreateFolder str="'D3E'- (%F4'! E,D/" /> <HTTP_Config str="8(7 (1H*HCHD FBD 'DF5 'DA'&B ( %*4 *I *I (I )" /> <HTTP_IP str="(1H*HCHD 'D% F*1F*" /> <HTTP_UID str="'D-3'(" /> <HTTP_PWD str="CDE) 'DE1H1" /> <HTTP_CGI str="(1H*HCHD H',G) 'DE9'(1 'D9'E) " /> <Proxy_Address str="9FH'F 'DH3J7" /> <Proxy_UID str="-3'( 'DH3J7" /> <Proxy_PWD str="CDE) E1H1 'DH3J7" /> <Proxy_Port str="EFA0 'DH3J7" /> <TCP_Config str="%9/'/ EJA'B 8(7 'D%13'D ( 'D*I 3I (I )" /> <TCP_Server str="EB/E 'D./E)" /> <TCP_Port str="8(7 'D*F(JG" /> <Alarm_Config str="'D%7'1" /> <frame str="*/'.D " /> <SnapshotInterval str="A'5D #H A*1) 'D916" /> <SendInterval str="A*1) 'D%13'D" /> <SnapshotTempFolder str="E,D/ E$B* DD916" /> <Mail str="'D(1J/" /> <Subject str="'DEH6H9" /> <body str="'DE-*HI" /> <MS str="EJC1H3HA* ( %E %3)" /> <second str="'D+'FJ)" /> <EventDetect str="%C*4'A 'D-/+" /> <EventForceRecord str="3,D B/1) 'D-/+" /> <EventSetting str="%9/'/ 'D-/+ " /> <MergeSeconds str="D-8'* 'D/E," /> <Display str="'D916" /> <Division str="'D*B3JE" /> <FullScreen str="ED! 'D4'4)" /> <ResetDIVDefault str="%9'/) 8(7 'D*B3JE 'D%A*1'<6I" /> <CancelFullScreen str="%D:'! H69 'D4'4) 'DC'ED)" /> <Function str="'DH8JA)" /> <SystemManagement str="%/'1) 'DF8'E" /> <PTZControl str="'D*-CE (C'EJ1'* 'DE1'B() " /> <Volume str="'D5H*" /> <Monitor str="'D4'4)" /> <CancelMute str="%D:'! 'DH69 'D5'E*" /> <TwoWayAudioON str="(/! %*,'GJF 'D5H*" /> <TwoWayAudioOFF str="%JB'A %*,'GJF 'D5H*" /> <Resolution str="/B) 'D4'4)" /> <Style str="'D#3DH( / 'DFE7" /> <Simple str="(3J7" /> <Professional str="EGFI HE-*1A" /> <Output str="'D%.1', " /> <SettoOpen str="'D8(7 DDA*-" /> <SettoClose str="'D8(7 DD%:D'B" /> <Preset str="'D*-/J/ 'DE3(B" /> <Zoom str="*C(J1 #H *5:J1" /> <Wide str="91J6" /> <Tele str="9F (9/" /> <Advanced str="E*B/E" /> <IsDeletePreset str="('D6:7 9DI EH'AB  3HA J*E -0A 'D*-/J/ 'DE3(B" /> <System_Log str="3,D 'DF8'E" /> <PTZ_SPEED str="319) C'EJ1'* 'D*-CE" /> <PTZ_HOME str="(/'J) C'EJ1'* 'D*-CE" /> <PTZ_UP str="C'EJ1' 'D*-CE D#9DI" /> <PTZ_DOWN str="C'EJ1' 'D*-CE D#3AD" /> <PTZ_LEFT str="C') EJ1' 'D*-CE 9DI 'DJ3'1" /> <PTZ_RIGHT str="C'EJ1' 'D*-CE 9DI 'DJEJF " /> <PTZ_UP_RIGHT str="C'EJ1' 'D*-CE #9DI 'DJEJF" /> <PTZ_UP_LEFT str="C'EJ1' 'D*-CE #9DI 'DJ3'1" /> <PTZ_DOWN_LEFT str="C'EJ1' 'D*-CE #3AD 'DJ3'1" /> <PTZ_DOWN_RIGHT str="C'EJ1' 'D*-CE #3AD 'DJEJF" /> <PTZ_TOUR_GO str="(/! *,HD C'EJ1' 'D*-CE " /> <PTZ_TOUR_STOP str="%JB'A *,HD C'EJ1' 'D*-CE" /> <PTZ_FOCUS_UP str="*1CJ2 C'EJ1' 'D*-CE D#9DI " /> <PTZ_FOCUS_DOWN str="*1CJ2 C'EJ1' 'D*-CE D#3AD " /> <PTZ_IRIS_UP str="B2-J) 'DC'EJ1' D#9DI" /> <PTZ_IRIS_DOWN str="B2-J) 'DC'EJ1' D#3AD" /> <PTZ_FOCUS_AUTO str="'D*1CJ2 'D*DB'&I DC'EJ1' 'D*-CE" /> <PTZ_IRIS_AUTO str="'DB2-J) 'D*DB'&J) DDC'EJ1'" /> <PTZ_AUTOPAN_START str="(/! *5A-/ %(-'1 C'EJ1' 'D*-CE" /> <PTZ_AUTOPAN_STOP str="%JB'A *5A- / %(-'1C'EJ1' 'D*-CE" /> <PTZ_ZOOM_IN str="*5:J1 C'EJ1' 'D*-CE" /> <PTZ_ZOOM_OUT str="*C(J1C'EJ1' 'D*-CE" /> <SYS_LOG_SYSTEM_INIT str="(/! 'DF8'E" /> <SYS_LOG_SYSTEM_SHUTDOWN str="%:D'B 'DF8'E" /> <SYS_LOG_USER_LOGIN str="/.HD '* DE3*./E" /> <SYS_LOG_USER_LOGOUT str=".1H, 'DE3*./E" /> <SYS_LOG_START_SCH_REC str="(/'J) *HBJ* 'D*3,JD" /> <SYS_LOG_END_SCH_REC str="FG'J) *HBJ* 'D*3,JD" /> <SYS_LOG_START_SCH_ALARM str="(/'J) *HBJ* 'D*F(JG" /> <SYS_LOG_END_SCH_ALARM str="FG'J) *HBJ* 'D*F(JG" /> <SYS_LOG_ENTER_SYS_SETUP str="%9/'/ F8'E 'D/.HD" /> <SYS_LOG_EXIT_SYS_SETUP str="%9/'/ F8'E 'D.1H," /> <SYS_LOG_ENTER_SCH_REC_SETUP str="%9/'/ *HBJ* *3,JD 'D/.HD" /> <SYS_LOG_EXIT_SCH_REC_SETUP str="%9/'/ *HBJ* *3,JD 'D.1H," /> <SYS_LOG_ENTER_SCH_ALARM_SETUP str="%9/'/ *HBJ* *F(JG 'D/.HD" /> <SYS_LOG_EXIT_SCH_ALARM_SETUP str="%9/'/ *HBJ* *F(JG 'D.1H," /> <SYS_LOG_RTSP_GET_CONNECT str="'D-5HD 9DI 'D%*5'D" /> <SYS_LOG_RTSP_LOSE_CONNECT str="AB/'F 'D%*5'D" /> -- <SYS_LOG_SERVER_HTTP_START str="(/! .'/E (1H*HCHD FBD 'DF5 'DA'&B ( %*4 *I *I (I )" /> <SYS_LOG_SERVER_HTTP_STOP str="%JB'A .'/E (1H*HCHD FBD 'DF5 'DA'&B ( %*4 *I *I (I )" /> <SYS_LOG_SERVER_RTSP_START str="(/! .'/E (1H*HCHD 31J'F 'DE9DHE'* AI 'D2EF 'D-BJBI " />? <SYS_LOG_SERVER_RTSP_STOP str="%JB'A .'/E (1H*HCHD 31J'F 'DE9DHE'* AI 'D2EF 'D-BJBI " /> <SYS_LOG_SERVER_RPB_START str="(/! .'/E %9'/) 'D*4:JD 9F (9/" /> <SYS_LOG_SERVER_RPB_STOP str="%JB'A .'/E %9'/) 'D*4:JD 9F (9/" /> <DiskManagement str="%/'1) 'DB15" /> <DeviceType str="FH9 'D#/') / 'D,G'2" /> <Partition str="'D*,2&) / 'D*B3JE" /> <FileSystem str="F8'E 'DEDA" /> <IsPartition str="3JBHE 'DF8'E (%9'/) %F4'! 'D*B3JE  (1,'! 'D*#CJ/ 9DI G0' 'D%,1'!" /> <Image str="'D5H1)" /> <Brightness str="'D37H9" /> <Contrast str="'D*('JF" /> <Saturation str="*4(9 'DDHF" /> <Sharpness str="'DH6H-" /> <Hue str="*/1, 'DDHF" /> <NoSeldesti str="(1,'! %.*J'1 'DEC'F 'DEB5H/" /> <NoSelSource str="(1,'! %.*J'1 B'&E) 'DE5/1 " /> <Time_Range str="'DF8'B 'D2EFI DDEDA" /> <Event_Snapshot str="DB7'* 'D-/+" /> <EventSnapshotViewer str="9'16 DB7'* 'D-/+" /> <Event_Time str="HB* 'D-/+" /> <Event_Type str="FH9 'D-/+" /> <Change_Resolution str="*E *:JJ1 /B) 'D4'4)  GD *1J/ 0DC 'D*:JJ1 " /> <% Select_All str="%.*J'1 'DCD" /> <InitNetowrk str="(/! H-/) #H FEH0, 'D4(C)" /> <InitSystemDate str="(/! H-/) 'DHB* H'D*'1J. " /> <InitDisk str="(/! H-/) 'DB15 " /> <InitRTSP str="(/! FEH0, (1H*HCHD 31J'F 'DE9DHE'F AI 'D2EF 'D-BJBI" /> <NoVideo str="D' JH,/ AJ/JH" /> <Modify str="*9/JD" /> <DisplayCount str="9// E1'* 'D916" /> <Mount str="E+(*" /> <Unmount str=":J1 E+(*" /> <EditEmpty str="(1,'! 'D*#CJ/ 9DI #F 'D%9/'/'* 5-J-) " /> <Account str="'D-3'( " /> <FindListLog str="%J,'/ 3,D'* d%  916 3,D d% AB7 #HD'K" /> <Trigger_Interval_Seconds str="D-8'* A'5D 'D(/! " /> <Alarm_Always str="'D*F(JG /'&E'K " /> <LowFPS str="%F.A'6 E9/D %13'D 'D(*'* DD%7'1 AI 'D+'FJ) " /> <WithFPS str="C'D#9DI" /> <ShowPW str="%8G'1 CDE) 'DE1H1" /> <SelOverMaxPlayHours str="'D%.*J'1 #C+1 EF 3'9'* %d" /> <SelectedCamera str="'DC'EJ1' 'DE-//)" /> <Codec str="CH/JC" /> <Switchto str="'D*(/JD #H 'D*-HJD D" /> <Filter str="*14J-" /> <AutoSettingNote str="(1,'! %/.'D B'9/) 'D*14J- #H %JB'&G' A0'1:) DD(-+ 9F 'DCD" /> <TemplateSetting str="%9/'/ 'DFEH0, / 'DB'D(" /> <SearchByEvent str="'D(-+ ('D-/+" /> <Control str="'D*-CE" /> <SwitchCamera str="EA*'- 'DC'EJ1'" /> <Preview str="E9'JF)" /> <SequentialSearch str="(-+ E*3D3D / E**'DI" /> <Split str="*,2&)" /> <PreSearch str="B(D 'D(-+" /> <SeekTo str="'D(-+ 9F " /> <ShowInformation str="%8G'1 'D(J'F'* " /> <Bitrate_Log str="3,D 319) %13'D 'D(*'*" /> <Save str="-A8" /> <PlaybackControlPad str="DH-) E1'B() %9'/) 'D*4:JD" /> <FormatFault str=".7# AI 'D*F3JB #H 'D5J:)" /> <LowBitrateSetting str="8(7 %F.A'6 E9/D 319) 'D(*'*" /> <NotConfigured str=":J1 E91A" /> <Application str="*7(JB" /> <NameOrMailEmpty str="-BD D%3E #H 'D(1J/ 'D%DC*1HFI A'1:" /> <ONVIF_Auth str="*H+JB EF*/I H',G'* 4(C'* 'DAJ/JH 'DEA*H-) " /> <PIR_Alarm str="*F(JG 'D*-CE 9F (9/ " /> <CameraTamper str="9'C3 'DC'EJ1'" /> <AudioDetection str="#C*4'A 'D5H* " /> <AutoSwitch str=" 'D*-HJD 'D*DB'&I" /> <CancelAutoSwitch str="%D:'! 'D*-HJD 'D*DB'&I " 3/> <MailRepeat str="DB/ BE* (%6'A) FA3 'D(1J/ 'D%DC*1HFI . (1,'! *:JJ1G " /> <SMART str="*BFJ) 'DE1'B() 'D0'*J)  'D*-DJD H 1A9 'D*B'1J1" /> <OVERALL str="9DI 'DCD" /> <PASSED str="EB(HD / E9*E/ " /> <FAILED str=":J1 EB(HD " /> <Raw_Read_Error_Rate str="E9/D .7# 'DB1'!) 'D#HDI" /> <Throughput_Performance str="#/'! AI HB* H'-/" /> <Spin_Up_Time str="2EF /H1'F 'DE9DHE)" /> <Start_Stop_Count str="9// E1'* %JB'A 'D(/!" /> <Reallocated_Sector_Ct str="9// 'DB7'9'* 'DE9'/ *.5J5G' #H *H2J9G'" /> <Seek_Error_Rate str="E9/D .7# 'D(-+ " /> <Seek_Time_Performance str="#/'! HB* 'D(-+" /> <Power_On_Hours str="'D*J'1 AI 3'9'*" /> <Spin_Retry_Count str="%-5'! %9'/) E-'HD) 'DE1AB" /> <Calibration_Retry_Count str="%-5'! %9'/) E-'HD) 'D*:JJ1" /> <Power_Cycle_Count str="%-5'! /'&1) 'D*J'1" /> <Power_Off_Retract_Count str="%-5'! 1,H9 B79 'D*J'1" /> <Load_Cycle_Count str="%-5'! /'&1) 'D*-EJD " /> <Temperature_Celsius str="/1,) 'D-1'1) 'DE&HJ)" /> <Reallocated_Event_Count str="%-5'! 'D-/+ 'DE& 9'/ *.5J5) #H *H2J9G" /> <Current_Pending_Sector str="B7'9 'D%F*8'1 'D-'DI" /> <Offline_Uncorrectable str=":J1 E*5D :J1 B'(D DD*5-J-" /> <UDMA_CRC_Error_Count str="%-5'! .7# #H E4CD) AI 'DG'1/ /J3C " /> <Multi_Zone_Error_Rate str="E9/D .7# 'DEF7B) 'DE*9//) " /> <SMART_RAW_VALUE str="'DBJE) 'D#HDJ)" /> <SMART_WORST str="'DE1,9" /> <SMART_Event str="*BFJ) 'DE1'B() 'D0'*J)  'D*-DJD H 1A9 'D*B'1J1 - 'DB15 'D5D(" /> <DisplayRatio str="E9/D #H 'D916 " /> <FitWindow str="F'A0) *H'ABJ) " /> <KeepRatio str="E9/D 'D-A8" /> <Joystick str="95' 'D*H,JG - 01'9 'D#D9'(" /> <Joystick_Information str="(J'F'* 95' 'D*H,JG" /> <Joystick_Model str="FEH0, 95' 'D*H,JG" /> <Axis_Count str="*9/'/ 'DE-H1" /> <Button_Count str="9// 'DEA'*J-" /> <Axis_X str="BJE) 'DE-H1 'D3JFI" /> <Axis_Y str="BJE) 'DE-H1'D5'/I" /> <Axis_Z str="BJE) 'DE-H1 'D9JFI" /> <Buttons_Status str="H69 'DEA'*J-" /> <Joystick_Buttons_Setting str="8(7 EA'*J- 95' 'D*H,JG" /> <Button str="'D21 / 'DEA*'-" /> <Next_Division & str="'D*B3JE 'D*'DI" /> <Previous_Division str="'D*B3JE 'D3'(B" /> <Next_Window str="'DF'A0) 'D*'DJ) " /> <Previous_Window str="'DF'A0) 'D3'(B)" /> <Switch_Division_One str="*B3JE 'DEA*'- 'D'HD" /> <Axis_Z_ID str="'(7'B) 'DE-H1 'D9JFI " /> <RAID_Err_Alarm str="*F(JG .7# #H E4CD) E5AHA) 'D*9// DD#B1'5 'DE3*BD)" /> <Create str="%F4'!" /> <Detail str="*A'5JD" /> <Rebuild str="%9'/) %F4'!" /> <EraseDisk str="3JBHE G0' 'D%,1'! (E3- ,EJ9 'D(J'F'* EF 9DI 'DB15  (1,'! *#CJ/ 0DC 'D%,1'!" /> <FishEyeCtrl str="*-CE 9/3'* 'DAJ4 #I" /> <FishEyeDispMode str="FE7 'D916" /> <FishEyePosition str="'DH69" /> <FishEyeWin str="'DF'A0) " /> <InvalidFirmware str="'D(1F'E, 'D+'(* 'D:J1 5-J-" /> <ConnectLost str="AB/'F 'D%*5'D" /> <ConnectFail str="A4D 'D%*5'D" /> <GetSettingValueErr str="D' J3*7J9 'D-5HD 9DI BJE) 'D%9/'/" /> <Refresh str="(1,'! %9'/) 'D*,/J/ / 'D*F4J7" /> <IE_Protected_Open str="*E *A9JD H69 'D%F*1F* %C3(DH1 'DE-EI  (1,'! %6'A) G0' %DI EH'B9 'D%F1*F* %C3(DH1 'DEH+HB (G' . " 3/> <Backuping str="'DF3. 'D%-*J'7I .. (1,'! 'D%F*8'1" /> <Converting str="'D*-HJD . (1,'! 'D%F*8'1" /> <ShowDate str="*'1J. 'D916" /> <ShowTime str="HB* 'D916" /> <Subtitle str="'D9FH'F 'DA19I" /> <PreSecond str=" 'D+'FJ) 'DE*B/E)" /> <PreFrame str=" 'D%7'1 'DE*B/E" /> <NextSecond str="'D+'FJ) 'D*'DJ) " /> <NextFrame str="'D%7'1 'D*'DI " /> <LowBitrate str="%F.A'6 E9/D %13'D 'D(*'* " /> <DigitalZoom str="'D*C(J1 H'D*5:J1 'D1BEI" /> <MotionSearch str="(-+ 'D-1C)" /> <TimeSplit str="*B3JE 'DHB*" /> <ShowDetailWindow str="F'A0) (J'F'* 'D916" /> <FirstPage str="'D5A-) 'D#HDI" /> <PrePage str="'D5A-) 'DE*B/E)" /> <NextPage str="'D5A-) 'D*'DJ) " /> <LastPage str="'D5A-) 'D#.J1)" /> <DetailPicture str="*A'5JD 'D5H1)" /> <SelectTime str="*-/J/ 'DHB*" /> <ErrStartEndTm str=".7# AI HB* 'D(/'J) #H HB* 'DFG'J) " /> <SearchSet str="%9/'/ 'D(-+" /> <ShowSearchImage str="916 5H1) 'D(-+" /> <ShowDetectMark str="916 9D'E) 'D%C*4'A" /> <DetectInterval str="A*1) 'D%C*4'A" /> <0Exit str="'D.1H," /> <Grayscale str="*/1, 1E'/I" /> <Softness str="3D'3) " /> <Reset str="%9'/) 8(7" /> <Print str="7('9)" /> <RetryAgain str="(1,'! 'DE-'HD) D'-B'K" /> <FirmwareUpgrade_msg str="%3*CE'D *-/J+ 'D(1F'E, 'D+'(*.. (1,'! %9'/) 'D%*5'D " /> <SYSTEM_TIME_MSG str="3JBHE B* F8'E 'D*9/JD (%9'/) *4:JD ./E) 'D*3,JD  (1,'! 'D6:7 9DI &quot; F9E &quot; DD%3*E1'1 #H &quot; D'&quot; DD%D:'! ." /> <TWO_WAYAUDIOUSED str="*E %3*./'E %*,'GJF DD5H*" /> <Weekly str="#3(H9J'K" /> <SAVEAS str="-A8 (%3E" /> <Send_To str="J13D %DI " /> <ACTION_DESC_SNAPSHOT str="5H1) 'D916 9F/ (/! 'D-/+ " /> <ACTION_DESC_RECORD str="*3,JD 'DAJ/JH 9F/ (/! 'D-/+" /> <ACTION_DESC_DISPLAY str="916 'D13'D) 9DI 'DE9'JF) 'DE('41)" /> <ACTION_DESC_MAIL str="%13'D %49'1 ('D(1J/ 9F/ (/! 'D-/+" /> <ACTION_DESC_VOICE str="*4:JD 5H* 'D*F(JG 9F/ (/! 'D-/+" /> <ACTION_DESC_DO str="'D%/.'DI 'D1BEI 9F/ (/! 'D-/+" /> <ACTION_DESC_FTP str="1A9 'D5H1 9DI EHB9 (1H*HCHD FBD 'DEDA'* " /> <ACTION_DESC_BUZZER str="'D% %F0'1 9F/ (/! 'D-/+" /> <ACTION_DESC_TCP str="1A9 'D5H1 9DI EHB9 (1H*HCHD 8(7 'D%13'D" /> <ACTION_DESC_HTTP str="1A9 'D5H1 9DI EHB9 (1H*HCHD FBD 'DF5 'DA'&B " /> <TCP str="(1H*HCHD 8(7 'D%13'D" /> <HTTP str="(1H*HCHD FBD 'DF5 'DA'&B " /> <FTP str="(1H*HCHD FBD 'DEDA'*" /> <EVENT_DESC_MOTION str="%C*4'A H69 -1C) 'D5H1)" /> <EVENT_DESC_BLOCK str="%C*4'A -81 'DC'EJ1'" /> <EVENT_DESC_BLUR str="%C*4'A 9/E *1CJ2 'DC'EJ1'" /> <EVENT_DESC_CAM_MOVE str="%C*4'A *-1C %*,'G 'DC'EJ1'" /> <EVENT_DESC_DI str="%C*4'A H69 *:JJ1 'D%/.'D 'D1BEI" /> <EVENT_DESC_HDD_ERR str="%C*4'A .7# 'H E4CD) AI 'DB15 'D5D(" /> <EVENT_DESC_DISCONNECT str="%C*4'A 9/E %*5'D 'DC'EJ1'" /> <EVENT_DESC_FORCE str="%C*4'A (/! 'D*HBJ* " /> <EVENT_DESC_PIR str="*F(JG 9F (9/" /> <EVENT_DESC_TAMPER str="9'C3 'DC'EJ1'" /> <EVENT_DESC_AUDIO_DETECTION str="%C*4'A 'D5H* " /> <ALARM_EVENT_SELECT str="*-/J/ *F(JG 'D-/+" /> <CREATE_NEW_FOLDER str="%F4'! E,D/ ,/J/" /> <CHANGE_NAME str="*:JJ1 'D%3E" /> <TIME_SET_ERROR str=".?7# AI 8(7 'DHB*  (1,'! E1',9) %9/'/ 'DHB* " /> <Export str="(/! 'D%13'D" /> <SEL_VIEW_CH str="%.*J'1 BF') 'D916" /> <SYSTEM_UPDATEMESSAGE str="1A9 'D%9/'/ 'D#F  (1,'! %9'/) 'D%*5'D (9/ 40 +'FJ) " /> <START_MONITOR_ALL str="(/! E1'B() 'DCD" /> <UPDATE_FAIL str="D' *3*7J9 1A9 'D%9/'/  (1,'! 'DE-'HD) D'-B'K " /> <DI_REC_TRIGGER str="(/! *3,JD DL EF .D'D :" /> <PASTE str="D5B" /> <PASTE_MON_FRI str="-A8 EF 'D%+FJF %DI 'D,E9)" /> <PASTE_SAT_SUN str="-A8 EF 'D3(* %DI 'D#-/" /> <PASTE_ALL_CAM str="-A8 %DI CD 'DC'EJ1'" /> <APPLY_ALL str="*7(JB 'DCD" /> <UN_SELECT_ALL str="%D:'! 'DCD" /> <GET_PARAM_FAIL_USE_DEFAULT str="A4D* E-'HD) 'D-5HD 9DI E9'ED 'D#/')  3HA J3*./E 'DF8'E 'DBJE) 'D%A*1'6J) " /> <NO_CAM_NAME str="-BD %3E 'DC'EJ1' A'1:  GD *1J/ %3*./'E 'D%3E 'D%A*1'6I  " /> <ERR_SETUP str=".7# AI (J'F'* 'D*91JA  (1,'! %9'/) 'DE1',9)" /> <DEL_CAM_COFIRM str="GD #F* E*#C/ #FC *1:( AI -0A S% EF 'DB'&E) " /> <ADD_CAM_ERR_ALREADY_HAS str="*H,/ S% ('DA9D AI 'DB'&E)  (1,'! %9'/) * E1',9) 'D*91JA" /> <MOTION_GET_DATA_ERR str="A4D* E-'HD) 'D-5HD 9DI (J'F'* 'D-1C)" /> <SHOW_LIVE_CAM str="916 'DC'EJ1' 'DE('41)" /> <SHOW_PB_CAM str="916 C'EJ1' %9'/) 'D*4:JD " /> <DELETE_CAM str="%D:'! 916 'DC'EJ1' " /> <NoCamSupportPreset str="No Camera Support Preset"/> <ACTION_DESC_PRESET str="Go To Preset"/> <EVENT_DESC_SMART_ERR str="Detect HDD S.M.A.R.T Error"/> <EVENT_DESC_RAID_ERR str="Detect RAID Error"/> <AutoPan str="Navigation"/> <ACTION_DESC_AUTO_PAN str="Start Navigation"/> </root> sysAڗR˺R˺RsbinAڗR;˺R;˺R routeƗR;˺R;˺R../bin/busyboxsuloginƗR;˺R;˺R../bin/busyboxarpƗR;˺R;˺R../bin/busyboxvconfigƗR;˺R;˺R../bin/busyboxslattachƗR;˺R;˺R../bin/busyboxstart-stop-daemonƗR;˺R;˺R../bin/busyboxsetconsoleƗR;˺R;˺R../bin/busybox acpidƗR;˺R;˺R../bin/busyboxlspciƗR;˺R;˺R../bin/busyboxloadkmapƗR;˺R;˺R../bin/busyboxifupƗR;˺R;˺R../bin/busyboxifdownƗR;˺R;˺R../bin/busybox rmmodƗR;˺R;˺R../bin/busybox!hwclockƗR;˺R;˺R../bin/busybox"ifconfigƗR;˺R;˺R../bin/busybox#insmodƗR;˺R;˺R../bin/busybox$findfsƗR;˺R;˺R../bin/busybox%watchdogƗR;˺R;˺R../bin/busybox&logreadƗR;˺R;˺R../bin/busybox' initƗR;˺R;˺R../bin/busybox( blkidƗR;˺R;˺R../bin/busybox)klogdƗR;˺R;˺R../bin/busybox*manƗR;˺R;˺R../bin/busybox+adjtimexƗR;˺R;˺R../bin/busybox,makedevsƗR;˺R;˺R../bin/busybox-ifenslaveƗR;˺R;˺R../bin/busybox.tune2fsƗR;˺R;˺R../bin/busybox/pivot_rootƗR;˺R;˺R../bin/busybox03hdparmƗR;˺R;˺R../bin/busybox1&switch_rootƗR;˺R;˺R../bin/busybox2%sysctlƗR;˺R;˺R../bin/busybox30automount.shƗRP˺Rw4*#!/bin/sh LD_LIBRARY_PATH=/lib:/envr:/sbin:/bin export LD_LIBRARY_PATH /envr/StorageManager "$ACTION"_"$DEVNAME" 4wlosetupƗR;˺R;˺R../bin/busybox5?swaponƗR;˺R;˺R../bin/busybox6<inotifydƗR;˺R;˺R../bin/busybox7)tunctlƗR;˺R;˺R../bin/busybox8)gettyƗR;˺R;˺R../bin/busybox9<raidautorunƗR;˺R;˺R../bin/busybox:?fsck.minixƗR;˺R;˺R../bin/busybox;*haltƗR;˺R;˺R../bin/busybox<0mke2fsƗR;˺R;˺R../bin/busybox=%mkswapƗR;˺R;˺R../bin/busybox>&lsusbƗR;˺R;˺R../bin/busybox?3runlevelƗR;˺R;˺R../bin/busybox@syslogdƗR;˺R;˺R../bin/busyboxA poweroffƗR;˺R;˺R../bin/busyboxBmkdosfsƗR;˺R;˺R../bin/busyboxCdepmodƗR;˺R;˺R../bin/busyboxDmodprobeƗR;˺R;˺R../bin/busyboxEmkfs.vfatƗR;˺R;˺R../bin/busyboxFmkfs.ext2ƗR;˺R;˺R../bin/busyboxGfreeramdiskƗR;˺R;˺R../bin/busyboxHnameifƗR;˺R;˺R../bin/busyboxIfdiskƗR;˺R;˺R../bin/busyboxJswapoffƗR;˺R;˺R../bin/busyboxKrebootƗR;˺R;˺R../bin/busyboxLmdevƗR;˺R;˺R../bin/busyboxMfbsplashƗR;˺R;˺R../bin/busyboxN devmemƗR;˺R;˺R../bin/busyboxOzcipƗR;˺R;˺R../bin/busyboxP<lsmodƗR;˺R;˺R../bin/busyboxQ)udhcpcƗR;˺R;˺R../bin/busyboxR*mkfs.minixƗR;˺R;˺R../bin/busyboxS?binAڗR̗R̗RT%Tprintenv̗R;˺R;˺RbusyboxU0Tparted̗R̗R̗RV3ELF(Ț44 (pll l 444tt,YQtd/lib/ld-uClibc.so.0EYjt.v3V#Rosc\47ikpXWT5nK2[a^_y?eJw~bz|,LufH:q{r%>Sxd}Q&mOgI](8hl"  ' 1BD<=@-6FG 09!U+*)CM/ $P;N`AZHT`ldxhl _nؕ̕Q, ,(8DP\ht8Z{PvȖԖ@sV</(v4$@ELXdMp5|pcI[,0!ȚP ė)З'ܗ0< $0<BHT`lqx D6̘Xؘ,Jj , 8kD5P\Uhot;f,"a}!ș"ԙ[DȒ(4@L,Xd7pb|K=Wgetenvmallocstderrfree__data_startmemcpyabortcallocreallocmemsetraiselibc.so.0strlenvfprintfsrandomstrncasecmpvasprintfiswprintclosedirfflushstrdupfgetsvsnprintfforkreadlinkgetppidlseek64fcntllstat64ftello64__errno_locationopendirstdinmemmovegetpagesize_exitreadfseeko64fsyncaccessfdopenstrcatisattyfopen64__fpendinggetcwdsigactionfeof__fpurgefscanfstrtollmemcmpconnectsscanfmbrtowcusleepunamewaitpidstrchrioctlstrcasecmpsysconf__xpg_strerror_r__uClibc_mainferrorfputcfputsgetpid__sigsetjmpstrncmptolowerftruncatestrcmp__ctype_b_stdlib_mb_cur_maxsyscalV?lstrtolfilenoposix_memalignreaddir64rewind__assertsocket__fputc_unlocked__freadingstrncpylocaltimeexeclsigfillset__glibc_strerror_rstrcpygettimeofdayjrand48gmtimestrstrumaskfclosembsinitstrnlenstrrchrstatgetuidatoi__stdoutfwritesiglongjmp__cxa_atexit_edata__bss_start__bss_start____bss_end____end___end:^g      $(,048<@DHLPTX\` d!h"l#p$t%x&|()*+,-./012345678;đ=ȑ>̑?Б@ԑAؑBܑCDEFGHIJKLMN OQRST U$V(W,X0Z4[8\<]@_D`HaLbPcTdXe\i`jdkhllmpntoxp|qrstuwxyz{|}~ -L-Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌV* Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌ  --- 0c(gD$GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/H-M   0 00 0S  000 0000  0  0  0  0KH-M 00000 0K-M  00 000 0!000S0!00  00!00 Ћ/H-M  0 0 00 0S0700 #0!0000T0S S0!000 0S  0s0 0 0 0 00 000 0!000S 0s0 0!000KH-M 00 0 0 000c0w00 00 0 00S0KH-M 00 0@h0 0x000 0H0S 0 00R*00  0   ~K8gH- M 0 0S @ @00 n0 @-0 0K  00S 00` 00P+ 0 1Y8u+ 0@P00  "?c0t0#0"? c020b1 c  0$00 Kp m(mH-M 80S 800 @$ 0!*00KHmH-M 00I&0S X00S 00  `, 0)0 S000KmH-M 000 )0S00KmH-M !K0 K0SHHH H0$!KK0S0!K 0K4nhn ~H-0MK0 40 0"K 0!K00S 00s "2$000S  0 0000S 0 000 ? 0!K4!KK0S K"K P0"K00 0 000S 000 ? 0!K4!KcK0S K!K P0!K00 0 00 000S* 000S% K"KPK"KQP00S00 K!KPK"KQP00s00  0C$000S 00 000S 00 0S 0S"K 0!K  0Ktnhn-}nM0H- `MP T X \0 P0 "KP0!#K 0#K 0$K0L0 L0H0 "KX@0 0 #KX@00 0 00!QP000 T0S T0 ,K\0S 0V% H0 T0!4K0S 0L0 0RH00H0 L00L0 "KHK <K \000 #KLKDK 000 #KR$KR\\\"\2#0S> 0S;0S8K#KPH00H0 "KHK <K \000 #KR!1w#L00L0 #KLKDK 000 $KRlTh!T1]#0S 0! 0S 0 0 0"K"K0S0 0 00S0"#K#K"K\J0S 0.##K J0Sl l0##"KKPtDj/D0#"KCKK@TPPH K0nhn}nnnoLoH- M   D0<00"   0@L0KhH-M 0=00 0S K$H-M00  001000  01SK$H-M00 \ X010 D0!80 1$000  01SK\o0iH-M 0S 00 0S M0KH-M 0 0 '00 300 0S '' 0KR0S6 0S /0S& 00SK0S 50 0400 0S 50S 500 0S P0 0 40Kto H-pM` X(0@0 0$K 0%K0X0 0\0 0 0 00 00 00 00 `002080 80S 870S 70S008 570S 800Y60S0<0 <0Kd8 V& 0S 800F60S 800000S<0S 00 0 0$0 <0S $0S 6 $000000S 0@0 @0KT0Sp $g`0L KX0Kh 0Sg `0T K\0KH0S` <@K%K 8 :040 40SS 40 X0\8 \`0X \0 q000 00S%5f!l50S`00%0,0 @50S`00$0,0 `00k$0,0 ,0S$ %5B!0,K0(0 0#L,!L(0S &84( A0S00 0K(L 0[0#0S &`00N00 84 A0S00 0KK 0[0#0SX40!G0S \40"G0SB`0$K--00 `0%K&-00 `040!-00 `040"-00 30S   t30S @00XQ D  #0%0S{20S84 k00#0S 20S84 ^00#0S 20S 0`0|"|%0@SR%;% 0S 4 ;0S$ "1| ?0 0 @04A;0SE 4:0S 4 N:830S8 8%3X0S X0E\0S \0E`00 0S D1 0484rA49  82X0S X0E\0S \0E0KoВoooooooohna}okp4ppp H-M 00 0000 0 0S3 0K  WV30S# 0j;0 000 0S 0;0S  730S 20 ~ v20KqoH-$M(  (00 0 0 0 00 D00 6(90S, 0S 00 0 0 00 K' 00 0C00 0 0  @000 K' 00 jC00 0S0Kq- M 0Ћ/H-M 0S 0A0H0 0 00   ?A+00 |00S p 0 0 00 H 0 0 00Kqhn?}(q8q0H- xMh l `2dK H0 h 00+00 (00 h0h0! B 0 0Q Q R0h*00 l0S l00010 10S( 0S Sl}dz\wXAh0h0 W0! PK 0h0h0!hPP 00P  0#h0 h0 W0 K 00  h00  h0!h IG(0S (0Sh*(00S80 K0|}qqqqqqqq r0H- M 00 0t0 0p0 0l0 0h0 0d0 d0S> d e0SP0D0 D0t0 -d` V0SA0@0 @0p0 d( G0S d @0S+0<0 <0l0 : d000000h0 dt0Sl0S00.00 0S 30S `:0S00 530S~ t0SC 040 y4040! B V30 04)0\0 )400\ O\41040 40S000080 Y8d 0 00S0K000S0B8o0>l0S X080S h0S 00 000 0K 0S 06000 N00000t0S |80Sp80,0 ,0H0S ,0 ,00R*,00  ,0  ,+ ,0010|0 0010x0 70SN'0S'0 0(0 00'7 0(0 |0S (h (` x0S (L (D (L0o00 (90H0 p0SH60S H0400Sn%0P0 H000S&H000P b6PT&\P 0$0 0H0!)0`0 0H0 000! B 0 0 0(0\0 0H0"(0X0 &0S$`5 $\2 $`. $\+ $X( H0400S+|0S H040@0T0 $T H080S H08004$ x0S H80T0 $T H0 0 $  E|0S $h $ x0S $D $8 $$U P+`)\'X%HW80H0 H0S=0L0 LL(5 B80H0 p0SH60S H0400SH000St#H000\#\30 0H0!P(00 (30H0 000! B 0 0 0'00 2s%0S 0H0"(00 \2aH040V & 0SYH080S "H0800O100 0H0S 0 00R*00:  0 ::+x0S AH?70((100 0H0S 0 00R*00:  0 :Y:H00 0H7Hw70H0 H0S27.02.00 K0$r,rg4rВ8roDrLrTrXr`rhrtr|rrrrrrrrrH-M0 0  0K000 0H0S 0 00R*00  0    00 0 0S0KH-M 00H-M !K600 0S 00!KA0S00KH-4M( (00"0$0 $0S0j(00$!0 0 0S0^(00 MA0S t@0R G00 (0 0 0! ( <0SE0;E 0 0 &00 0 0!&00 $0@(040>000000Ft 0y00 4@RP0S @S0 0($L5(00-0KrpH-M  00! 0OP 00b Q00 000"dK 0L?p20#`20X$0 "Kv<2`0 K P0 @P0!  0  0!0#0DK 0 "K?1@100"PKDKdK! 0 C0!K  7300 0S0KD#T0K :0S V0S S s# 0KD0'V % ;An30KDK 0 0"K0"KPH00Hc#0 :R30KD0Kp$sh?H-pMx 0"K 0#Kx00;*0 0 0S x0 ,0K 00S x0 40K 00S K"K P0 0" 0@Px000 ?T K"K P0 0" 0@Px000@_x0002 ?R*K"K P0 0z" 0@Px00i0 ?T K"K P0 0c" 0x00S0 ?x00K02 ?!Kx0K!K P0R 0xBKaKV`p`pK@PTTK =x0K!K P0R 0xBKaKV`p`pK@PTtK =T Kt0K  S0S +x00 0S H0 0  y+0Koo H-M 0 0 008)00 0S% 0K 0S 0C0S 09+K+00 0S <0 0<+0Kq H-M 000 0Kts0S000S0 00 0 000K0sH- M  0 0R  07000 0S00 0 0S0 0 l\h \00 0 G! 0 QP000K 0[K@3000#340  p0L E@!0  0\0pl 1P` @300 0 C0z P@\200  *04a P@200  0Hlh P\@1H2 D20 00  0T) P@1 10 0  0  P@100 d 0LH ` H0mS mShS lS aS -vS  S% sS &00 &00 #T1 H1 0 0 01 ,1,V ?! 1!1 1 00 0 00 0! 0S{D0S>0Se8 0 t00 c 0 $0 X001 $0 0K{g$xg {dgВ{(H-M  00S 000%00 0S0$00 C0 00 0 00 0SP@ F0S 00S00K|H-M  0S; 5.0S( 00S{0S"0S 00S00 0S || t0 l00S X0 0 0K|`($H-M 080S 0 0S l h00S \00SP00S < F000zKT| |$H-M  00 K0Kn0 0 0S00Sp00S  0 KT00  0K8 00 00S00K@$H-M &0KH-M 0 0K 0[$0KH-M   0KH-M     J0KH-M e0KH-M [0KH-M  P00 0S  0R 00 0KH-M  00 0K~H-M00 0 0KH-M 0S 00KH-M 000 KH-M 00 00 0 0KH- M 0V<S @00000K-M  00 000 0S 00S0S 0  00Ћ/H-M  0S 00 000 00Sy 0 000 q00 00 0  0KH-M  '00KH-M  00 0 0  00S 000S#0 00 0 0S0KH-M  0v0K-H-M00 0S 00  0  0 0 0S0KHЍ/-H-M00 0S 00  0  0 0 0S0KHЍ/H-M 000KH- M 00 00 0 0 00 %00S 0000 n 000 0 0 0   0 0700C0 000 0S 0K~H-M 00 00S 00q000 0SK-M  00K00  000 [R0000  0R0Ћ/- M00K\0 0[000;S 80 0[000;S00Ћ/- M00K0[ S00Ћ/H-8M0 4 8 <0 4 <00c Sddo/`3A4 800c0 00(0 (00S (00$0 $0 0 0 0 0 C00CR000   0R0 $0000S 000 00C0 0S  $0000S 00C0 0S  $0000S00$ O00 0s 00C0 0 0 0S 0V) 0 00 000   0R $000l0S0S00$0$ 0$0 00c 0 4 <00c0 (00S$00S 1<!& 0S 000 0H0S 0 00R*00  0  T   0RU$ 0SO$G$0 0c0 (00(0 (0S2K~4~H~@~~H- M  000S00@0 0S00KH-M  0 0  00 0KH-M  00 0 0 00  00  0R00 000 0S 0KH-M  00 0 0 00 00 0S S 00S 0 0 00 000 0S 0S00K-M 0 0 00  00 0 000 0S 0Ћ/- M00 H00S<00S 90SP00 0Ћ/H-000S$ $00L -Ћ/H-M 00 0 0  0S# 000 0H0S 0 00R*00  0  0 0S +K`pH-M   0S (0 0 K脠0H-M   00 0S0  i 00S S  003 ppY/l0h T00< L 4002 , 0܂L `oH-M   10lZ 0Sl1 " 000CSV G$Dd$!$10, L> !10& D6 00* <. 00$ 4& 00% , 00* $ d00- d D002 H $000 u܂ă@hĄH-M   10 0SXl1 000CSG$Dd$!$10# > !10$ 6 00, . 00! & 00&  00(  d00& d D00) H $000 ܂,Px̅ HtH-M  81  ,1  1  0S 0;L0000 @00 00 0S 00S  00yx0000S `0 C00 00 0  0K`p-M  0S00 000  00S 0000  0R0Ћ/H-M 00S0000 0900 00 00L <0(00 0 0 JK܂H-M 0000 000S0200S0S00S0#0 00c00 0S 0SP00S D00S 400S $0 00 0K0H-M 00t 0 K4H-Mp00Sddd d0 L000 0 40000 $0V 00  0K44H-000 4H-,00S 00004H-0004- M 000 D0 00000 0S00S00Ћ/H-FM  00 0 0K101 10 S 00 G10 S 0S1SB0S?0S 10L0S 00 10 0K$0S 10 [R00 0S 10\S100S 101 1 0K0 000 101 10S0S1S  D0K 0 >K10S 1SKІH-M  @0000 0"00 0KH- M  /00 0S 0S 0S/1 0SI 0SD00S 00 0 0 /  0R |00 0S p0SH00 00 $00 00 00 \ 00 0 0S00 $0S 00S r00 |m00 h00 `c00 00S <Y00 0KԆ  H- M  $0 0 0 00 0S  p0S C0 0 00 00S 0S6 3  <00  !00 0S0 00S 0S $W0S 0S 0S K0H-M   0 >0S$ 0 0 0S 0& 00 0SV x 0J 0S 0H00S 0  0n0S0KH- M $ $00K A$00S 0K0  00 0 0S0 ,0$ 00 Y0K,H-(M  $0 0 00 0  00 0y0 0 0S$ 0  0S$0S 0 {. $0 $00S00  0 0S   0 $0S $0 0  $000 0KH-M  00S 00!0 0 000 0 00  000 0S0L000S 0 0 0K<@DH-M  00S 00000  00 0 0S0 y 00 0S00  0KH-M  00S 0000 0 0K0S000Shhh h0C00 0R 0000 0S00  0K0H-M   00S 00000 0 0K0S@` R 0 0 %00 0S@( C 00  0K8XH-M  00S 0000 0A0 0 0S@p  0 00 0S@@ 0 0 0  0KTtH-M  00S 0000 000 0S@\ 0 0 00S$$$ $00KXԇWVH- M  00 00 \"0S +00 >00 H00 >,00 0S 00 0  0S 6, 0 j00KH-M 00 9$0S0 000  0R0KH-M 0S0000S0G#0S 00KH-M 000S0.#0S00KH-M   0 0 0S 0 0 0 0 0S 0 0 0 0 0S \0 0 H0 0 0S@(! 0A 0 00 0S@ 0/[0S U0S0 L0S pF0S0 P=0S 870S0 0K$H-M  00  0 0   0800  0000  0 0 0S 000 0S0!~0 0  00S  00S  0 0 7 0KH-M  00S 00a0 0 00Z0 0 00  0T00 0S0D000S 00 00KHLPH-M  00 00 000 000 0 S000  00 0  0S  0 00KH-M10 0 0S0 0 0K !00 0K,0H-V M00  030 @ P 0 \0! P01S0 000  03@S 00 K0<H-M00  001000  01SK<H- |x t l0 hd m X0 H00@<000 0 0@<D@DH-,00Y 00U00Q<@DH- |x : l0 hd 3 X0 H00g@<00b0v 0 0HHPLPH-,00 0000HLPH-M0 0 0 0 00 0 00S0#  0 0 0S 00 d0 00 D0 <00S0 00 0S0KTH-M0 00 d0 00 D0 <00S000 0S0KX-0Ћ/H-M0S 0S H0S ~0S 0S0Wd( 0KT1T! P1P! L1L! H1H! <1 K0 1!1 0 ( 0 0  0 0 0 0 0 0 |0 t0 d0 \0  P0 D0 80 0K$| xH-0000TXH-M,2 (20200 0H0S 0 00R*00  0   w!10 v100 0H0S 0 00R*00  0   VT 10 0 0H0S 0 00R* 00  0   7 00 6000 0H0S 0 00R*00  0  i $0  XdpH-M  00K蘈H- M $ $$00 1$  1 10 00|10&00 0 0 H+<100S $100 0H0S 0 00R*00  0   0K 0w0S 200 0S T000 0  0S  00S@=8H- M  $0 $1  00 0!$000a000   0R'00 0S& 00>0 0  0S 000Sl l00: FP 0S 0S00K8H-M 0S\\= X0F<00  0 0  0  0 0KlxH-M 0SN 1#00SO 00 0 !00 0 010 0100,000 0 0R0 0100 00 0 0 0R000 0  K耉x- M  0R00Ћ/0H- M 0Sh 100Sthi d10 0S0010 0 00 0 010 000 0 0R00 -00 "0 01@0 010P0 010 010 |00V000000 0 0R000 0 0R K0耉x`H-M  0S 0T0 0001V0 0 0 0010  00 0 eK耉x܉H-M  01 00 00 0!0@00000!000S000 000 0SKH-0@0S 0@00#0S  00@0S 0@00#0S x t0 :00 0S0 0  0  0 0 ,i0K( P?<ZH-M 0S 00nvKH-M 0S 0 0 0 0R0 0 00  3/KH-M 0S 0 0 0 0 0 0  0 KH- M  0S$ 0 0  tO0S0@0 000c400U0 0 KH-M  0S 0  KH-MK!KK!K 0 0!K? 0K- M 0  Ћ/,-00Ћ/,0H- M  0L0 P  ?!K0 SX(`4`@`L`V\`h`8a```t````0!L 0I/0F=) -0BE? ?> <+09&06!03 <00!B 00"0!00! B 0 0d 0 0 @@ s 000 ,0 K0ʚ;@- M  01Ћ/0H-M 00  H010S0000 0 S0K0H-M 0000 0S00KI-M +K0! K` 0#K0SPP L4$0S:0H0 0 0 00 ?KH 0 00 ?? 0`p 00 ?K5 0 00 ?,@P 00 ?K$K`@!d {0K00S 0S 0S0c 0 K 0@PU 0K@ d W0Ks00S&+KP00+K&P00+KP00 +K' P0000 Kx@P 0n 0 0 56y 0#K0@K 1 70S 0@0S > 0@K 1Y80S 0@0S >  56#K` 0"K0@K 1 70S 0@0S @ @K 1Y80S @$@ @K#K $00 d 0K0KrN T{Gzt??$H-M !K0S444 400000!K0K  ,0H- M !K0S``` `00!V B 000 K00H- M !K0SddJ/`00!B 00(s0 K0,H-M   0 ,00    0w0K,-M 0 0 $0 000000 0S 000 0 C00  000  000S 00 0 000SЋ/H-M 000 00S P0 000000S00$0S0K(-M 00 00 l0 000000;S  00 000  000SЋ/-M 0 0 00 00 |0 000000;S00 0 0 000  000S 0S00Ћ/0H- 8M0 4 8 <0 40L04 P  ?!K000 0S07( K(0K0(K0S @!0`$ 40L0R40L00C@!S 40P0R40P00C@l!F(0 ?B 00$4P 0 ? 08 8040"PP4000@ 00S<0S 80 4 <0 "<0S <00S 00 8 0 <0S <0 0 K0,8`-M !K!KR 00 0!KP0 0 0!KЋ/H-(M "KK  P0 0!KK 0 0 KK K P0PK"K P0P0 K!KP 0 0 !K0KH-V M  r0S&0000iS000g0C S񟗂pprprprpprpprprprprprprp 0 0~ 0| 0z00Si 00h0%0COS`hrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtr8r`rtrtrtrPrtrtrtr@rtrHrtrtrtrtrtr0rXr0000000 0 0S,00S000 0K,- MKK 0 K 00S000Ћ/0H- 8M0 4 8 <0 00S 04< 0)000$0 $0S $p$0 0 8080 0 $ ",0K %0S @!i48 0!K40!K 0 0!K!KR 0!KK0S 0!KK"K 0@P40! 0J 0 0< $00-S<040" 0< 0S <0 K4| 0 00S4000@ 00n <0 4E 0< $B0$>< 0 0S 0 0 K0БԑH-M 0SxxF t0Y00S`TG P0P00S@0H ,0G00 0 0  KThp@H-M 00 00ST 0)0SU 0!00 0  00 00 0 0S 0R 0SXHZ D0 0S 0 0 0 0 K@hܢT- M 0S 0000Ћ/@H-M 0V 0 0Sttz p000 000S 00 0S0KĒhȢH-M 00 0S 00S0100 50S 0 00 00=0003/0S00 0S@00S '0KԒh,H-M 0S 0\0S, 0 0 0S00@ 0 z00 0S 0003/0S 0  0 0KԒhH-M  000,03/0 0 0S% 0  X0S   00 x0S 0S 3 0S 0  0KH-M 0S 100S xl h1000 0SP@,<1000,0S($!1000 03/0 0 0S1 0S&  00 j0S {0S  00 0S 0S 0 0 0 D0K h4LtH-M v00 000S0g00 0S0K0H- 8M8 80S!1H8t0Sk 040 40S!17400083/0S00-0K- [0"K80! V 0 0 0"K"K!K80BK"K 0P80"K P0!K!K 8"K0S% 8080"BKT"K 0 P0!KK"KP"K!K80!K P0 8!Kَ0S 8HV 08A0 K0Ԓh7=H-M  0S@@@!@10S0 ]/ 1000S !00H00 00S 000S^/00003/0 0 0S 0S 00S lDh D0 0  0 <0KԒhslȓuwH-M  00 0S 0  0  0  0 00KH-M KH-M 0SPPP P0.00S <,.,0%00003/K,hX<H-M 0S 0 0060S p00003/0S 00a000Z0K,h@(H-M 0S,,,!,100S !10000S000@ ,000S$ 00S 00_0S 0  00003/0S 00 0 000K,h(<PH-M 000S 0S `0S 000 000KH-M 0S444 40W000003/0K訔h/(H-M 0S444 40<000003/0K訔h;(H-@M8 80S@@/<2!80 000 0080,0 00So ,0Sn 000,0(0 (0Sf 00"(0!00cS0c ?"K00" @P 00"d 0 0*0!K000([0S V! "KKP000K80(0!00 (q0[0#0S 8000"0 0 0000    ` 00 vt00 0 S 0k80000 00Sz0K,h- M  0 00S00Ћ/H-M 00 0S 0r0 0 0  30S 0400S000  \0 0 0S0K,hH-M 00 0Slll l0C0 0 0 00 0R 0000  20 0 0S0K,hH-M  0Sddd d0000`0SH8D 80000`0 3/0K,htH-M 000d0S800d0000d03/0KhH-M 00S``/\0000\0S@4< 00000\03/0K$hH8H- M   0S 00000 0S0$O0Sn0   @l x000 3/0 0 0S0 0K,h4tH-M  0S``` `0i0000 0S00 03/0K,h H-M  0SXXX X0C0000 0$0S00$03/0K,h/H-M 0S$0@ 00K訕H-M 0 0  00 (0S "0S 0 0 0 0S0K- M 000Ћ/H-M  0SV"  0000s9.000S 00000 0S 000L0S\/\0000S\4X 4000L03/0K訔hԕT H-M 0S 000S:.0}0000 0SlXh X0q00P0SL0H 00g00P03/0K訔hؠT8H-M 0S!1I00 0 0  00 0S 0S0# 00 0 0R0 00 0S 000s0S000 0S0K,hH-M 0 0 0S/0 00 0 0 00 0S 0400S 0400S  N 0S0K,hH-M 0SLL/H000S000X03/0K,hH-M 0 0  00 0400S  A .0 0 0S0K0H- 0M( (e00 0S0V0!"K00 0<00 (0!BKPK 00A 0 0 ( 00 ( w00 0""K000 0S0"KPK 00" ( o00 0S ( 00 < 0 K00H- 0M( (p0S0g(0S0`00 0"K(0 00 (0!BKPK 00A 0 0 ( '00 (  00 0""K000 0S(00V#  0 0KPK 0(00B 0 0 ( 00 0S ( &0(0  0 K0H-M 00S0S000 0 0S000 0 0KH-M 00S 0|00S0S000 C0 >0S000 C0 0Kdh{pH- M   0S 0DH00 0S. 0 0  0  00 P 0 0    0S 0 0 0 4 0 < 0 8 0Կ0K,hXH-M ĿKH- M   =0 0  0S 00 00 0S 00  } 0 0KH-(M   0S<<0S 06!K0S 0 0 00R 00!K0  P0 K KR0 KP 0 KKT l`H-M   0 0SC 10SD 00SE 0 PF 0!PG 0 ? 0 : 0  0  0  !!!0Kĥإ H-0M   0 00 0S 00 ! 00S 0L0K0H- XMP T P0SDD @1tT0S0$ 1lTP0S 0aP0T0 P@T@TP,K FP0P0!TAP@TPLK 3`0PX0@P0T0!,KLK  00 K00إ<HhH-0M( (0STT P0(0(00"$K 0$0K(0K0إ|H-M 0SXX T0P0H00!   0;0K<V, إ`h0H- M 0Shh d00P0@00 00!  00 K0ĥإDH-@M0 4 00S 40S0m00 400l0,0 ,0S_ 00 400`0(0 (0SO 00 4000$0 $0S? 00 40 00 0 0S/ 40!0R 0!K40!0P 0!K!K !K ,($  000 0S ,($ 0 $(,0KH-M 0STTB/P0,0000000 0Kĥإ0H-M 0S ѭKH-PMH H0!HP0gH0H0 H0 0  0"KH0H0 H0 0! 0!KK 0QP K 0QP "KKPH0!KP08H0!KP 0 0!K!KR 0!KH0!KP 0 0 K KR0H00K!KP 0 0DK  !KH00D K0KH- M "K00 0S 0 00"K 0 K KK0H- PMH %KH0 00 0 H0%K 0 0 BP09H0%K 0 0!KH0%K 0 0!K 0 0!KP 0 0 0!KK!KP 0 0DK  !KH0 0D K0 K0H- M "K"K00 0S 0 00 ^ 0 K KKH-(M $ 0S0T$0SLLi/H1 00 $00R (V- $!1$0 D 0!KK 0QP01$0! !K 0!KK 0QP0 $0K!KP 0 0 !K00 0S0 40S0, 00Klإ|H-8M0 00S000000 0 0 0,K  0n,0K0x0KH-M  0S<< !K B>!KPL 004 0$J!K  I> !K 00$ B> !K 00$0(4 $ 0$0K谨 ,H- M  W00 0S+ 0 0 0 00S 00S 00$0 00 T 00 q0j0KH-M 0K00 0S 0S00KH-M 0K00 0S 0S00KH- tH- tH- 褓ԓH- 褓ԓH-|xt}p{lyhwdu`s\qXoTmPkLiHgܖ$Hlؗ V0* 8PhȘH-}{yw|uxstqpolmhkdi`g\eXcTaP_L]H[ܖ$Hlؗ 8PhȘH-"M( (20!S R 0C(2!@P`0:K 0 (@ 00S0-?K 㒥0S$ 2/ S04 ?"K|0pK !K(2(2@ 0 0$ $ 0c 00  0p00KdH-H-0H- (M( , (00!S R 0K,0S S s B( 0 0 (n0 0 (0 0 0S/ 0 00 00S 000 0 B 0 0!K!K(0!!K(0(0 K 00 0S 0 0 K0H-,M( , (0 00 {0/ S04 ?!(000! 00 0  c00KܩH-,M( (00 0S= 0! w0 00 000! 0P0S# 00@0 0C00  X0S0  0  0$0K ܢ00K$0K@0 0K(H-M 0KH-M 0KH-M 0KH-M 0KH-Dg@e<c,4 (   dtH-8844(,pnld tH-xM  \K 0  0 0S0\0X0 X0#L3RX000 3 ?%KX00 0$KX0 0 0$KX05 0#KX00 0#KX0L0(0 0$0 0 0 X0\00S00$0 $0S& X0d00SX0d00SX0d0 0SX0`0@0S X0`00SX0`0<S 00 0 0S 0$0 X0S$0S 0S 0m0S$0S0e0S 0S0](0S?#KP@90@@0< 80D D <0c 00P#K P0!K!KRp060H0T P0L L T0C 00|K  !K|0K4000@H0T P0L L T0c 0V2<0  00X嚢0KSH-M  0KH-M 0KH-M 0KH-'% #DTH-HF DDTH-M 00 0 0R 0*00 0 0 S0" 0 0 X400 p R400 0 0 0 0c0C D400 0 0R00K44PH-0M(   (K(Q P 0R! 1 0 1 0 K 0 ( 00S 00 $K 0 ( K|0S $00 0S 0S 0S x0SСΡ0K 0 0!Kġ¡(0(0 K 0KH-iДH-ДH-!M K 0  00S0?K0T 0S 22 K( 00KH-2H-YH-M 000 0Sll+ h00SXL, H00!S R @,  10(0 ^( 1!002!P`N( 1!0 K0 0SA ?K40P 㠛0S ?K400 㗛0S ?K40 ㎛0S'0pK048#8 0"K(2 0!K0202@ 0 0$ $ 0c 00  0l0(00(0 ( 80!0 0QP0KЫܫH-0 00T(H- 00TH-cMM@ @6!P`0c>K0C0C@ 00S0c>K0C0C80 80\5,80\5#408 80\5#848#8 80\5#< 1RF8000,8000#408 8000#848#8 8000#<04 0#K80$0,80$0#408 80$0#848#8 80$0#<0 0"K@6@6@00, (04 4 ,0c 00  00(80\%0R"80004 0"K80$0 0!K@6@6@ 0 0$ $ 0c 00  000KTH-bMM0 06!P`0b>K0C0C0 0Y0S0b>K0C0C(0 (0\5,(0\5#408 (0\5#848#8 (0\5#<0"S !S !SF(000,(000#408 (000#848#8 (000#<04 0"K(0$0,(0$0#408 (0$0#848#8 (0$0#<0 0!K0606@ 0 0$ $ 0c 00  0 0.(0\5 S S SV6% "(0004 0"K(0$0 0!K0606@ 0 0$ $ 0c 00  000KV#P H- ,*@XH- PNX@K-M0 02 0R0K 0 0 00S0," 4R (24 0"K3K "K0202@(0$  0, , $0c 00  00,2,,2#408 ,2#848#8 ,2#< <3R(2,(2#408 (2#848#8 (2#<04 0"K2pK ̠  2K "D@#T 0 0HB PR )~K@ mK`F@Pt2pK "h`#x 0 0Ġx | =K @P(2`K "# 0  0ppr t '.KB1@K PlR `hb lr'4h ̠` `"0`2 l2S0~!K Ћ/H- M 0S 0嘾0!P0%0K0 0l_0S00@0 0 0 0   0<0 40R000K0.0[KDPWEVH-M 0!/ 0 0  4M00 0S!  0 0 0  0S 0,ブ 0@00  0W000E000V0000}0000    0 X Y Z [ 0!0(")"*", + 0P0 0,"-".", / 0L0 00"V801"2", 3 0H0 04"5"6", 7 0P0 L  08"9":", ; 0P0 L  H  0<"=">", ? 0  H  I 0  J K 0 L M 0 N O 0 P Q R S 0 T U V W  0W000E000V0000}0000 0 0 C0 0"$("( 00KXPH-M 000 00PB00 0S0 00 0 0,㬔0K萕H-M 00ᶕKH-HM8 80000 88004 K  0]0S00 40,40ᓕ00@0,0 0(0 (0 C,0   "000<0S (0C, 0 00S (0 C,0      "000<0 0!K(0 C,0      "000<0(0 C,0   Ġ Ƞ"0 00<000C 0!K!K !K 8 g0$0 $0S; $0@0 0 (0C, 0 0 0 $0( 0 $00 $08 $00+0 0 0S 8$ 0S000K 0[0#0S(00(0 (0S+00KH- M 00 K  V9% 0\0S# 00 0@0 0 00S 0   0<0 @0R000 0,h0|KWEVH- M 00 0S000#03夻 00S # 3囻 000 0@00 00S 00 ֓0 0 q  '00 0Se 0@00 0C0 00 0C0!0  !  !  ! "00   0C0"0  ! ! ! "00   00 00 0 0S08#808#(0"$("(  0 0"$("( 0'0 ,Y[0S 00ᠽ00K舯PVtWH-(M    t0 0 0S$ 0S "00 0 @ 0S 0 0  0  0  0 @ 0 c0KH-,M 0@ 04 08 0 0"  00 0S0 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0KH-M 0S@@n/<0S0S 0@0BK謯P\H-M  0@00 0 8 0S0 00%0S 0 0 0KH-M   0S 00@0S 000Sv/00@00 0S S S0  00S 0 0  0 0S 0  V:& 0  0K謯PDدH-M  0S 0Ĺ0@0Sxht h0廹0@00 0S S S00000 00K謯P,- M  0S 03b0S 00Ћ/- M 0Ћ/- M  0 0Ћ/H-0M( (0 0 0$K ( 0Z$0K_0KH-M  0000  N0S 0@ )0KH-M 000s 00 0 00 00 0S0 0 0 00 0 0S@ 0K H- M 00 0S 000S&.00000 0 0  0 0 0S   0S s00K舯P_H-M $Z0S000K@H-M0K@Z00 0S $$$ $0嬸!KK@LPvH-M0K@Z00 0S $$$ $0呸!KK@LPvܰH-萕H-D萕H-M 800  0 ሐ0S00K蘱-M 00S 00S 00 000 0 S  S S  S  S000S0000S 00Ћ/H-(M 0Sxx t2( 0!P00K0  0X0S000 0!1408#(1Rg00 0 0  1 00S000  1 00S  1 00SF 00 0 0SV;30S0q0S90 0  1 00S/ 00 0 0S00S 00S00S00S 00 0S 000 3/0S0f00V0KU H-M 0S 0zx0 0 0S ׿00 0S .00 0  0K6H-M 00L00 0S00 00 0K蠕H-M 0S00V/,0/000 K-M   000 0S0S  0 00Ћ/-M  000 0S000Ћ/- M  0S00Ћ/- M 00 00#3040Ћ/- M 00Ћ/- M 00?00CЋ/0H- (M( , 0 ,0SLLL!L1島00S<,8!,1嫶00 ?"K00 ?!K00 ?!K"KP@ 0'!KRP 0 ,00 ?$ $B 00K,00 ? B 0 0K 0 K0$8H-(M0 4 #K00S!1O0S!1G40S00H040 4004   ?Ki 0"K400 ?K` 0400 ?W"K400 ?KP!K"KP/ 0"K4000C ?"K4000C ?!K"KO_ "0#P 0 0 "0# R0 0 $ [0  [(0<,!d`(0Ct030000 V<) 0 Kx8H-M   0Sddd d0ǵ0STDs/D0念0 00  0KhDH-M   0Sddd d0垵0STDP D0喵0 00  0K\DH-M  !K0S||| |0t 0Sl\.\0l 0   0<0!K 0KLDH-M  !K0S 0E 0S|lx l0= !K 0 Ġ  Ƞ 0<00C 0 0K@DH- M $ 0SDD~/@1 00S, (!1 0@0S !0 0@0 0 0$0S0/ 000 0$0 0$  0!K 0$0 0$ 6 0!K!K 0$0!KQP 0 !K 0$0!KQP 00KX h|H-M  00 0Stt!.p0宴s0S 0S0 00 0S0KH-8M0 4 3,K00 40S"2~00S/2v000S"2m0000St"t2c0000!/ 0 0 P,L",2Q0000!0ᱼ00 0S0u0080Si 00 00  '0!K 0 00800Ꮜ0S00 000  '0!K 00S0SE 00 0  00S: 000 000400 000 00040 0 0S$0?S! 0S 0S40  40  00000 V=< ? 040 00 哌0Kط$'Xh)*+H-M  0S )9屳0@0S )8娳0S(8堳0@00 0$0S0&0$0!00 0 ?)K0 ?)K0 ?(K0$0 (KK(K P0'K0$0%00 0 ?'K0 ?&K0 ?&K0$0!%KK&K P0%K)KR&KR@ )KPP&KP`0)KKPp0K 0 0@,@ 00KRP0'KP`0'Kp0 0$KL0;H0 0L0 K 0 0$K'KKP%KKP@00l h 0l b0p0  0t t 0C 0 0 P0$K$KP0ix0l h |0|l b0P0  0T T 0C 0 0 P0$K 0#K80D @0< < D0c 00xlh||l@PP TTa TSR 0#KPp0 #K P0)KP@0< 80  <0c 00K P0)Kዻ 0#K#&KPpp0< 80t t <0C 00K P0&Kl 0#KD @# 32#KPP0#K?P`0000"#KK 0"KK#KE 0"K#K!K"KPp0"KP0!KP@0!K?PP0~K 0 0$ $b 00V>?K 0B 00K%KQPK 0 0'K0$  0  $0c 00 K 0B 00K(KQP 0.p0$  0t t $0c 00K 0B 00K%KQP 0 , 0 $ 0  0 0KX|$>H-M  0S<<$00$0" K4 0$0S% 0$0 00 0$0$0!QP 0 0 ' 0$0$0"QP 0 0 0KDO(XH-M   0SG.1Q0Sx!t1I00ShTd!P1@0 0  0 0 c0" " ", 0!0 " "",  00  000! 0 0 0KDqr0H- HM@ $K@0Sddd"d2ڬ@0SL<H"<2Ь0S40"2Ȭ@0!"K@00, K $KM0S0o,00 0o?0@  0U0100U00100 0o?0$K0SH 0000@70(0 (0S1 @0(00!(B(@TP 00 0S' 80K(0s?08 KK  (00!(@w0S @0 0 $K᙮00 ,0 0 K0سH-"M K 2S 0-2 0KK M0S 2/K,Ƀ2݄?Ko?0@ ^L00K2K$ 0 K K0KUH-(M 0S 0 0 0 0K  00 0S VA 0! 0 0! 0KжH-M0Ku00 0s0 0KH-(M 0S"2孫 00S"2夫 00 K  0L0S00 0 00S  0,ك 0 K 5 0!  1<0S 0""", ! 0o?0@ 㫃 0U0100U00100 $ 00 0S 0o?0  B"0 0C0S* 040S 90S# 000 0S 0 0   0f00 00S0 00Э00σ0KĶH-(M    0 0 0S6 0S( (L00 0 @ 0S# 0 $ 0| 0  0  0 0 0  0  0  0   0 @ 0 {0KH-,M 0@ 04 08 0 0"  00 0S0X 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0$0S% 8Ȳ0 0$ 0$0S00$ 0$0@0$ 0$0 00$0$0##0KH-M 0S\\\ \0-0S 0@00 0$00@0KXeH-M  0@00 0 8 00S 0S 00 0S 00W0S 0  0400S 0 0 0  0 VB  0  00S 0 0 00 0S 00S 00'S 00S 0 000S 0q 00 0S 0 000S 0 000S 0A 00S0| 00P0S00S 00 000 00S 0000 0 q00ʁ0S00S 0 0 000 00S 0000 0 P00D婁0S 000塁0S0 00 00S 0000 0 -00冁0S 00~0S0P 00r0S0@ 000S 0} 0| 0K - M 0 0  0  0  0  0 Ћ/H- M  0S#3Ȩ0@0S"2忨00S"2嶨0@00 000 00C S񟗟XPP8tPؖPPP040S@X"{00  080X0~0  0S0v|0 0  0R <0S   e0 0 0S0U 0S k0  080 0F 0S \0  08007 0S M0  0800(0  0800 0S 40  0800 0S %0  08000KX|h H-M  0Sb. 10@0S 00@00 00C S+XVC4p|d040S000000 00 0 00 0000000KXt|!- M  0S 0#P00S 0S 040S0000Ћ/FH-M   0 0 d 0S0 00 x00 V0K0H- 0M0 4 8 <0 4004   ?"K80S<0j<0S80e80 "K| 00$0 <0 "Kr 00 0 $  0R%80400 ?c 0400 ?Z@P<0400 ?Q 0400 ?HT"00!80 00cS0c ?!K00!<0 00cS0c ?!KK!KP<808<0 K00H- M  00 0 00   ?!K4K!K  00S0vDK!K  00S0j0S- 0!KP0_0 0!K P0dK  !K0S0K0! BTK 0S*09 0"KP!K 0!K 0!K P0dK  !Kp0S0 0"K   0b0S0 0"4PKD@KdKK  00 K00H- M  0 00 0 00   ?!K0!S R+0!K00 ?!K4K 0 !KL0S0\DK!K  0@0S0P0S dK 0  !K0S0@0! BTK 0S0. 0!K P0dK  !K0S0 0"K   0VD 0S0 0"4PKD@KdKK  0 0 K00H- Mp t 'Kp0,0 p00(0 t00t   ?"K,0S!1娥<K"K 'K0S0XLK"K  00S0L0S ,0!,lK (}0S,0;,0 0 0"K! 0!K,0!KP 0 0!K,0"KP0lK!K (!KR0S0(0" $0"?KH00H!00 0SA 00q 08 $0 00 A0/K s0S ㋴000 0 H H0S000K {0[0#0S !$00$0 $0S 0S H0HY0K,̸ܼDA H-M  0@00 0400S HH.D1Z0"00"0#4080"0#848#80"0#<0 0 0!00!0#4080!0#848#80!0#<0 0 00,00#408 00#848#8 00#<0 0 K谹̸ȼH-M  0@00 0400S   ! 100,00#408 00#848#8 00#<0 0 VJ 0!00!0#4080!0#848#80!0#<0 0 0 r 00 qK̸ܹH-M( (20 0 0S$$$%$5壙(b">K,q5 2 0408#80C8#848#( 0408#80C8#8#48#808#8 4 K 0008#80C8#848#( 0008#80C8#8#48#808#8 84 K 080S 080(00 0".K p 0K(20H08#848#((20H08#8#48#808#(t3 K (20L08#848#((20L08#8#48#808#( 3 K (20P08#848#((20P08#8#48#808#(2 K (20!8#848#(20!8#8#48#808#(x2 K 00 00(ጵ00 0S  0001 ">KN?0j000 0S(20"0(20"0#408(20"0#848#8(20"0#<0p0 0l0 4h0 00 00(L00 0S 0"">KH00000 0S0(0 ">K0L">K0#408@">K0#848#8@">K0#<0(0 ">K(,80S (20$0S 00K,̸ A H-(M    0 0 0S0 0S 0 @ 0(㚠 0@ 0@00 0S 0S00 00 T0 o 0"04 0 0  0K(H-,M 0@00 0@ 04 08 0 0"  ឰ00 0S- 00 00 孱0S0 @ 0VK !C 0@ 0@00 0S 0 0 0 00:o0 0 0幰0KH-M z0S 0@0S,,, ,0姗0@0hp困K̸NH-M  0@00 0 8 040S0 0040S00S 008o0S0 0 0K$H-M   0000 0S S S. D040S 0S @!30:0S 0000 40/040S 0S @ 0#0S 0000 00040S 0S @P 0 0S 0000 8000K(X-M  0000 0S S S 04 000R0000 000R0008 000R000Ћ/- M  00CS00Ћ/H-M  0@00 040S 00 n0 @ 0嗛K贺-M 0@00 00Ћ/H-0M( (0$K 0 0㌻0S0$0Kk0KH-0M( (0(00 0 0$K   0l0S0$0Kl0KH-M  0S 0[040S000000  J0S 0@ %0K̸| H-M 000s 0L0004000S 00 00徲0S0 0 02000 0Sڸ 00400S 0 0 00 0 S 00嗲0S0 0 0 000 0S@ ƚ0VLKT̸+dX- M 0Ћ/- M  0 0Ћ/H-0M 0S!1嵕 厱00 0S 0! 00 00 0 0  Ϯ00 0S 000 0  :0S000K m0[S 00Kt̸WPH-M $=70S000K輸H-M0K@s700 0S $$$ $0S!KK輸̸s0H-M0K@r700 0S $$$ $08!KK輸̸sH-Ĥ谕H-谕-M   00 @0 0   0000# 80!$4@" 00 0 0R:0K/H-MK!KK!K 0 0!K 0K- M 0!0Ћ/- M \0Ћ/H- M @00cKH-M a'00 0 0 0\"]"^", _ 0KH-M 00 0 l0\ ] ^ _0<0@0 l0K0H- M  00 0S 0i0 l0\ ] ^ _0<0Pv 0@z0 k0 K0N H-M 0S! 0\ ] ^ _0<0SXXW/T0)0\ ] ^ _0<0llK 0H- M  0S!10\ ] ^ _0<0S 000 0R00 0S00 kVM  0P0\ ] ^ _0<0@0 wk0 K08e fH-M 00 0Sc/0屓00,00#408 00#848#8 00#< 0 0048#(00#48#808#(0 0048#(00#48#808#(0 KDH-M    L00KH-M   0S 0\0Si/0T=00 0S00   0<0 0 k0KT8H-MK0K0 Rk0KH-M 0So/00!1408#(x0R 000  T0 00S0000 0S0K`UH-(M 00 00 0S"2ڒ 0"P0q 0300  0  0Ȕ0S 0 0 0 幔0S# 0 100 0  Ġ  Ƞ  ̠   Ġ  Ƞ 0<00 QP00 OkE0S0#0K0  0a30S00 0 0S0S  00T P00 0S0 0 0%k 0KEFI PARTTl0H- (M( (p0$0 $0SQ 4㭚0 0 $0  $00SB (0! i 0 0 0!K(0 0@P@P(0! S 0 T0!K K!KP 0 0 (!K 0 ,, ! " # 0$0 0$0<$0$j0 K0pH-$M( (000 0 0S0e(0VN 00 000 (0 0   @  0<0P0`d`h`l`d`h0<0  0ᛶ0 ! " #0<0 0 "!""", #  0$$ 0 )i 0KpH-M Q001j#KH-0M $ ( 000 $0T U V W0<00 0 ! " #0<0 (0 (00 00!< 000 00!c 00 0Pi0 0@ 00!0 ၙ0 0 0S01 0$0H I J K L M N O0<0 0 0S si000 imi0  0 0KH- M  0K j0 0 0S00 O00 0X Y Z [0<0 0R00  0 vi0KH-K0C0C 0g0S B>K0C0CC0S 0400`"j0S0(0 (0"B>K0C0C<0 0 o0S0  0!K0  0 K!K K 0 ~00 0Sz 0@00 0SY/1ke 00$ 00 0 00}0S0000 0S0KH-M 0S 0`00S,0v`000s 05z0St`p `0f`00 00 000S@4 =e00KH-(M 00 0S   ! 1;`00S 02`0000 00D0  @  ? KK 0 0  Iy00 0S  庀0Sy00Kd- M 0Ћ/- M  0 0Ћ/Vg<H-M $0S000KH-M0K@00 0S $$ - 0_!KKH-M0K@00 0S $$ - 0_!KKH-1oH-XoH-(M  0 0P+ 0{_00!0g00 0S0 7  00 0 00! 00c  70 0  0a00 80K<H- M !K0!0 g00 0S\\D X02_ !K2a0S70 0  0KH<H- M !K 0 00!K0K0H- 8M0 #K00! P@[ 1^00! %h 0"K"Kh 0"K 0!K (0 0, , 0C 00K 0K0a0S08K 0 0!KK"KPP(0 0, , 0C 00 P0!K!KP (0 0, , 0C 00K 0K0$`00 K0T<\-0 @ BRн d @ P @ < @ ( @0 0@0K/xH-P0S'S%0@-TT t00010` 0R 060S 0001 000x`H-(M  6000 0S0.0"0!QP 00!!@t b00!0 QP 00 !@ b00KtH-M  z60Vh<|00 0S00  0KH-M  `60b00 0S00! 0KH-M 800 E60 50S00KH-M   060 0 0R 0 0 00 0 00  000   0RK-M 00 0 000   00 0Ћ/- M 0 S S S S S x S s h S \0 X0 T0P0L0H0D0@0Ћ/GESLTOOBDHSFBDABKSDRTRAP $,4H-M  e00 0S00  0  0KH-M 0 0  000 50 0 0SK-M  00 0 0R0000 0S0Ћ/-M 00 00,00#408 00#848#8 00#<00 000,000#408 000#848#8 000#<00 0 S<0 0 0 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0R0Ћ/0H- M 00,00#408 00#848#8 00#<@z00cL00,00#408 00#848#8 00#<Pa00c#408@00,00#408 00#848#8 00#<PE00c#848#8@00,00#408 00#848#8 00#<P(00c#<0 0 K0H- M  !K 0  !K]0S0Z0S 00, 00#408 00Vi) #848#8 00#<00S0; 0S5 00, 00#408 00#848#8 00#<0O!K ap p0`0S @S0 , 0  !K]0S0 0 0K@$H-M  `00 0 0 ) 0 ?x0S 00,00#408 00#848#8 00#< H0RO 0 00 0 0SD0KKSDRH-M 0Sttt t0@[0!0c0 0 0S0  00 30s00KtOH- M 0SXXX&X6[ 0D0 @  ?!K 0m00 0S0}00!0ec 0 00S30l000 00!P%5Z00!0 (30p% 0! 0 00!000!0#40800!0#848#800!0#< 0 0  0  0  0 0 $ 0 ( 0<0, 0<0#408 0<0#848#8 0<0#< 0@ 0D0, 0D0#408 0D0#848#8 0D0#< 0D 0@0, 0@0#408 0@0#848#8 0@0#< 0H 0 L 0<0, 0<0#408 0<0#848#8 0<0#< 0P 0<0, 0<0#408 0<0#848#8 0<0#< 0` 0<0, 0<0#408 0<0#848#8 0<0#< 0d 0 h !KDc 000 0 0 0C0 0 0,0#408 0#848#8 0#< 0 0, 0#408 0#848#8 0#< 0 0<00CVj* , 0<00C#408 0<00C#848#8 0<00C#< 0 0,0#408 0#848#8 0#< 0 0 0 00 0 00 00 00t 00\ 00D 00Kta oRDSKH-M 0S 0nY00Sk/0eY00St t0\Y000 00dk00 0S000 0 ,00KH-M 0SPPo/L0.Y00S8,4 (0%Y001kK-M   00 0!00 0R0 000  0R:0!00  0Ћ/0H- %MH H2Sw/6XH20S&6XH20!/ 0 0 &6XH20Sd|&`6XH20@0 H20@.0s@@&@6]0H2 @0@0@0@0#408@0@0#848#8@0@0#<0<0H2 @0H0@0H0#408@0H0#848#8@0H0#<0@0H2 @0D0@0D0#408@0D0#848#8@0D0#<0D0@0H0,@0H0#408 @0H0#848#8 @0H0#<0@0D0,@0D0#408 @0D0#848#8 @0D0#<0 0 B 0 0#K#KHzH20!0`0<0 <0S00,0 , 3! PK 0 ,00,0 ,0S0,0 @00,@00#408 @00#848#8 @00#<080 ,0 -K8 0SH2<80 00S<00<00,<00#40Vk?8 <00#848#8 <00#<0 0404B 00"K"K<00,<00#408 <00#848#8 <00#<0 0 0404B 00 0!K"K !K H p0(0 (0S<O00V(0@0<,0/(0, 0 (0 4 (000_ (08 (00ቄ00 0S08H( x0S00 0KG 0[0#0S (p<00",00,0 <00,<00#408 <00#848#8 <00#<080 ,0S80s6</0 K0,H-(M   0 0S$$$#$3W00S #3 W0 0 K 0!000s K a"2[0@S000 0 K0S000,00#408 00#848#8 00#< 0R 00,00#408 00#848#8 00#<0Q00 K @!1[0Y 0!00 00,00#408 00#848#8 00#< (1R0H0,0H0#408 0H0#848#8 0H0#<0  P0S000,00#408 00#848#8 00#<0 0 KK 0QPK0K67`DHSFGESL-M   00 000 0!00 0R 0!000s0Ћ/H-M  r00 r00 0S o0S 0K0H- `M` `0S  -;U`00S +;U`00S| hx+d;U`00!0I^0X0 X0Vl% S0`00XH0$0 $0s0$0 <0 `0 0 000@-)0S0,! 200!)0S0! &00)0S0 00 )0S0 00(0S0 0 0Ko,<LNXEXTSWPFAT FATHFSJFSNTFS$RFS0SUFS8HUFS@XFSH-M   0Sxxx!x1cP0@0SdT`!T1ZP0@00 00CSELLL 0S 00$0 00$0 000S 00$0 00$0 0 0S 00#0 00#0 00S 00#0 00#0 00K<H-M  0S 0O0@0S 0O0@00 00CSDD$Vo& 4004 0040030030K<- M  0S 03r0S 00Ћ/H-M  0S\\>.X0O0@0SD8@ 40O0@00 0$0 K<H-M 0S\\\ \0}O0@0SH8/80tO0@00 0$00K<H-M 00D0  @  ? K K}0K0H- hM` `000 0D0 @  ?!K,K!K  0Z}0S0/<K!K  0N}0S0#0. B0 0\K . 0t0S00",PK<@K\K\K  0[x0 K0H-M  0S 0N00Stdp d0N000  g0S 0@( S0KDH-M 0S 0N00S 0N000s 00 0 00 Nk00 0S0 0 0 00 0 0S@( |S0K'(xH- M 00 0S 0}N00S 0tN00`{00 0 . 0  g0 0 0S   o0S g:y05y0KCpD- M 0Ћ/- M  0 0Ћ/H-M $0S000KlH-M0K@,00 0S $$$ $0 N!KKlhLH-M0K@+00 0S $$$ $0M!KKlh0H-}]H-Vp]H-M 800 k&0 %0S00K8-M 0 0 00K 0 0[0"0K 00 0 0?0 S0 [ ! [ !Ћ/-M 0?0 0 00K 0 0[0"0K 00C 0 0 R*0[S00Ћ/H- M 0S 1xM0K0 0V0S0/0 0 00 0!1408#848#( 01408#8#48#808#(d0R 00 0S00 @, 'R0&0KHT8\0H- 0M( (0H00 00   ?!K!K 6M(_0$0 $0S {U $0 $00S $000 00@_(0"!K1V 0UT  5L(0"!Kz 0 00 0 ,2% 00%00100A001 0 ! !008#848#(008#8#48#808#( 0"$("( ! 0  !  ! 0 !  ! 0 ! !008#848#(008#8#48#808#( 0"$("( !008#848#(008#8#48#808#( 0"$("( !(0"!KU 08#848#H(0"!KU 08#8#48#808#( 0"$("( ! 0`000 0000!00000000 0  0  0 0 ! ! ! !0 00 0#4080 0#848#80 0#< 0""", ! ! 01408#848# 014Vq 08#8#48#808#8 01408#848# 01408#8#48#808#8 01408#848# 0A1408#8#48#808#8 0A1408#848#H 0Q1408#8#48#808#80 0# $0$9^0 K0T,H-M 000 00H]00 0S000 0 /#0KH-M 00$^K0H- (M  000 0!1408#848#(01408#8#48#808#8 0D0R!0!1408#848#(01408#8#48#808#8 0@0R0 H0< 0!1408#848#(01408#8#48#808#8S  01408#848#01408#8#48#808#8S0001408#848#01408#8#48#808#8S00S00!1408#848#(01408#8#48#808#8 0P0R0!1408#848#(01408#8#48#808#8 0L0R 0H0L0P0!1408#848#(01408#8#48#808#80!1408#848#(0A1408#8#48#808#8 0A1408#848#H0Q1408#8#48#808#8 0`! 0O0@S0h0!1408#848#(01408#8#48#808#8 0P 0!1408#848#(01408#8#48#808#8 0L 0!1408#84Vr 8#(01408#8#48#808#8 0H 0P0 L  H  ?P 00`( N0 S 00 K00H- XMP P0S )9IP00S )9IP00S )9IP00@0 PkkP00H K  0f0SF @000 H0,%!H09"P'0S7 P00P0P  L  ?"KP00H0 ?$ $B 00@ 0<0 < 07    !000<0< 07  A@ Ġ A@ Ƞ !0 00<0#408< 07  A@ Ġ A@ Ƞ !0 00<0#848#8< 07  A@ Ġ A@ Ƞ !0 00<0#<0S <0 "0 00S <0 "0 00Sw < 07 !000<0< 07  Ġ Ƞ!0 00<0#408< 07  Ġ Ƞ!0 00<0#848#8< 07  Ġ Ƞ!0 00<0#<0 0$ $B 00"K"K< 07    !000<0< 07   Ġ  Ƞ !0 00<0#408< 07   Vs Ġ  Ƞ !0 00<0#848#8< 07   Ġ  Ƞ !0 00<0#<0"K 0 0#K"K #K P `080 80S^ 80@0D0 <0 "0 0 D0 D00S  D0 D00S  D0 D00S  D0 D00S  D0 <0 800 800O 808 800st00 0S# P8 h0S00 0K3r 0[0#0S<00<0 <0S0 0 K0T= >?H-M  0 0 00S" 0!1408#848#( 01408#8#48#808#(80R000 00,0K0H- 0M0 00S(8F000Sxht(h8F000( K  00S0(000S(000000 00$0 $0o?@ $00 00 G000Lc00 0Sf0Sc0$ "0 0  $07 !00 0 00 0#4080 0#848#80 0#<$07  !  !  ! !00   0S 0@0 0 0  $"00 @0000P00  L  ?PO 00\0000P00  L  ?@O 00#408P0000P00  L  ?-O 00#848#8P0000P00  L  ?O 00#<$07 Vt  ! ! ! !00   0"0!00c00"0!0 0c0#4080"0!0 0c0#848#80"0!0 0c0#<$07  !  !  ! !00   000 0S000H0S000H0 `" 0 0$0R 0$ 00R t  0$ 00R 0 0  00 0 0 p0R 00!t0000-S 00!t00000S 0 0$ 0 p0R0 00!t0000S$ 00 0 0 0$0R 0$ 00R t m 0 0$0R 0 0 0p $ 0p  0 p0R  0 0$0R 0 0 0 00!t0000-S  00!t00000S 00S0 00 t    0 0 00!t00 |0S 00t00000-S000 0 |0S 00!t00000-S 0S 00!t00000S  00!t00000x:0S0T0 0P0 0L0 0H0 0D0 00`0 `00`0 `00S `00=S`  000c\0 |0X0 0@0 IX0 00\ 0S8X000 \0RX0T0 @0D0 0L0 2T0SX0T0 @0D0 0ST0 X00R T0 X00RT0 X0 0R 0<0 <0X  <0P  <0P0 X00X0 @00@0 X00SP0S_ L0S\d0S> T0l0 P0h0 l0KP0 <;t0 00t000 ;*P000 P00P0 P0S:080 80H0S 80 800R*800  80  8Vz 8Q 0@ 00l0 0 00 0 0  ?0P0040 P40P0 P0ST0S D0@0 00 0 `00SB T00S `0 0 qd0S& 000C!t00000-S L9t0 T00$9t0 000Ct0000T 0@ 00 0 0 T0 0 ?0T00S3 0 p0R 00 t    0 !d0S 88t0 T00N 0@ 000 0 T0 0 x00:S:0?0V 0@ 000 0 0S 0@  T00S T00T  0;T0 080S 00!t00000-S 000x0S4d0S$ 00!t00000-S 6t0 006t0 00t0000 < 04& 00 0 0  ?0 00 - K 0 -0[xc0,0 000S 00 0 ,0S -0[:S -0[;Sd0S 5t0 -0[d- [ 0 ?0,00WS],000;SX0 0 00 00 00 000S 0 0 00 0 ) 0 p0Rd0S 4t0 -0[o- [ 0 x00:S:0-0K?0-0K-0[ 00 t    0 0 0(0 0(  (00(0 (00S (00=S|0$0 00 F$0 0 ( 000c G0S1(  000c@$000T$0 0 00 00 ( 0S$0 0 00 0S 0 $00R  0 $00R 0 $0 0R 00 $00$0 000 $00S0S 0Sd0S 2t0 0 0V{ \ 0@ 00n0 0 00 0 ?0 0S 00 (00S 00S (0 0 Nd0S 1t0 00 0@ 00?0 0 ?0 00S/ 0 p0R 00 t    0 d0S 1t0 00 0@ 000 0 x00:S:0?0 0 0@ 000 0 0S 0  00S 00  0r@p$Hx 0 0` 0  W0[,000:SU,000:S 000S 0 0 00 0  0 0  : 000S 0 0 00 0 ( 0 p0Rd0S 1t0 -0[ - [ 0 x00:S:0-0K?0-0K 00 t    0 0  -0[KH-(M   0 0 0 0 0 0000h00 0 0 000 <0 00 ,0 ,0 0 0 0K(d,$0H- M   000000  00KH- M   0 000000  00KH- M   0 0000000 0  00KH- M   0 000000  0w0KH- M   0 0000000 0  0V0KH-M y00 (0 $0R0  0K4H-M 00 (0 $0R0  0K4H-(0 0$0 T00K00KO0S `00P000[0#0S 0(0 , D0R*@ ,00(  ,00,0 (00(0 (00S00K0(0 ( 0$0 0000K0[0#0S , D0R*@ ,00' ,00,0 T=(0 0$0 00K, 000 <00K0[S $0S 0 $0 L0RH 000($ \ 0S0[Sk00KH 00000K0[~S񟗝mqqqqqqoooopooqqqqqqqqqqqqqqqqqqpppppupppppuuuuuuuuuuuuuuuupppp nquuuuuuuuuuuuuuuuuuuuuuuuuup pupupuuuuuuuuuuuuuuuuuuuuuuuuuuhpphpp0[S< 0[S, D0R*@ ,00\ ,00,0 00 L0R%*00 H000/S00 H0009S, D0R*@ ,000 ,00,0 , D0R*@ ,000 ,00,0 000K000S N0S S 0[S00S 00 L0R*00 H000?S00 H000!0CS #80S 0[Su00 H0000K00000 , D0R*@ ,00? ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00? ,00,0 a00K"b00Kf00Kn00Kr00Kt00K V~ v00K0[0K0[S 0[S $0S0S0[S0[Ss 0[0KL0sH000S000L0S000S`00S_0S^0[S] 0S[0[S, D0R*@ ,00' ,00,0 , D0R*@ ,00\ ,00,0 , D0R*@ ,00' ,00,0 40[S 00 6 0[000@0S000K80K 00 00KL0sH 0L0 0 0 H00 00L  c<K80K 00 0Sn 0s00Kk0s00K000 0 0 L0R[*0 0 H000SS0[S: 0S70 0 00 0 0 H000[0C!S!xxsxsxsssssssssssssssssssssssssssx 00 0 0R:<00S00K 000 80K 0S 0S0[S 0[0#0S 0 000 0[S9 0[0#0S4 0[S, D0R*@ ,00\ ,00,0 , D0R*@ ,00 ["# 0  ,00,0 , D0R *@ ,0 0[1000000,00,0 0[0000K0[S , D0R*@ ,00\ ,00,0 00K00 0R_*, D0R*@ ,00 [ ,00,0 00000 H 00000K 0[0#0S 0[0#0S 0S 0[20! 00 0[030S0[0#0S0[Sz, D0R*@ ,00\ ,00,0 , D0R*@ ,00 [ ,00,0 00000 L0s H 0000S000 ptxQ80 L0R000S,0S0S0[S9(0S 0[V0#0S , D0R*@ ,00(  ,00,0 (00(0 (00S, D0R*@ ,00 ,0# 00 0000 000@DH L00KH-8M  $0 0S 000 00 0 0000( 0,0 0 $000 0  0KH-M     00KH-@M $ ( ,0 ,0S ,0 10 000 0 (0S0000 000( 0,0 0 $0H00 0 00 000( 0,0 0  $0.0  (0S 0 C(0 0KH-M00 0 00 0! 000000 00 R: 0 l0R 00T0, H0@  80R 0 0 KD8<H-TM8 < @ D0 B0000 80,0 p20(0 80SX2 ,0R4,00$0 ( 82R000K$0s0[S 0(0$ !?0(0 1(  0[S (0!10!(0 10$0c1 |1$  80!(0000 80!(0000 D0000 D0D0D0( D0,0 0< @0t00  0R+80!(00      0R 80!(0@00 00D0D0D0( D0,0 0< @0B00  0KD8<H-M    0F0KH-M     060KH-M 0KH-M   0KVH-@M8 < @ 40K<40K8@ 0KH-@M8 < @ D0 40K<40K8@D 0KH-M   0KH-M    00KH-@M8 < 0=0KX04K4 K=0[ 40K8< 0KH-M 0 0K 0[ 0KH-M :0KH-M   : 0KH-M   0 00  00KH-@M8 < @ D0 T04K40K<@ 40K8D c0KH-M    00KH-M   0 00 00KH-Mx | x00 0S 0 Cx000/S t0Kx;0Sl0 0x| 0KH-M  0S00 00 0S00 00 0KH-M   90KH-M  0 0 0S00: S 200 0 C000/S0 0 0KpH-4M  $0 0S ,4$    0z 4 $0s#3n 00 S$(Dh4 <00 T0 000tK0 000D>0 000 -0 000 0 000  T0 000@ @ V i0 000P @P@ dH0 000` P@ `P@ #0 000` P@ `P@ DwKp| `p<lH- M   0 00 000 0!000S0000 0KH-HM8 < @ D0 00 000 0 S0 + K  + 1K000S00K0008<@ D0K0-H-$M   0 0 00 0KHЍ/H-00x,,, t(00$? m(LH-00 0M$H-M  .0 0R*0 a0KH-M   .0 0R* 0 [0KH-M   000 0S0S@.00 0S00 00 p.0 0R000 00 0  0 !0K說H-M 0KH-M 00 0S0S n0KH-M  0S0S  0  g00 0S 0S O0KH-M    0KH-M 0 i0KH-M  $00 0S!0KH-M  0 0KH-M 000K- M000S$0V 0 0  Ћ/(0- MK $ !40*"*0@P0>00K0/- MK  ,&  6000Ћ/H-(M( , 9 0 00 0 ,0 ,00S0e,0 00$0 ($)00 0S0S$ / 000 0 0 0 ,00 00 0S 000 ,00+0  03,0  0S,00,0 0#,0 00o0 0 0S 000 ,000  0 ,0  ,0 00 0KH-(M( , 0 0 00 s00 0S0] 0Kj0S0R 00  00 A00 0K0 0S   0S%00 # 0$0 $0S $00,E0S $0K 00  (0R 000 [ 000  g00 0S 0u0K- M 00C6S8강00Ћ/- M 0GS0OS0gS0oS00Ћ/- M 0OS0WS00Ћ/- M 0S0S00Ћ/H-M 0KH-M  0S 0(000S  0(00\0S00@00#00P8 0,0S 0K4H-M 0X00 |0KV0S0l0: S 0 0%K00 0  %K0 0 0  0S 0 S 0@S0GS0S 0S 00S0 0S 0?0S0 00S 00S0 0rS 00S0 0S 00S0 w0^S 00S0 l0pS 00S0 a0S 00S0 T0S 00S0 G0S 00S0 :0bS 00S0 /0S 00S0 $0S 00S0 0S 0 0S0 0 S0 0 0KH-M00s 00'c?K0S 0 00c?Kp.Ke?KfK0S H0 <00 1(14 1 0 00KĖH-MP00s @00 00  (0R  0 00KH-$M 0X00 ,0!,0!0(0S 0& 0R,0!$0 0K 0S 0@00!00,0 L 0R+0 ?!0!!K(h8H-MY00  D0R0  00R $0R00KH-4M0 00X00 0"K00(0Stt/p1)&00!/ 0 0 @4K[ 2 1[0S 1[0S 1[K 0S0|>K0K\tH-M  0X00 0 0 p0Kh c0p0 `0l0 0h0K05020g0K`0d0K0f0K0e0K0c0K0 p0K s0S0 Kp0K0 00K0K 0 Kp0K0 0V0K0K 0 0KH-M   lk 0 Xe 0 00S 00S 0  0KxH-,M( (0X00 ($0Sm 0 0K 0S(0 %(0 %(0@0000`\!0j(0 SB(0S? ($0E08#((0%08#((0%+0 (0 (00S)  K 0K( 0S (0  00 0(0 x0 (~0S ($0 ($0KSK-xM 0K0Sp L$0Sm ,0!0$0 $0S $0 0 0S 0;;S 0 ?!0!!|0: S 0"K0!, 0"0"P 00@ 'A$*>$0"lp 0C@S 00H 0 L 0 P 0 <0H <0 0 00KdK-M  0Kt0Su #0Sr '0S 'ZM 06''\3''00`|!a'0 0 0 S @SL S;"'K ?Ϡ Ϡ 0;0 *K 0d`t 0"0"Ϡ Ϡ 塌 0C@S 00H 0 L 0 P ,0!,0!ddd d01"s0 0 #0#0KhlH-M   \ 0 H 0 00S 00S 00KH-M K0K 0S p 0Kp0V 080 K (0b0K(0KH-M 0S```$`4!` *00 0S 0 0 00S * 0X 0X0S 0X0 0 0 0 ( 0 , 0 0 0 4 0 8 0S 0 0S񟗞ꄳԱ\̲x@h$Գj0S0S0S0S~0Sy0St0So0Sjl0SexT0S`q0S\k 0 0Sg " 0 0K 0s\ 0m0S000K00[0#0S= J\0S8CU0S3<0S/6\H0S*/DA0S%(@(!%# 00X0{00uq0K(@Xt0LH-M 0X0 0 0 00 M0X0I00E00A?KH-M 000S 000 0 0 0S0 00 0S 0000 0S0KH- M 0X00 0,0SK0 4 00,p0SA00 80 0 0S8 U0S&  t00 0S0S0S00000T 0$0S 000 0SKaxH-M 0X00 0V 01 0 00s4Y00X00 00 0 00s0@D00C00P 0$0S 000   H $0 , 0 , 0SL0K- M 0Ћ/H-M 0X00 040S 0000S00)0S0@00000 0B$0S 0KxH-M 040S 0K0H- (M "K 0!/ 0 0  01 0S 0) 000S  0  0X00 0!,(,B 00!K!K00 !K!KQP00 K0cdeH-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K F0sP00O0  pT #00 0@S00S 0K{|l0H- 0M( , #K(0X00 0 0 (0S#3(0!/ 0 0 #3 3R<(0 0S8 (0"000S1 K  0(0B 0 0QP  0 0 (,#K` 0S 0 00$,00(S0S 00(#K0S (0!0 0 (0!0 K 0S&'000(  p"#00 0S SS S @S 0d"0a!10Z0 0 00 0S 0,  0R 00?0S0 0c0 0, V 0,0 20S@@[00Z0(  p "00 0S SS  S @S 0|0 d" 0u0<D 0 K0l<H-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K 0s000  pT E"00 0@S00S 0Km\0H- 0M( , #K(0X0 0 (0!/ 0 0 #30(0,0S (00`# "0 S 00" p3R?(0 0S; (0"000S4 K  0(0B 0 0QP# 0 0 (,#K:0S 0 0(0!0,00(I0S 00(#K0S (0!0 0 (0 4 (0!0$ K |0S&'D00C0(  p!!00 0S SS S @S 0YQ!0V|`x!`10O$0, @$00 0 $0 00  0RF070S0 0c0 $ 00$0 *000(  p L!00 0S SS  S @S 0 !08< 0H K0!ttlO\{H-(M $ "K 0X00 0!K 0SXXX!X1% "K0S 0E04 K 0S 08 0!K)0!K P0 0!0  00 0S 0$ 0S0 0!% 0K 0!KK V P0!KKhH- M 0X00 0050 0 0S0%?00>0  pp 00 0S SS S @S 0L 0 0K\l\H-M 0S||| |0000S hXd X0w0,0S 0 0S00KPH-M 0Sttt t0R000S `P\ P0I0,0S 0r0S00K@- M0  0K@0 0[0000S   0R00Ћ/H-M /0S 00 0 0 ' ??  0cS000 00S0000S0000 000S 00 0 0S00S00KH-BMM00 !100 0S0[">K g0SO ">K _0S-G2>K0S 1@2>K@0 C1 K 000000S A>K 0C0C A2.KA>K 0C0CA>K 0C0C">K &0S "K` K0K K2K0S 00 0KtH-M d00 0 00 j0S0000 00S0K萖H-M000 0S40A 000S- 000S(0.K 00.K!>K0 00!S 00.S0/ 000 00S>Kv"0 0 0S0KH-t]p[lYhWdU`VS\QXOTMPKLIHGDE@C0 $0<HT`lxH-y0S-H-M0 0 0K V00 0S00KHЍ/H-M  00+00 0S0 00C00S 00C 00 00 0 *0 0S 0 0S 0 0S 0 0 S |0 000C000000S H0D00 008 00 0 0KdH-M 00 0000KH-Mx K 0x00 0S 0*K G>K0C O0SG.K Bt0K_0S K\0K QPK0 ?K 0S>0KtH-MKX K0S D K0S0 K0S 00KH-pMp l0Kp0S 0 \0: S 0$K0KH-M u20S000 0000 0 0S0 00 Y0S00KH-M 0SHHH H000040S00K H-M 0S 0a0S 0040S0<00 0S 0000 0S0K H-(M $ ( 0X00 (00 00 00 $0 0 0 0K  0S00Ki0H- M  0S"200!/ 0 0 TDP"D2o0S000b,0S 300 00 0 000E00 0V S0f0K #000! B 0 0*K0400S 0"SR,0+0*K 000! B 0 0*K0000 0 K @ 0S 0KT0@ Y0 0K O0S00 0K0 K  `< `0 S000 K03 4 PH-M  0S00K 00 0 0K 0KH-M @000 K 00 0S0S@0! K000 0S@0d 0K 0S00 0Kc 0[S 0S0@0K,t@H-\MX X0SLL.H6X00S4(0&$6D0KX+0S D0@X000T:X000D0D0 X000D0 D0S0_0@0 D00<0 <0S0RD01(080 80S? @540 000 000%40,0 0(0 B(0S 400K00 ,0!<000S"0!<0@00X(000!80@0000!<000S0!8000S00K000 D0 R0[0#0S(00(0 ( ,0R:0(0 X(300 0S{ (00C!<000S](00C!8000SU 0%KX00(00 0S 00 0s L0K  0ST0K 0S @"00s KX00!R 0%KH00!QP"0"%KQP(00C!<00 X0Sr00q00P!(0hV(00(0 D0( Rt0$0 0(0 1(00C!<000S#(00C!8000S $0S D 0100$0 $0S: $0 $F $0 1( (00(0 D0( R$0S0@0 $+0 C$00 X0000` $0j0 S0@0 $B8:<8@0KD '@BrXH-MP00s @00 [00  (0R  0 00K茖H-M 0S000 0S 0S888 80 0S00K -M  00,00#408 00#848#8 00#<0S 0a030C!000,030C000#408 030C000#848#8 030C000#<0S 050 0 00 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0# 0R0S 00Ћ/H-@MH L 0 0 00 00 H0S8 |4H00Sh\9 X4 040$0 $0S@,$,4XH$0S[ $00,$00#408 $00#848#8 $00#<00 $00,$00#408 $00#848#8 $00#<00 0S 000 $00,$00#408 $00#848#8 $00#< $00$00#408$00#848#8$00#<03 0 $ 04p0@0 @0S@h"`2H0H0  @0SH0 @"2t@00,@00#408V  @00#848#8 @00#< L0R\H0 0 ? 00 ? P0#KK 0 0OP 00b "KH0@0"K 0 ? b 0 0 0#K#K   0H0 0 ? @#K0S#K @x d0f @ \0S@ 04 ,0$,04S@%c04,044S@$Y0*, B> @$M040000 ,00$,004S@l$;0 ,004SS00 0408#8, $ ?, 00' ( ) *0<0 ,0@$,0 p$, E>ӀK, 3,044 ?  0 0K 0,x ,0t4",044 0 0,@ , 03, (3 0,F ,004Se00$ % & '0<0, $ 0, 00C D E F0<0 ,0@$,03, $ ?,X ,03, $ ?,4 00, - . /0<0 ,0p$, 0 , 0 , E>ӀK, 1,044 ?  0 0K 0,F , @1, F> P, B>  0,0($,0040(0 ,0(40, 0 tpd(0 ? 0R , 0 TPD(0 ? 00 C,0($,042 ,0,$0K $\8XxHhH-M 0SXXX X0(,q0< 0Z0( 0K6 H-M  0 00 0S\\\'\700L 048#848#(0 "$("(  B>04 ?V% 0 0  E>04 ? 08#(0"$("(  044 0 004S0t48#80 #48#800 604 ? 0@P004S"0    504 ? 00 "!""", #  $504 ? 08#(0"$("(  0 ! " # 0  048#(0"$("(  048#(0"$("(  00 0""",  004S0    304 ?; 00$"%"&", ' 0 ( ) 0 * + 0p$0,"-".", /  204 ? 08#(00"$("( 1  d204 ? 08#(02"$("( 3  0<<@00A0040 0) B 0@$0C"D"E", F 0G0p +0R0\ %= 8104 ? 08#(0"$("(  0 $ 0) & 0@$0'"(")", * 0+0t 060d  0U0100U0010KCl L8HhXdpH-M  0 00 0S 00 0  0-0S0004S0 `0  -0S000l-0KT V?hH-M  0 0 0 0Si/00 0  ,0S0%0!  1<0 |0R 0!  1<0`@ 00 0@S00K|< HrrAaH-M  0 00 0Sppp p0~0 `0  '-0S000,0K|$ H-M 00 00K000 00/S 0 0  00/S00K0[S 00 00K 00 0 00S0Ћ/H-M 00 0 0  00C 0 0S 0 C000/S 0KH-M  0S 0S00 00 0 0 0 0R 0 00 0 0KH-M s0S000K0S000K!0S000K0[S 0[S 0[SO00 S 0[0#0S E0 00KH- M 00 00 ;0 0 0S0)0S +0  00 0QP ?0S 000 00 0S 0  00 0KH-M `,A00 0S@0 0"SJ(( 0  0K H-M   0 0 0R* 00 00 00C 0 C00 "00 0KH-M   0S0S 0 "020 000  0 0 0S00 0 00S O0 0S 00S00 0}r0  0K H-M  V* \0#90 00 0S (0#9 0cf0KC@B0H- M  0@0 ? 0T 1 0$0 ? 00 P@ 1 000 ? B 0 0 0 K0H-M   00 0 00 0S000  B S0KH-8M0 4 8 <0 00 80S80$SS 440S$0K40 0 0 0 8  0"K 0 00R0S 000S 0000S  0"K000S 00"S 000 0S"K< 0 000S ;0 0 0 0000S"K< 0000S 0000DS iS BS  0000BS  00 0 ?0 00 0 000B0C5S񟗍<-..d-.-...-.-..-........@.`........ -X-...-...-.-.........$.,0K00 V,0K00 O00 L,0K 00 D,0K 00 <,0K 00 4,0K 00 ,,0K 00 $,0K 00 ,0K00 ,0K 00 ,0K 00 "K< 00 000 0 0 0 000S 000 "K< 0K0 X d H-M h0 0   00c0 00 0S  00 0R:0KH-M10sZ0K7 1 10s t1 l1V) 0S\1000 0S41 00 zh08@0 $0 "00".[08#(08#80"8#88#(0 08#(08#80"8#88#(0  00"C88#(d0 0K 00"00 00C0 0S 00Kp  0H- (M0 4 400 {00 00 000 0S$ 0 0 0 0S 0S000   S   00c0 0 00 00 0S000 0 0 @0P030 0"000000 00 0 40R(0K 00@08#8 0"8#88#(0 000 0 0 @0P(0K030 0"000000 00 0 40R(0K K0H-MMH  00 0S0hC>K0C 0C+*;@0 C>K0C 0C<0 @0Kl J0S0O@00 0 0 C<0 000 08 K 80K .0S*80K00 00S000S000S000S 000S000S H4S H :F0 0 0 0 0R80K'H-PMP T X \0 (60sw00 B. 5 l50 5 50S50 5 03K03K080 040 000 p50S'l5000 S 00S 050}505 4 <0K 0S40S4@ KD0KHKLK0S@08#89#9|$0D0 p4 H0 `4 L X4 L40S<40S(g409#9 $0V<%30 C3 ,0K, 30R , 30R( 30R3008#89#9t#0t3 d3, K, L30R( 830R ,30 S30 3 3 2, K( 0100 200 ?"K,0 ?` 00K 0"KK? 0"K\0S= \00S9\00 C020 $2 2 20qA?0c 1 11C!? c0100 c1 1 10aA?0c 1 1 1sC?0cx0cX!0810S8410$1@ 10 10 !00 00000S 00 000003K`0 <0K 0@P P0 $ T0 40 X0 0K@    gfffC@B  H- M  0 0 00  9 00 0SB00 S =00S 0S 0S000   S 0S 000S00 0 0c 0 0 00 00 0 0S 0KH-M00 0 0 5 0S( 00 0 0RK H-NM( , 0! 0\0 0 0  600 0S00C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$//SRQPM`-QЍ /SRQPM`-2Ѝ /@-mp@- 0P@Pp@ p0p@- D0`p/@G (0 0&  Ѐ=C-@P`pNT$ 0`Vp 0`C-@P`pT$ 0`Vp 0` *& *Z>>*SJ51:3////QO-`MSS@P3R??oS c0"C$S *x'x % SI* SI c   XXWPJ*WJ p\BpV 0 r0ЍR@oZ d($x   Z % SIV% * SI c  G8#XXXPJ*XJ poW g201;(   ' "Ƞ'8P0Kt:@` 0 @ ("Ƞ 8Z0@D[:j *Ƞ" H"(Q:Ppp Wt Jpq r0`0p`* pj57J;$x _(" ,8R0K(:b K Ƞ ,8R0I*RI0 Z bM\R!0-Z0@DPK0RK0SO-@ M`pP3R?oS c0"S%h H$H ( SI* SI c p m("TpG*TpG SooV~ f20v4'    K0 H #6 RI: b  0 P 6 8#(0(T PE:@d )#X  " (,T:RQ? I<RPoY6@e!%x` (( SI* SI c r@ Ƞ,Z@D*Z@D SR! Ѝ pi8Y4g%xL* ,hHS@K :@c9`H$8HR@`F*R`F@@b hT PEo RIWSK@0 0 R =) -L nonecylinderminimaloptimal@gHgTg\ghelplistmachinescriptversionalign-pretend-input-ttyghglgmgV0sgvgagdisplays this help messagelists partition layout on all block devicesdisplays machine parseable outputnever prompts for user interventiondisplays the versionalign=[none|cyl|min|opt]alignment for new partitionsgLhghhghghghhiNUMBER is the partition number used by Linux. On MS-DOS disk labels, the primary partitions number from 1 to 4, logical partitions from 5 onwards. LABEL-TYPE is one of: FLAG is one of: UNIT is one of: desired alignment: minimum or optimalPART-TYPE is one of: primary, logical, extended FS-TYPE is one of: START and END are disk locations, such as 4GB or 10%. Negative values count from the end of the disk. For example, -1s specifies exactly the last sector. STATE is one of: on, off DEVICE is usually /dev/hda or /dev/sda NAME is any word you want Copyright (C) 1998 - 2006 Free Software Foundation, Inc. This program is free software, covered by the GNU General Public License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %s... %0.f%% (time left %.2d:%.2d)Partition %s is being used. You must unmount it before you modify it with Parted.Partition(s) on %s are being used.The existing disk label on %s will be destroyed and all data on this disk will be lost. Do you want to continue?ped_geometry_test_sector_inside (range, *sector)parted.cwhat == SECT_START || what == SECT_END0start_dist >= 0 && end_dist >= 0start_dist >= 0end_dist >= 0ped_geometry_test_sector_inside(start_range,start)ped_geometry_test_sector_inside (end_range, end)start <= end -%c, --%-25.25s %s New disk label type?ext2Partition type?dvhPartition name?File system type?Start?End?user_constraint != NULLdev_consV3traint != NULL Is this still acceptable to you?You requested a partition from %s to %s. The closest location we can manage is %s to %s.%sThe resulting partition is not properly aligned for best performance.ped_partition_set_name (part, part_name)Partition number?, dev != NULL%d:%d:%d:%s; BIOS cylinder,head,sector geometry: %d,%d,%d. Each cylinder is %s. unknownCHS;CYL;BYT;%s:%s:%s:%lld:%lld:%s:%s; Model: %s (%s) Disk %s: %s Sector size (logical/physical): %lldB/%lldB Partition Table: %s devicesfreeall%s (%s) NumberStartEndSizeTypeFile systemNameFlags%2d %2s Free Space%d:1:%s:%s; free;A %s %s partition was found at %s -> %s. Do you want to add it to the partition table?searching for file systemsNew device?part->disk == diskpa->grain_size != 0alignment type(min/opt)%d aligned %d not aligned Flag to Invert?New state?Unit? %s %s align-checkalign-check TYPE N check partition N for TYPE(min|opt) alignmenthelp [COMMAND] print general help, or help on COMMANDmklabelmktablemklabel,mktable LABEL-TYPE create a new disklabel (partition table)mkpartmkpart PART-TYPE [FS-TYPE] START END make a partition'mkpart' makes a partition without creating a new file system on the partition. FS-TYPE may be specified to set an appropriate partition ID. namename NUMBER NAME name partition NUMBER as NAMEprintprint [devices|free|list,all|NUMBER] display the partition table, available devices, free space, all found partitions, or a particular partitionWithout arguments, 'print' displays the entire partition table. However with the following arguments it performs various other actions. devices : display all active block devices free : display information about free unpartitioned space on the current block device list, all : display the partition tables of all active block dV& evices NUMBER : display more detailed information about this particular partition quitquit exit programrescuerescue START END rescue a lost partition near START and ENDrmrm NUMBER delete partition NUMBERselectselect DEVICE choose the device to editsetset NUMBER FLAG STATE change the FLAG on partition NUMBERtoggletoggle [NUMBER [FLAG]] toggle the state of FLAG on partition NUMBERunitunit UNIT set the default unit to UNITversion display the version number and copyright information of GNU Parted'version' displays copyright and version information corresponding to this copy of GNU Parted partedGNU partedhlmsva:--alignUsage: %s [-hlmsv] [-a] [DEVICE [COMMAND [PARAMETERS]]...] No device foundWARNING: You are not superuser. Watch out for permissions.You should reinstall your boot loader before rebooting. Read section 4 of the Parted User documentation for more information.You may need to update /etc/fstab. partition_align_checkscsiidedac960cpqarrayfileataraidi2oubddasdviodasdsx8dmxvdsd/mmcvirtblkaoemdq}}}$}0}8}@}D}H}P}X}\}`}d}l}t}x}_print_disk_geometrydo_mkpartsnap_to_boundariesprefer_snapsnap%sline_length - indent > 10strlist.c %*sstr_list_print_wrapGNU Parted 3.0 Welcome to GNU Parted! Type 'help' to view a list of commands. Usage: parted [OPTION]... [DEVICE [COMMAND [PARAMETERS]...]...] Apply COMMANDs with PARAMETERS to DEVICE. If no COMMAND(s) are given, run in interactive mode. You found a bug in GNU Parted! Here's what you have to do: Don't panic! The bug has most likely not affected any of your data. Help us to fix this bug by doing the followingV% : Check whether the bug has already been fixed by checking the last version of GNU Parted that you can find at: http://ftp.gnu.org/gnu/parted/ Please check this version prior to bug reporting. If this has not been fixed yet or if you don't know how to check, please visit the GNU Parted website: http://www.gnu.org/software/parted for further information. Your report should contain the version of this release (%s) along with the error message below, the output of parted DEVICE unit co print unit s print and the following history of commands you entered. Also include any additional information about your setup you consider important. 3.0 Error: SEGV_MAPERR (Address not mapped to object) 0ui.c Error: SEGV_ACCERR (Invalid permissions for mapped object) Error: A general SIGSEGV signal was encountered. Error: FPE_INTDIV (Integer: divide by zero) Error: FPE_INTOVF (Integer: overflow) Error: FPE_FLTDIV (Float: divide by zero) Error: FPE_FLTOVF (Float: overflow) Error: FPE_FLTUND (Float: underflow) Error: FPE_FLTRES (Float: inexact result) Error: FPE_FLTINV (Float: invalid operation) Error: FPE_FLTSUB (Float: subscript out of range) Error: A general SIGFPE signal was encountered. Error: ILL_ILLOPC (Illegal Opcode) Error: ILL_ILLOPN (Illegal Operand) Error: ILL_ILLADR (Illegal addressing mode) Error: ILL_ILLTRP (Illegal Trap) Error: ILL_PRVOPC (Privileged Opcode) Error: ILL_PRVREG (Privileged Register) Error: ILL_COPROC (Coprocessor Error) Error: ILL_BADSTK (Internal Stack Error) Error: A general SIGILL signal was encountered. : command_line != NULL'"str_list_match_any (possibilities, def) /[]? ]? invalid token: %s%d*valueExpecting a partition number.Partition doesn't exist.Expecting a file system type.Unknown file system type "%s".Expecting a disk label type.*value != NULLprimaryextendedlogicalV0Can't create any more partitions.Expecting a partition type.onoffoptimalminimalOPTIONs:COMMANDs: Report bugs to %s bug-parted@gnu.orgUsing %s (parted)This command does not make sense in non-interactive mode. command_line_get_disk_typecommand_line_get_disk_construct_promptcommand_line_pop_wordsa_sigsegv_handler ncols >= 0table.ctt->ncols > 0s != ((void *)0)**s == '\0'table_render_rowstable_render_rowtable_add_rowtable_calc_column_widthstable_destroytable_new3.0[%d] %s:%d (%s): %s Assertion (%s) at %s:%d in function %s() failed.path != NULLdevice.c/dev/mapper/dev != NULL!dev->external_modedev->open_count > 0dev->external_modebuffer != NULLped_device_sync_fastped_device_syncped_device_checkped_device_writeped_device_readped_device_end_external_accessped_device_begin_external_accessped_device_closeped_device_openped_device_get_ped_device_probeInformationWarningErrorFatalBugNo Implementation FixYesNoOKRetryIgnoreCancel8<@DHPXn > 0exception.cA bug has been detected in GNU Parted. Refer to the web site of parted http://www.gnu.org/software/parted/parted.html for more information of what could be useful for bug submitting! Please email a bug report to %s containing at least the version (%s) and the following message: bug-parted@gnu.org3.0%s: %s Out of memory in exception handler! ex_fetch_count > 0ped_exception_leave_allped_log2fs_type != NULLfilesys.cfs_type->ops != NULLfs_type->name != NULLfs_types != NULLwalk != NULLalias != NULLfs_aliases != NULLname != NULLFile system alias %s is deprecatedfs_type->ops->probe != NULLgeom != NULLped_file_system_probeped_file_system_probe_specificped_file_system_type_getped_file_system_alias_unregisterped_file_system_alias_registerped_file_system_type_unregisterped_file_system_type_register3.0V3Out of memory.handler != NULLtimer.cnest_frac >= 0.0nest_frac <= 1.0ped_timer_new_nestedped_timer_newsBkBMBGBTBcompactcylchs%kiBMiBGiBTiBCannot get unit size for special unit 'COMPACT'.0unit.cdev != NULL%lld,%lld,%lld%lld%s%1$.*2$f%3$s,.-%d %d %d"%s" has invalid syntax for locations.The maximum head value is %d.The maximum sector value is %d.The location %s is outside of the device %s.%lfInvalid number.ped_unit_formatped_unit_format_customped_unit_format_byteped_unit_format_custom_byteped_unit_get_sizedisk_type != NULLdisk.cdisk_type->ops != NULLdisk_type->name != NULLdisk_types != NULLwalk != NULLname != NULLdev != NULLPARTED_DEBUGprobe label: %s %s: unrecognised disk labelold_disk != NULL!old_disk->update_modeold_disk->type->ops->duplicate != NULLold_disk->type->ops->partition_duplicate != NULLgptgpt != NULLtype != NULLtype->ops->alloc != NULLbios_geom->sectors != 0bios_geom->heads != 0disk->update_mode == 0disk != NULL!disk->update_modeThis libparted doesn't have write support for %s. Perhaps it was compiled read-only.part != NULLPartition %d is %s, but the file system is %s.disk->type->ops->get_max_supported_partition_count != NULLdisk->type != NULLdisk->type->ops->get_max_primary_partition_count != NULLThe flag '%s' is not available for %s disk labels.cylinder_alignmentUnknown disk flag, %d.part->num != -1part->disk != NULLdisk_type->ops->partition_align != NULLpart->disk->update_modedisk_type->ops->partition_enumerate != NULLdisk->update_modedisk->type->ops->partition_new != NULL%s disk labels do not support extended partitions.part->disk->type->ops->partition_new != NULLped_partition_is_active (part)ops->partition_set_flag != NULLops->partition_is_flag_available != NULLpart->disk->type->ops->partition_get_flag != NULLpart->disk->type->ops->partition_is_flag_available != NULLdisk_type->ops->partition_set_syV& stem != NULL%s disk labels do not support partition names.part->disk->type->ops->partition_set_name != NULLpart->disk->type->ops->partition_get_name != NULL!(walk->type & PED_PARTITION_LOGICAL)!walk->prev || walk->prev->next == walkwalk->type & PED_PARTITION_LOGICALwalk->prev->next == walkloc != NULLpart->geom.dev == geom->devext_part != NULLpart->disk == diskpart->geom.start >= 0part->geom.end < disk->dev->lengthpart->geom.start <= part->geom.end%s disk labels don't support logical or extended partitions.Too many primary partitions.Can't add a logical partition to %s, because there is no extended partition.Can't have more than one extended partition on %s.Can't have logical partitions outside of the extended partition.Can't have a logical partition outside of the extended partition on %s.Can't have overlapping partitions.Can't have a primary partition inside an extended partition.part->part_list == NULLped_geometry_test_equal (&part->geom, &old_geom)metadatafreeextendedlogicalprimarybootbios_grubrootswaphiddenraidlvmlbahp-servicepaloprepmsftresatvrecvdiaglegacy_bootUnknown partition flag, %d. %-10s %02d (%d->%d) ped_disk_printped_partition_printped_disk_minimize_extended_partitionped_disk_get_max_partition_geometryped_disk_maximize_partitionped_disk_set_partition_geomped_disk_delete_allped_disk_delete_all_logicalped_disk_delete_partitionped_disk_remove_partitionped_disk_add_partition_check_partition_check_extended_partition_partition_check_basic_sanity_disk_check_part_overlaps_partition_get_overlap_constraint_disk_raw_add_disk_raw_remove_disk_raw_insert_after_disk_raw_insert_beforeped_disk_get_partition_by_sectorped_disk_get_partition_disk_check_sanityped_disk_next_partitionped_disk_extended_partitionped_partition_get_nameped_partition_set_nameped_partition_set_systemped_partition_is_flag_availableped_partition_get_flagped_V<partition_set_flagped_partition_is_activeped_partition_destroyped_partition_new_ped_partition_alloc_disk_pop_update_mode_disk_alloc_metadata_disk_remove_metadataped_disk_enumerate_partitions_partition_enumerate_partition_alignped_disk_is_flag_availableped_disk_get_flagped_disk_set_flagped_disk_get_max_primary_partition_countped_disk_get_max_supported_partition_countped_disk_get_last_partition_numped_disk_get_primary_partition_countped_disk_checkped_partition_get_pathped_partition_is_busyped_disk_commit_to_devped_disk_commit_to_osped_disk_destroyped_disk_new_freshped_disk_clobberped_disk_duplicateped_disk_newped_disk_probeped_disk_type_getped_disk_type_unregisterped_disk_type_registergeom != NULLcs/geom.cdev != NULLgeom->dev != NULLCan't have the end before the start! (start sector=%jd length=%jd)Can't have a partition outside the disk!a != NULLb != NULLbuffer != NULLoffset >= 0count >= 0Attempt to write sectors %ld-%ld outside of partition on %s.checking for bad blocksdst != NULLsrc != NULLped_geometry_mapped_geometry_checkped_geometry_writeped_geometry_sync_fastped_geometry_syncped_geometry_readped_geometry_test_sector_insideped_geometry_test_equalped_geometry_test_insideped_geometry_test_overlapped_geometry_setped_geometry_destroyped_geometry_duplicateped_geometry_newped_geometry_initconstraint != NULLcs/constraint.cstart_range != NULLend_range != NULLmin_size > 0max_size > 0min != NULLmax != NULLped_geometry_test_inside (max, min)geom != NULLconstraint->start_range->dev == geom->devped_constraint_is_solution (constraint, result)okped_constraint_exactped_constraint_is_solutionped_constraint_solve_nearestped_constraint_doneped_constraint_duplicateped_constraint_new_from_maxped_constraint_new_from_minped_constraint_new_from_min_maxped_constraint_inita >= 0cs/natmath.cb >= 0V) align != NULLped_alignment_align_nearestped_alignment_align_downped_alignment_align_up_closest_inside_geometryped_alignment_initped_greatest_common_divisorfs_info->cluster_sectors % frag_sectors == 0 && frag_sectors <= fs_info->cluster_sectorsfat.c0fat16fat32fat_set_frag_sectors"X#hfshfs+hfsxJFS1jfslinux-swap(v0)linux-swap(v1)swsuspSWAP-SPACEUnrecognised old style linux swap signature '%10s'.SWAPSPACE2Unrecognised new style linux swap signature '%10s'.S1SUSPENDUnrecognised swsusp linux swap signature '%9s'.< h  linux-swap(old)linux-swap(new)linux-swapext2ext3<hext4nilfs2NTFSntfsgeom != NULLprobe.cdev != NULLParted can't use HFS file systems on disks with a sector size not equal to %d bytes.hfsc_can_use_geom (geom)hfsx_probehfs_probehfsplus_probehfs_and_wrapper_probehfsc_can_use_geomgeom != NULLreiserfs.cReIsErFsReIsEr2FsReIsEr3Fs(reiserfsreiserfs_probe +-sun-ufshp-ufsped_file_system_ufs_init0xfsaixdev != NULLaix.cSupport for reading AIX disk labels is is not implemented yet.Support for writing AIX disk labels is is not implemented yet.Support for adding partitions to AIX disk labels is not implemented yet.Support for duplicating partitions in AIX disk labels is not implemented yet.part != NULLSupport for setting system type of partitions in AIX disk labels is not implemented yet.Support for setting flags in AIX disk labels is not implemented yet.err == 0566 7@7|777 8l888999 :909T9:`:aix_partition_max_lengthaix_partition_max_start_sectoraix_partition_alignaix_partition_destroyaix_probelinux-swapbsddev != NULLbsd.cdev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0disk != NULLdisk->dev != NULLpart != NULLpart->disk_specific != NULLpart->disk != NULLUnable to satisfy alV* l constraints on the partition.Unable to allocate a bsd disklabel slot.err == 0<=CCCH(LMNpNO8PQRRHT0SXQ|QTTped_disk_bsd_initbsd_partition_max_lengthbsd_partition_max_start_sectorbsd_alloc_metadatabsd_partition_get_flagbsd_partition_set_flagbsd_partition_destroybsd_writebsd_allocbsd_probelinux-swapм؎|!8u u|tL|msdosdev != NULLdos.cpc98disk != NULLbios_geom != NULLchs != NULLraw_part != NULLpart != NULLpart->disk != NULLpart->disk_specific != NULLpart->disk->dev != NULLpart->disk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 00ext_part != NULLdisk->dev != NULLInvalid partition table on %s -- wrong signature %x.Invalid partition table - recursive partition on %s.geom != NULLgeom->dev != NULLped_disk_extended_partition (disk) != NULLlogical != NULLfatntfsfat16fat32hpfshfshfs+sun-ufsExtended partitions cannot be hidden on msdos disk labels.Parted can't resize partitions managed by Windows Dynamic Disk.Unable to satisfy all constraints on the partition.metadata_length > 0err == 0VdYZZ(~ZT[[($ИxԻ||ped_disk_msdos_initmsdos_partition_max_lengthmsdos_partition_max_start_sectormsdos_partition_enumeratemsdos_alloc_metadataadd_logical_part_metadataadd_metadata_partmsdos_partition_align_align_logical_log_meta_overlap_constraint_logical_constraintmsdos_partition_get_flagmsdos_partition_set_flagmsdos_partition_destroymsdos_writewrite_extended_partitionswrite_empty_tablewrite_ext_tablefill_ext_raw_part_geomfill_raw_partmsdos_readread_tableraw_part_parseraw_part_is_lbaraw_part_is_hiddenraw_part_is_extendedpartition_probe_bios_geometryprobe_partition_for_geomprobe_filesystem_for_geoV?mdisk_check_bios_geometrypartition_check_bios_geometrylinear_endlinear_startlegacy_endlegacy_startsector_to_chschs_to_sectormsdos_freemsdos_allocmsdos_probedvhb != NULLdvh.cold_dvh_disk_data != NULL%s has no extended partition (volume header partition).dvh_disk_data != NULLChecksum is wrong, indicating the partition table is corrupt.PED_BE32_TO_CPU (vh.vh_magic) == VHMAGIC(part->type & PED_PARTITION_LOGICAL) == 0(part->type & PED_PARTITION_LOGICAL) != 0part->disk_specific != NULLxfsOnly primary partitions can be root partitions.Only primary partitions can be swap partitions.Only logical partitions can be a boot file.failed to set dvh partition name to %s: Only logical partitions (boot files) have a name.part != NULLUnable to satisfy all constraints on the partition.0Too many primary partitionsdisk != NULLerr == 0Ľ\4\T Lx DXped_disk_dvh_initdvh_partition_max_lengthdvh_partition_max_start_sectordvh_alloc_metadatadvh_partition_enumeratedvh_partition_aligndvh_partition_destroydvh_write_generate_boot_file_generate_partitiondvh_readdvh_duplicateread_sector0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,V?[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-gptpth_raw != NULLgpt.cpth->Reserved2 != NULLpth != NULLuuid != NULLdev != NULLmbr != NULL%s contains GPT signatures, indicating that it has a GPT table. However, it does not have a valid fake msdos partition table, as it should. Perhaps it was corrupted -- possibly by a program that doesn't understand GPT partition tables. Or perhaps you deleted the GPT table, and are now using an msdos partition table. Is this a GPT partition table?The format of the GPT partition table is version %x, which is newer than what Parted can recognise. Please report this!last_usable > first_usablelast_usable <= disk->dev->lengthlast_usable_if_grown > first_usablelast_usable_if_grown <= disk->dev->lengthNot all of the space available to %s appears to be used, you can fix the GPT to use all of the space (an extra %llu blocks) or continue with the current setting? gpt_disk_data->entry_count > 0gpt_disk_data->entry_count <= 8192The backup GPT table is not at the end of the disk, as it should be. This might mean that another operating system believes the disk is smaller. Fix, by moving the backup to the end (and removing the old backup)?Both the primary and backup GPT tables are corrupt. Try making a fresh table, and using Parted's rescue feature to recover partitions.The backup GPT table is corrupt, but the primary appears OK, so that will be used.The primary GPT table is corrupt, but the backup appears OK, so that will be used.primary partition table array CRC mismatchgpt_part_data != NULLdisk != NULLdisk->dev != NULLdisk->disk_specific != NULLpart->disk_specific != NULLfatntfshfsswap0part != NULLUnable to satisfy all constraints on the partition.err == 0,|V* x 0""l(t.//H03'44%|004t4gpt_partition_max_lengthgpt_partition_max_start_sectorgpt_partition_aligngpt_partition_get_flaggpt_partition_set_flaggpt_partition_enumerategpt_alloc_metadatagpt_partition_set_systemyD<#*=(;Mt?(s*K>;Hah!IdontNeedEFI(2{\ M}-@Mjy֬oceRev0eC쬢3Dh&SFH0eCmWC 3KOO3Dh&gpt_partition_destroy3Dh&add_metadata_partgpt_write_partition_generate_part_entry(s*K>;Hah!IdontNeedEFI;Mt?yD<#*=((2{\ M}-@Mjy֬oceRev0eC_parse_headergpt_probe_pmbr_is_validpth_crc32swap_uuid_and_efi_guidpth_get_rawpth_freepth_new_from_rawloopGNU Parted Loopback 0dev != NULLloop.cdisk != NULLUnable to satisfy all constraints on the partition.err == 05647l779$;; <@<t<<\=<=0>===>p>loop_partition_max_lengthloop_partition_max_start_sectorloop_readloop_freeloop_alloclinux-swapmacInvalid signature %x for Mac disk labels.dev != NULLmac.cPartition map has no partition map entry!AppleApple_partition_map%s is too small for a Mac disk label!partition_map != NULLpartition_map->type == PED_PARTITION_NORMALApple_BootstrapApple_BootApple_driverApple_UNIX_SVR2rootswapLinux_LVMLinux_RAIDApple_VoidApple_FreeExtraApple_ScratchApple_ExtraPartition %d has an invalid signature %x.Partition %d has an invalid length of 0 bytes!The data region doesn't start at the start of the partition.The partition's boot region doesn't occupy the entire partition.The partition's data region doesn't occupy the entire partition.Weird block size on device descriptor: %d bytes is not divisible by 512.The driver descriptor says the physical block size is %d bytes, but Linux says it is %d bytes.V) i <= disk->dev->sector_size / 512No valid partition map found.disk != NULLConflicting partition map entry sizes! Entry 1 says it is %d, but entry %d says it is %d!Weird! There are 2 partitions map entries!part->num > 0num > 0disk->disk_specific != NULLdisk->dev != NULL!disk->update_modeuntitledpart != NULLhfshfs+Apple_HFShfsxApple_HFSXpart->disk_specific != NULLChanging the name of a root or swap partition will prevent Linux from recognising it as such.Unable to satisfy all constraints on the partition.part->disk != NULLCan't add another partition -- the partition map is too small!disk->update_modeerr == 0ADEF`~,ЃD Tȓ`0@Ԕped_disk_mac_initmac_partition_max_lengthmac_partition_max_start_sectormac_alloc_metadataadd_metadata_part_disk_count_partitionsmac_partition_enumeratemac_partition_alignmac_partition_get_namemac_partition_set_namemac_partition_get_flagmac_partition_set_flagmac_partition_destroymac_write_generate_empty_part_generate_raw_freespace_part_generate_raw_partmac_read_disk_analyse_ghost_sizemac_duplicatemac_allocmac_probeIPL1pc98IPL1dev != NULLpc98.cdisk != NULLc != NULLh != NULLs != NULLraw_part != NULLdisk->dev != NULLInvalid partition table on %s.pc98_data != NULLPartition %d isn't aligned to cylinder boundaries. This is still unsupported.part != NULLpart->disk_specific != NULLname != NULLstrlen (name) <= 16fat16fat32ntfsufsUnable to satisfy all constraints on the partition.part->disk != NULLped_partition_is_active (part)Can't add another partition.err == 0dxܣ 0<dD84DLPX̷̲@ped_disk_pc98_initpc98_partition_max_lengthpc98_partition_max_start_sectorpc98_alloc_metadatapc98_partition_enumeratepc98_partition_aV<lignpc98_partition_get_namepc98_partition_set_namepc98_partition_get_flagpc98_partition_set_flagpc98_partition_destroypc98_writefill_raw_partpc98_readread_tablelegacy_endlegacy_startsector_to_chschs_to_sectorpc98_freepc98_allocpc98_probebuflen <= disk->dev->sector_sizept-tools.cb != NULLdev->sector_size <= sizeof zeropartition length of %jd sectors exceeds the %s-partition-table-imposed maximum of %jdstarting sector number, %jd exceeds the %s-partition-table-imposed maximum of %jdsunloopgptmsdosdasdamigadvhmacbsdpc98 $$$$($$$$0$$$$4$$$$<$$$$D$$$$L$$$$P$$$$T$$$$X........................................................ ....................................... .. .... .........................................................................................................................................ptt_clear_sectorsptt_read_sectorsptt_write_sectorlinux-swapRDSKV& BADBPARTFSHDLSEGBOOT%s : Bad checksum on block %llu of type %s.amigadev != NULLrdb.csizeof(*rdb) <= disk->dev->sector_sizedisk != NULLdisk->dev != NULLdisk->disk_specific != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0%s : Didn't find rdb block, should never happen.%s : Loop detected at block %d.%s : The %s list seems bad at block %s.%s : Failed to list bad blocks.%s : Failed to list partition blocks.%s : Failed to list file system blocks.%s : Failed to list boot blocks.part->disk_specific != NULLpart->geom.start % cylblocks == 0(part->geom.end + 1) % cylblocks == 0Failed to write partition block at %d.dhxpart != NULLpart->disk != NULLext2ext3fat16fat32hfsjfsntfsreiserfssun-ufshp-ufsxfsUnable to satisfy all constraints on the partition.Unable to allocate a partition number.err == 0LddtlX|HPptped_disk_amiga_initamiga_partition_max_lengthamiga_partition_max_start_sectoramiga_alloc_metadataamiga_partition_enumerateamiga_partition_alignamiga_partition_get_nameamiga_partition_set_nameamiga_partition_get_flagamiga_partition_set_flagamiga_partition_set_systemamiga_partition_destroyamiga_partition_duplicateamiga_partition_newamiga_writeamiga_write_amiga_find_free_blocks_amiga_find_free_blocksamiga_readamiga_readamiga_freeamiga_duplicateamiga_allocamiga_probe_amiga_read_blocklinux-swapsundev != NULLsun.cCorrupted Sun disk label detected.cyl_size != 0bios_geom->cylinders == (PedSector) (dev->length / cyl_size)GNU Parted Custom cyl %d alt %d hd %d sec %dThe disk CHS geometry (%d,%d,%d) reported by the operating system does not match the geometry stored on the disk label (%d,%d,%d).The disk label describes a disk bigger than %s.disk != NULLdisk->dev != NULLdisk->disk_specific != NULLThe disk hasV3 %d cylinders, which is greater than the maximum of 65536.part != NULLufspart->disk_specific != NULLped_partition_is_flag_available (part, flag)Unable to satisfy all constraints on the partition.The Whole Disk partition is the only available one left. Generally, it is not a good idea to overwrite this partition with a real one. Solaris may not be able to boot without it, and SILO (the sparc boot loader) appreciates it as well.Sun disk label is full.err == 0l ( $%|&&0(|*d+.p/H20++,22ped_disk_sun_initsun_partition_max_lengthsun_partition_max_start_sectorsun_alloc_metadatasun_partition_alignsun_partition_get_flagsun_partition_set_flagsun_partition_destroysun_writesun_readsun_allocsun_probeinvalid argument %s for %sambiguous argument %s for %sValid arguments are: - `%s', `%s'write error%s: %s%sPOSIXLY_CORRECT--%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument A NULL argv[0] was passed through an exec system call. /.libs/lt-literalshellshell-alwayscc-maybeescapelocaleclocale $"`'%s (%s) %s %s %s (C) License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Written by %s. Written by %s and %s. Written by %s, %s, and %s. Written by %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, %V0s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. Report bugs to: %s bug-parted@gnu.org%s home page: <%s> GNU partedhttp://www.gnu.org/software/parted/General help using GNU software: %smemory exhausted/proc/devicesBlock devices:virtblkdev != NULLarch/linux.c!dev->external_modeCould not stat device %s - %s.%u.%u.%udev->open_countCould not determine sector size for %s: %s. Using the default sector size (%lld).dev->open_count > 0dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0PARTED_TEST_DEVICE_LENGTHUnable to determine the size of %s (%s).S_ISBLK (dev_stat.st_mode)Could not get identity of device %s - %sGeneric IDE0Device %s has multiple (%d) logical sectors per physical sector. GNU Parted supports this EXPERIMENTALLY for some special disk label/file system combinations, e.g. GPT and ext2/3. Please consult the web site for up-to-date information./sys/block/%s/device/%srvendormodelError initialising SCSI device %s - %s%.8s %.16sGeneric SCSIPARTED_SECTOR_SIZEThe device %s is so small that it cannot possibly store a file system or partition table. Perhaps you selected the wrong device?Unable to determine geometry of file/device %s. You should not use Parted unless you REALLY know what you're doing!typename%s %s%sGeneric SD/MMC Storage Cardpath != NULLDAC960 RAID controllerPromise SX8 SATA DeviceATA over Ethernet DeviceIBM iSeries Virtual DASDCompaq Smart ArrayATARAID ControllerI2O ControllerUser-Mode Linux UBDLinux device-mapper (%s)Xen Virtual Block DeviceUnknownVirtio Block DeviceLinux Software RAID Arrayped_device_new() Unsupported device typeError fsyncing/closing %s: %sError opening %s: %sUnable to open %s read-write (%s). %s has been opened read-only.buffer != NUV% LL%s during read on %s%s during seek for read on %send of file while reading %s%s during write on %sCan't write to %s, because it is opened read-only.%s during seek for write on %s/proc/partitions/dev/%d %d %d %255s/sys/block/dev/hda/dev/hdb/dev/hdc/dev/hdd/dev/hde/dev/hdf/dev/hdg/dev/hdh/dev/sda/dev/sdb/dev/sdc/dev/sdd/dev/sde/dev/sdf/disc%.*s/part%dp%s%s%d/proc/mounts/proc/swaps/etc/mtabdisk != NULLlooppart != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0Error informing the kernel about modifications to partition %s -- %s. This means Linux won't know about any changes you made to %s until you reboot -- so you shouldn't mount it or use it in any way before rebooting./sys/block/%s/range%ddisk->dev != NULLUnable to determine the size and length of %s.Failed to add partition %d (%s)%d, Partition(s) %s on %s have been written, but we have been unable to inform the kernel of the change, probably because it/they are in use. As a result, the old partition(s) will remain in use. You should reboot now before making further changes._have_blkpg ()x`linux_disk_commit_disk_sync_part_table_blkpg_add_partitionlinux_partition_is_busy_has_partitions...dm-ramlinux_sync_fastlinux_sync_do_fsynclinux_checklinux_write_write_lastoddsectorlinux_read_read_lastoddsector_device_seeklinux_newinit_genericinit_ide_device_probe_geometry_device_get_length_device_set_sector_size_device_statgeom != NULLaffs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu Pralloc = %d, Reserved = %d, blocksize = %d, root block at %llu %s : Couldn't read root block %llu $TDt4daffs0affs1affs2affs3affs4affs5affs6affs7amufsamufs0amufs1amufs2amufs3amufs4amufs5_genVeric_affs_probe_generic_affs_probeRDSKBADBPARTFSHDLSEGBOOT%s : Failed to allocate id list element %s : Couldn't read block %llu %s : Bad checksum on block %llu of type %s %s : Couldn't write block %d geom!= NULLamiga.cgeom->dev!= NULL%s : Failed to allocate disk_specific rdb block %s : Didn't find rdb block, should never happen %s : Failed to read partition block %llu amiga_find_partamiga_find_part_amiga_read_block_amiga_add_idgeom != NULLapfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu %s : Couldn't read root block %llu apfs1apfs2_generic_apfs_probe_generic_apfs_probegeom != NULLasfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read root block %llu asfs_asfs_probe_asfs_probebs != NULLbootsector.cgeom != NULLFile system has an invalid signature for a FAT file system.File system has an invalid sector size for a FAT file system.File system has an invalid cluster size for a FAT file system.File system has an invalid number of reserved sectors for a FAT file system.File system has an invalid number of FATs.This file system has a logical sector size of %d. GNU Parted is known not to work properly with sector sizes other than 512 bytes.The file system's CHS geometry is (%d, %d, %d), which is invalid. The partition table's CHS geometry is (%d, %d, %d). If you select Ignore, the file system's CHS geometry will be left unchanged. If you select Fix, the file system's CHS geometry will be set to match the partition table's CHS geometry.FAT boot sector says logical sector size is 0. This is weird. FAT boot sector says there are no FAT tables. This is weird. FAT boot sector says clusters are 0 sectors. This is weird. File system is FAT12, which is unsupported.Xt~"tThis partition does not haV ve an operating system loader installed on it. Press a key to reboot...MSWIN4.1NO NAME FAT32 FAT16 is != NULLThe information sector has the wrong signature (%x). Select cancel for now, and send in a bug report. If you're desperate, it's probably safe to ignore.fat_info_sector_writefat_info_sector_readfat_boot_sector_writefat_boot_sector_generatefat_boot_sector_set_boot_codefat_boot_sector_analysefat_boot_sector_readUnknown error (%d)Unknown error %dCopyright %s %d Free Software Foundation, Inc.0 <= strtol_base && strtol_base <= 36xstrtol.cxstrtoll/dev/urandom/dev/random/var/lib/libuuid/clock.txtr+clock: %04x tv: %lu %lu adj: %d clock: %04x tv: %016lu %08lu adj: %08d /dev/null/var/lib/libuuid/request/var/lib/libuuiduuidd-qT300/usr/sbin/uuiddRV \X@XQ $ (g(L  |T(444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444̒hijj,j@jhjjjPklkkk\~l~~Pdh$X6Hx|Чl$PDTH\̓Lplt,X4\<`d|    ̪Ȫ (8 0P$XhT\P@X4lD3?<`,ط<`,ܼXLH048<ȖHLP4TXX|\`ėdhVlp0tHx`|x\ A/aeabi%ARM926EJ-S ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.V 4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v1V 00(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.V9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.comment (($ LL@! ) TT(2 ||;$$644AȚ`G(g(M8g84Upl l `lx}ȒȒ DPp0V ԳV&Tls̗R;˺R;˺RbusyboxW&Tiplink̗R;˺R;˺RbusyboxX&Tscriptreplay̗R;˺R;˺RbusyboxY3Tbusybox̗R̗R̗RZ0ELF(44 (p..88<<aQtd -L @ -p x p1Q4 RCA 0\R! B0R BR  BR  BR BR B  b 0RR! B 0c 0S,0S(   - @ $4s$p pP$4 p1%0p p p13ꔍp p13( <p p p13@-.pp .@ p13p p13( <p p p13@-.pp .@ p13tp p13( <p p p1~3@-.pp r.@ p1p3p p1f3( <p p p1Z3@-w.pp N.@ p1L3Q:@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1Z?P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R  --- 0. XԀ0 R  /f @-0S0S3/ 0q 0C0SSQ 000 c!X @-@r$0 0@,P @u` @-$@$00 0L"PdX EO-_MaT3P H6P A: S(1S@1PP 3 pp` 0P MP22@ PP2 `#0`S [S]Pt 0Sqr0Sl $Pp W`=qPb  `0S\ Ph0 0 0@`5 0娑@ 0S@1F x1 cdp10@0T 0  P@1 .:P-  E10S  P@0 00  20S P@0 00@aW^0000@004 0`P@T_ߍ@wgD v@-0 'P@@P  x0P0S@PXT0SH D,04(4fx)* )?H-Z<`pPP1S2 2"᳠B :#:@1U@ nPiP 10Sb 10S1@@0S @TCt1 0 S* P  P 0  0 0P  R  Pꪡ) 00 S ѧP 0 0  էP 0 R 0*ZeP tZ+40!T013/"  X H@gDOzh E-P@!PVT P`PV1P00!  0P0C0A0`0fUUPP`F@0SXP=| tPP `PT00P0S818!p0AP@W10!#20!00:#:` 4/P 0S E~0PU]P@0S 0xPgldj! X (  4 #  D EH8@-PPT0H D@0-Q00 h05 3@-/@P@0" 0 /R00S/0 C R 0a0CS00 R  /@-0@-S00C Q 0a0C0S $00 07@-0P0C Q 0a0CS $0@0@ 0>@-0@-S00C Q 0a0C0S 00O 0@-0@0C Q 0a0CS 00: 0Z) p@-PLPP@/;@0/S 0\  0 p@` *-@- n@-/@P P0S @@-/@P 000P0 P/R00S@8@-@PP 0S B@0S @8-@-00,00P  .@Ѝ/%_-@-00$00P  @-%_0 C SR/0 SS/ 0CS/O-P!M `R0` !P`  JPWh1Upp <1 @  lP 0 @$ 0 S 0: 0Up 00G Q  @0@ =@ t07 @T00   000 0$  Ѝ(` $%_@-  0P 4p q4np*4'p8@-@#PP=8@-80P (0($0Qǡ'0 xRE-RP@ ph`000V0S Z 0Pc p W`ʚ;?R00S-0` B0@-@ 00H@-@ 00H@-0@ `4P@D&r`P p PpCPCT0 @-@PP )n'`Pp 'PUV ``00@000?0<<0 s@-0P@ 00忠U` 0SP  x0 B("S030100T 0SHP  (0 B("SP030100|T-u8@-P Z3@P @8  @-@+@@-@+@ @-@fPP8@-@_PP580-@-V@P 00(00 O@Ѝ/0-@-BP 00(00 ; @Ѝ/@-@ḦP"@-0000$P2@-"P9@-Pg@@-PP)@-@P@8@-P @P 8@@-@PP@-@ƝP@-Pr@-!Py@- P[ -@-  $PO@Ѝ/ 40H0S 0 S*0/p꘲@-@ 0QP:@@-@VP 0ꌲ @-@`p@: 0SRT 0US܀@-PH@-@RPp@-@P_ p@@-@ᔝP-P@-@@@-aPp@-`PҠ@P  p8@-P@ŠP8 @-@WP8@-@JPP 8@ @-@<P@ @-@P@@-0P P @-@0p03T0S@q @-@0p03T0Se p@-0P  P 0CS@c   p@@-=@P@d@@8@-P @|88@-P0p03U0S@P 8 p@-P`@PP @Z& p@P00p8@-P@P ,00P   8(@-l`@#PP000SS `Vjh@0/S QpZ@XU@ApO-PMM@P+0JP`p P0  aP |Y  A PXX ?`px@TP0 `pЍڍ 00@-@P00@8@-@PQP8 0QP o}A-@- @Ѝ/@-p`P@  XPT@@`P`U@-40p@`P `P0S @-p`P@  PT@ `@P`UE-lMpQ 0 ``#_0@(PV1 P pP@ :V(``X#u0W0@lЍ8@-P㈣@P8P8@-@P%L8@-@P8p@-@PhPp p@@-@RPA7@-PU@P*.PP% P P t P 0S0SBS0ZS, ($y>,|\Xp@-`@PPpP@P pp@- X0@-P@p` P0 S 0  @05G-PQ`p pV㜠pW@Pp`  P T 0 S X@:0V00ee0GZ% T0A-Pp`@ ʝP0T@DS S =@-40p@`P P0S D7@- ㎒ ?C ? Ѝ0@- ?  Ѝ@B@-@p0 O-0$M@:P0P4 ` 0'P# h 0@PpH 0@P( 0@ P{0v>C 0C000C00:S0e k.IeP 0PP00 0P P 0000d 0P9HP 000000( 0P P 0000000 0 0P( P% 0000000 0 0P0v>C 0C000C0.Q 0X P000S 8$Ѝ"0 @-@P00TE-SP`@ p0"0 P P"U0@ R   Pp WpG0#SS 0C0SS$0U005/PO-GM pFpP`P@@1SP \哀11P@ P8B <`P z@Gߍ@-@ PpPUP`!G-(0p0h@`iPPX00 L 0P^P0S@Y< G-(0p0h@`DPPX00 L 0P9P0S@Y G-(0p0p@`PP`0Z00 T 0PPyP@Y G-(0p0p@`PP`00 T 0PPRP@Y G-(0p0p@`PP`00 T 0PP+P@Y A-`P@41X0p @:.@PA 00 0S5 :R2 R  ,  ,Q Q# ,Q! AQQ Q00QR 0 P B1 @T@@-`@P0Up@:0P  0SUP :P@00P'@-`@P0p0S U@ :0P  0S :R@00P 0@- I@͜ 0P/?T 0P/9X@- @0S0\X@-@ 00< H/ Ѝ@-@ 00< ,/ Ѝ@-@ 00< V/N Ѝ@-@ 00<X f ЍE-0@0rP 1! 1!  V1Pq0S  :MlM`PM  `V 81xP`?  19APP 00q0Sp0dP_p`P 00  RUgMP0 HxPR4T 0x 0@IдL M4\jp0@-04M,03# PPZ02 02(02" 0 ,   $  0 V20$0S@$2 0 ,0S|2,0t2(0,P LPLL4H20P d0?0(R0$R20 , 0Su00P0sP0s 00P t $00(00lJ0 \xP;H忍@<0 0x, R$  /P# @$sP 000S $ P$ΕP $0 b4Ѝ0t E дs M/\ Q-@ ?RfE-M@YPPL1L! H1H! @3U`A:@P$&00L lp   lp Tn@0 w0P |w0 S tX`0 tXpH0TPPЍ @ (`1`!0@- ,M00L! 0H1$ D! $0@00 0$T 1P!1R R0 0$0dS $01 0 00sSP65 R  vq7lP P `000mSPKH0vT mo,Ѝ07=CдMT0 R 00vP@-@ 000gSP "P hV\000uSLP <4P$ @ L @- P@.u@-@IpAm/Ŝ@p@-M`P-@ Z % ^ (p 0S0S -CP|, pU L,pJD0-@ @T N  ݍp_ E-MP@D 70707 07$07' 000000 0S7pQ - ` \S 0F  eF` F0S00! 0# 000A Q000(`\(0a!ll RI0 S(0Jʐ@PQ 6 嬙@PD@T|6 t6t& p6 OH6@0-SP/S (@ \HQ9,NKT@0 05T,P ㎕U@P@K>\00T`>\00d0`0T0j00 \0X 1 T\0k 0 @f 0& TP@ 0TT0k`k@*0Pp @ 000C SP\0:00\0P:TTPk`g0  00 S S0  eP `k Pp 3 g$i_Y_ Ph3000CSFTPU(QS  0 0Q 00c``P U U& U %U U U 2P5%0U0 $2T !@Dp @D@2T[U 20c S: ? PA0S b0T@ xA P`pZT U;T0Z & `0,> 0`0X0T Xef0iX0p0Vlgph0 V V \0<\0\0<\0T000T0\000 0\00\0T 1\0000 {00 0y m` xд0( $T Tp T[ @-<.oㅒ.G-0nM@1<ב@^p3 u.m?QP Xa dnx60Q a \nP P P P`P`F `P00pH0S0S (0S 00C8S -X! P,@P-h5pXun/   ,0 0ဘXE P,m!4 p 1S7 @]40H R  R4 5:p P@T 0@0SSnO044d@ P  hP@0 S00a @P '00!S*S& 50SaP3#P 01 kX#X3#aP a1S 00S IP6Gp Wa/ 0|0P1zǐ0S' pPP! T 31PH0S 0 S@405:*/p@U LWP(&m1n/0a 㭗X=lpm劘E [GX%  P 01~p y`Xit8h 4f 0d Z 3,b (` G`V 0Sa%Q% 0l㣘PPr0S ޷ 0nlnߍSYдm`uL{ Tx #.8BE X N@-@P9 @O-WMV_ 40%4 4@ ⤷ O3P`TxP`Ñp P1SBrFQUP|FW@ 0Sh  \#0 P10>0C g0 Oq0P Hqt0S RT 0 | Wߍ` ([дa@ *<Ro`sWG-PM0PP0%@L0峐 L0pN10Q1S` -R0S`P@X@、PP P`XKL1 PWLE0@S 0S10W bGP 0+ 6L0S - 0+? LL0WS 2jP |0L0L0S0L0p%EL  0kLH 0jZ ) д` E  2 @- OM1@NoP@& 1!  N1`1S X믎ᫎQP MP IPD1 PL~Z@PF 001>0C <P;01S8 004 CPP 0SQOߍ f`p3W CD9 tQp+Pd'PT0 R 0j8( д r V0 R  V0@-M@ሏ8D|1|! xPfMlm `m\ m m m@q@e$ 1Mx000 0 8 08᪏ 0 <<000<0H0?0<H00 0Q x#FPC\<x | KzrxVV&_`  @-@Pp``PPPG- M`P`\1@T10 L10H1H00000 00$```L1pa 1 1PS00&PUECpA 0H"p  0lh0` PXH  Ѝ(3д4\%DM` @-M, @4i  300(PG@PU 0@ TPPA\@P A0@,0#F( [P0 P  6P $"'"$"Z < P5 0(" 0$ /`PH@$80   ʌ@  0 P@^ \P1g)xP Pl1tJPP T1\JpP 0-S0-S, P Ppጿ0  oP R 0 -R0-S   x0IPPЍ"()4:DOox/.p@- M0 P 0%`|0@t00p00l0l  0 X 00 000EK<0 Ѝp` (дp@-P|0`K@P 0+S\000S WU  @T@pp@ 눲  O-M`p `' Pt3@l30h30d3d# 0 000L `J<3p@aLf0S f 0@P9 <R/ - >V@PPtYP8 @Z|2P`/ `6ZZ 0 0H M@8(&   f]gp8P@1P0a^ '`Yp0 m0   |h[`?\0.S 0.S S0 S0S : 0HP0  cP  (0 . m ^P @DThЍ(Z?)д}AIQY^fq/4 0C \ aL\_S -S .S @S00S0/@-@`p]P0-S`0IPP:D000S` WtV 눲1* @-@ P@IA-p0MP$pjf` l3@30303# 00,000$0 00( I3p $0S-$U0uS 0pS$ R0  30 30,00 @P2,,0,p|qPP J WP x Q0 ``s 0S 0S V((d O]Q( p/ZX .P喿 .P  (P? P5}4:~P$0S PP pW.$sU!P$hUP 0P$CUM$0SV峽H`PX |0Ѝ(д N`  G/54:Ab=p@-@0PP  P>| >  `. ),00 R R 0Sp iFTM@-`@P.H0S 0 S405 :pM-Q Ѝ@WP 0=S W 0UpCSp SWU p 0L!PbpCUH0S  0S ""11405Z* :"I01 U(H0S 0 Q0#11"1 45 :"#/02 U HPU  0R03104 5:P0vz Ѝ "E-PPDM@ 0-S0S @Q2 6pU - 0`P-W-``V   x0ykU@pf ᕼP00! U 0-S0S |DЍp "8@-H0@0PP T !@<8G@-M@ g000 P@@T 00 0T00 0 1kT@ @0@c 0S0 Ѝ$0@-@Pω00P@-d`0@ MkP0 ,,R,QA eo1@-!M 00000 F00P l0900 l000  l0 000 k090D@PSXP6$00(00,00?`p,  W 00pP`|00STlh=D00<00@000@4 80 @Ѝ + M$ /O-EPp`, 1nTPp`! lP@ dP fP p nP rP  &0kz~0k`0kpl0kP\ X0 E  < 㩈PU Ut*4/K0 /s@-`P@%\P Z P cP00 NP sP  -P0S X00C0^P  @@0000Pe|5 O- ,M@`ll$`f`E\5\0 `ApAH=PPP@4?PXZ@X9V`1$NR6X$`  + P$Q V `1XX\4 X  X WEZp $pX@@X 0 -S000TP ^ P!1 Y VP0P1Aꔣ  PW  0S   D3PU0i P$ 30U JmP# 2  Z 2 0UJ[P 20S  0ڈ0Pں! T2 0S @20S @0Ss 0St 0-S p@S 1 1XaPU[ 0@SPf P 0001 U\R dR pRDI  KR  PJPZ0E Y  0q0Pں!Z0  X ,0S l00S@QL0,Ѝ 0R дȯA%_p'p@-PT@`R8PT 0p@ p@ 71E-!P aDppp MBD1@ 1!P0 S!ia@S` *Pg(02 0嫺P o 0垺Z P` W c0i "wP8s SP \VkдJr A-`P#YP00 0S0000a_pW0S00USP@T|-7@-@0P00P U" @ P  PU  00  pD0D G0S>@Ѝ/pA}O-M0000S * ~"2(-P p 0p% 0p咈  2000>0 2m0X 0S0 000@T`VU  p`0S00@UVPP CP0PD0S00: `01t!϶0S- ỈZ ἇ[% XP81S4\  0> SR 0!* R  R  00S P00@T0pWX< îp1Jd(E pe #4O@-G@PP cP O 6 XჀЍ@-+P c000,)60P0h \X @PLH@P@ 0,0E A-|2M|0t2t" x |0p`Z?\2`KP  @K x16d6`0F@VQ0-S0S rPP!+P|V V VB(0p0p0t0傻Q|P hd-`o P%㨇pP y00 0U-pᐇP`$| sV ၆  厵P 0Shh-kPPЍH|8 S1д| &B,A3%}eAF@-$0 RB!p\8@-00P (@R @ 8pl@-`pCz@?z$x@@-8zxx@@-`p.z@*zjx@@-`p z@z\x@@-`pz@zvKx@p@-@P 0yp@p@-@P 0uxp@p@-@P 0wp@p@-{@Px 0twp@s@-P0S 0Z S tP6/@@`V | {0  0p@-S @\0`S _0@0q80=PP@0@Spp8@-'y4@P,00S8] 008pp@-@ T0|p@>syTP T` Xp@20A0S@10X@ p@Sp8@-$P@Q@DTPE8p 0 !pp@-@P 0kip@O-$MPXpP( 1` >PPE @ 00A S0S b@A  1d@ P  Z P1QD00 `GR  0 =}p0`0ST T ( T @T # 0  0 D喳T T  T @T  (ᶀ($Ѝp1p!0@- tM@\<X10AP1T@PI3 (h FPh 1R @ S0000000 0l00H0 0}>$0}>C ##00 @h00h0h0S dP XT 80@tЍ0д"/u  "%__&S SSp@-@P$ABAńH@0a@ Ƞ$P@!,Ƞ`P`@PU@Z0SZp1O-0MpGPH `@[J~> $J`,+` -(ဠ"(P Z$ ,I⌠ L\ ZpGPE +J   `0@0 0[Z d;tHUd0ppt0 @PEdHd{UЍO-B4MP3@3,00(0$0(00$00 ,0;(P xLP 8a`\3PT^P`8#83?LPL3@ 0Sf,%F$ 2P2 <0S $0( 0  0P{pK$0 S Z p , 0-S0SP2@ P y@,b,fQ ሾP10 q#4P0 P`00ټP0S  X1`$0Y!(0[! 0|P0 1!0 SS>~ S R0:P U:$P$ _00PP $ fP v000CdP S;@PZ ` 4Ѝcl *vFpqVzA-@0 Pd` 0;x%U 0_A3#G- M@:20P2` 0: S 2N/D1|181@S @pP: 3p2,p6d26 0h1P L2H 0SPpUPU@ L1SPp @SPp SPPpp0h10 Y0"S"$!l!夡 0x11E p10p.t1|P4TxC>0 0_S@ ,Q(N^\ ^/1L 0Yx!  X!V/0`\Q=0 5Zx嬰x!D10x1x1@!S:N^. Zݍߘд3M  > MȀK| M@M@M 0@-S,M` 100lS@P P 0ST_P #_@J0 `0 000$0lS p gU tq@qT T P$@< 80440 ,Ѝ3M %M@TM@\C-@0`0PS؂ d!4#   0v 0V@ <V8 0 (ЍpCFЍpft00S/ )O- M@ 2" i92`Q 堁tl p{PXO%P8 E@` 0v2@0`0@`` { P000F0@  ? SR`@ 0@ 0@J%  R 0!08  !0QP@ ,5;(% 0 +)5G  'V00  }P 00 0'    P d 0`JVЍgдM M@ $0@-@P]  !PA-@000PU|p` PPT0ӗ ` Vp ,000S,6@-@&0   <SA-P`0@Shٮ@`p@pg`FV 0 S@pg`FV P AVE-pP@` T Ხ0S00 ( ᦮pWP@]^Z P/噮g0 P{P@-@ 劮@0@-@ T@P PPެnH-@4MP /P0ᰐS_ܞPP>YV븞PP  )Y .EP|0tp>p80d.dSS X.S P.S D嗬0(.,SS0 匬P .04 0-/-0*-0%- 0 Y 0A8!S` =U`PV . :0C8s $h zUx'x䌟  8 ٭ U*ZJ P+ P X !Jx 'x*Z ZUPUP1XV%X UV :) R9#9SOʸ:) R/IV UV1SC ;9 S? :) R9#9S7V UV:) R9#9S,*;0S'ʴ69 S# 6 ;S?0S V UV:9 SP V UV 6  6PPPPV<  U0 T$ !9 S0 J0) B(r BiP` :PU `S  H 垫P:XUE(x 含YU    p`p 8 -0 `Vp0S0`0 S l)@S   D9)P^7wx9W`V R3f` &VV0h PҬXQ0S @ ǬV 7Uh &8bQ baR bQ`ᯬᬬ:1; SἼ8  Z " 0 ᔬ 0V`1%*5T剬L(0Ys`p4 0}WV /0Ks 0q lP Q 6  a6  \6  WU &6  ' K|嶪Q Qh'Q`'`7T't6T:X 0@8s r?7ro 0+XQ # U`` 0SRP 5&Q6 6V 6) Rtt6t &`U^0SHYC^<  ( LV5 : ׫< S ϫ̫U#Q !ëQ 6  (8S9S 岫Q x孫Q h娫 \夫6  QQ 7S7S!ᒫP s /0`P m /0``6 P u /0``V/0Sn  0 6Sdѩ6 8S8S <XQ ,SQ N ~J6 pW qp` <` V pYX6fp ` +`h&h0#V U厩6 8S8S 0Q 0Q   ;:9 S*q봊z`+   0S \1 0S&2 x0('xzVji V`/``h&h/V?0SHe+HЪZ 0S;S;S 00A8s廪pW `(1XB+`  嫪V p ` Z7ss7%Y@ bw-;f(l@B6fq#=Sq(x-ALf 8FPbipxQ +MWq  ` 0 \\0\ p` LW W` V V   :;) R #40S0 S 00  "UQ ] 0R0!0  80p@-PO@0 Q@@cOā@p@-l0p@-P0Sp0OT$0S@0S T@C0Oġ@p@p@+@-0 ,@u@-@TdrF=E-0M000T1@0000@1O`^Z   V$1 0@00R00 R03:4 1 00 R000SP $PUPPQx1S  ᅡ e i 0S\PP O@pP0 S2Ѝ8@-<0P@P00P00 P0S8P8A-Pt@p000 P`0000P`V00T0S L@DV00C0eT*B`@ p<`Mp@-t[ 0@Sp@eP 8K00PDH0D@@0@0<0p@s@J1p@-@P0PSPP wP`"0 ?/0PSp@   DM`V p@00`] P000S  0C0p@O-pMbP,;@`0+08 0<`@`$``%:0QpcPV ?P GPQ NP {mPR dP? [P RP o]P bP0 jgP9 eP" fP$ bjP kPuP) qPT nP pPZ! rP sPc OzP wP yP G{P }P Ba:660L~& 0a0C0S-L0SL`L0 !0TL0 ` 0a0C0SL 0 P V1TR0SL0Sg0Vb_ 0S P` 40 !A`0V ᄗrP5 ) @+$5 ) #U4NP" EP MP "mP ~P SP 4  " 4  "4  "4  " x4 @ " d4  " !4` իPd ` ɫP`0V:0``40 ๫Pc  ᭫P /`FVJd@PKx (TTTTTTT0T8@TTTTTTL<0S3@P 4<0 H R0A<$<0 H 0R@0A0C<@0 N 00 C R=0L?`PP  00 B RbV  `0`F =1 @R`OGU5 %U8 u, u% U$ U!<U& /U8 >U ?U7 nU, eUdUbUgU wU pU uU yU zU000Fd}Z00040 )$0 ) `дh` NXoy%} #~O-MM.30"3@!"3PZ" zi喘(0-S0S d単\(3PD3$10 11111I? p000> 0G?0>0E?0F?0K?@( 0@XP ! 10!0!0!0S(!]0S sc0S `jcNL0t/!/S@dR$ /  bp$bP cfR jP00: S  !  bPpR$1: cR$1: bR $1:$1 1S0C1`-4P/$!S 0 0!1 b1! / 0$fdP   aP$aP P1! X Jh h01P7Mߍ\%ߘmд'9Ae 8 {%_ SG-`hM@PZ4aPU\1pp LU<  G#KP3pP  EP |& ḩS/P / pP /ժP 00 |}@[ 0P }@0U<i@ FhЍ"'%_2A-p@`PP%.ᠪ⪩ 0P.ᓪ\❩ 0tP .ᆪ 0iP}3#O- 4M` 2$D4P"0P0@@0P2PU1pP<P1p7,X4 `(强P" $:ԨP 0 Z  ᩺P P %HP@Z 0S(呺P,(!Z#10P a1@/ᘨPPp7  0MP5@:Ĩ`d4!@0!0  0 @ 0 2`P` iVU  $0 @ @0:S S0 0S`UxY00`0S4ЍZд^pxxp@-P@ឮp@í8@-0@ ҮPP ƿ8E-=M00002" 0 @00}2 Ͼ|xi/p hPPd200Sp P᰿D  00x?,2  PPq ` _hH D@ၭ !@P^P  !PQ ,,!0P0@01T<S  PQC Q&   R@<S  P0 0`V bPH %LP  W }f40Ѝд"2  p / 6:0/1!O- lM@1 0Ap` g +gPPTW 0: S b@ @@<104>(1 0 0: S5 ЀЦ" PugP@* YXP&[ZPP  p  | Ppٔ  d0U``  ДPှPlЍߘ7д<CZm` e`%_p@-PM@ 嚸PP0U R@ɻPZPZ$ 0``P00 nC0F8S Fp0(BmVT P0P(D}< ,0PЍp[P{Z4 x m%_qm@@->K 0 ~0@-S@`z.PP00 000 0p 0paplW`P@-P I떎0S0X SA NR B,", (fP僒/@-] 㣸@]TO-M M[>M@lPˍ Ꭻ  ៬=OC00a `3P0 p ` @0PZT- 0}$SR~$SR4SS   S B @R0DQ T 00  P U@0Z4fZ Zb00a {pPVwPR`W LZ@KhPC 0 Z:U ]P8X 3JS P.0H0W/ 0W #U0 0 ! L !P0S! 0SR 0UAp4 00a ?p`V0` V `CSP 4' 0j  !:[+  ⽫ zB4!<W0p@-S@PP^` VX@P qb6巼O-M 1@0"T1!PAq1HS\\\10'@PPF  ?r`H0S 0 S@405:@ 0D T^S00VZ%;@00 呒00 ኒ0 `V 0屾0` 0t0S tQbдlh o020"M- PM2 1!P0@P Spp!Aa@Spa8h p`Pg[x0ꮢሀ :,\RS\LA 0 q    PЍ0`0 0 0 fA0 0S T 0 21 " @X g`P 8s ᪻P 2峻дv 8@-P@jST$E%8E-M LŵP僻0 00 0R ~   #GPCx0p`@p0S \H  b P L00cL0'$詒  5%O- TM@5 p5qE@5@\0 ,,RP`QA HP0pS0 ?(Rd0P``£P   4 @%Y0C0C5S ꠮ĮЯ$@t$0<HT0S 8L RP :}R R<vR< Rf<oR< R  gRdR 0  ᾐ (0  ~|4LQ ?RZ&y嘐wt$stR  dQ Z <R< 0S%$R =Z R S<R< S0  <R< S}R 0lh,0"h*DH'L Q  Qd[R  :@ <8 [QD@Y K0 R  ,,RP<C TЍ д,!   DcCc!)! !'$!!@-0 M0 0 0410"01,00 0`:P S0S0 01Sճ@P哹/[<=L00CS0[P [a0   H0@0 4l ЍC!I!д]!s@-@| {[0PPP``PSX  L倏 0wS hSw$0S 㣻|Tp@-P(M 0S HE@0`4 @Pỻ Q(Ѝp(g!8@-P +㚽@ᧉ 0S$坸Pc=8끉P8j@-0M 00 `@ 0p< = PP =P`F8㥻 P@dd d0$ㇺX0T Ⴚ?D g`ߘp! NW v!!W` @-  Rj!A-`@PpḲP pW0   0000@pp PU@- @]Pw4@E-1CM@`199P[ AZ' P ׻0p0H岺 }@p: IP` -S200@0S  @$ 4P\ )P @ "P t?P Eg$>@@1 0C0T:FCߍ!!0!!!!@-MP/|0"p2h2`+AP /H0 P@ P*_x0SP q~`ƹ0/[0S/ !0m210 19B l0   P0PPU @T10 1B堶.`Ppe# 0庍0S@T00 0B偶.`Ppe# 0\囍0S@Tߍ*!д!!з"Cc!!!"8@-PU@P o 偻8%"0@-$M'@T9f0H0S 0 S 3 405:  lPCPP@,9000000D0P ` 8?, ,0-'P$Ѝ0;"\"I"` c"0S0/@- 0 ! 01|p@-PQ@ Pp@ `  @MpCcp@-M` Yd0P@ P PUV@ .@  #܍pp7@-W'P':ヶP" P 0  00 0S 00C 0@崹"P D ,@@ 0S  , ,0&P'>"`p8@-@Z( d00P080@0<@08" 00 0  NP008ptu"A-M@S0.Sa &@P\ QQpVP) 1SH TQ`p _P m"000 00C 0000 00 0`V!'P  1S  P  |P `P~000A8 80 &P&ލx!p}"""0G-`10t @W0!@@TpF !F1@@P0 0p@8 @P W1 P ޹*0p00"0 V 00 P@@T P 04幹0000S""p" 2 " A-0MP1`h@ Pi "Pe Jp~\z%p000cl!l1[%P% 0S(1 Q0S7 &$0S b 0S \P0S  0+Pp$!0  P'0S`!`PUލ"#д#!;"xp#+#!!tPD/p8/P0/P$/&P/P`#Q#`#;##0@-@00UQs@-X0X``0!L0@ 00չPP@@d 00 oV@|` @-`P@걮ặp @ᾜ,0, PPP#8@-PP@@ T 㪷@Z) 0-R_  0S  R .R  8@-@pP 0S t mP`P@-AM`00@"MLP sP 000S $q1Sw+  _ `PP 800>  (徳PAߍ#д##O-@PM b)^003/PhZ003/@D嘴P` ⤖n010*>0>0>- 00! 0!.?P`q 0S 0"0ROT !ݭPH0S խP@p0h0!)0 3/P003/ !⺭1Pr,P8- !. 嶉  ⱉ 0$P⨉`p /PU 40 RT00S Pᒉߍp%_:$H$x_$e$q$t$$$*$ $E-5ME 0p50Q,P 000 000|5P ,PJXT%βH0 00 R ,²0S,P$0 R a! 1S? xP D q00 3/Pp`Vx( t40  PXUPቛH D4`嬴U 0&0R$h0$pP@003/Pph `P񟗛 $,<PP PPP߶p0S 0X} T孬P 0xp03/P8 Pp`V4PP 4⺛ 2*D c00Z* 3/PC 0PS002040B\A `P;P P 40040040|#0S 0pW IPp 0x03/P840 040kQU`P4 L 8 %TP (100S PPPU 400 40 TP 000SܱЍz+P _$p` $$$д$$ %$,%G%V%'l%%%#%%&U&%_S/&&>&@-00xxL0tSDH TPPч800 ,0LP0Lp3QpdxuL&E-CMXdA@0S40@SN < R @aQGS0C4080S !cP>P<q0000` <<0  M J0   D A00  Pa 0gP D00D0L080@H00H040S$00 |QCߍp xtG-6xMFp `t0040pp*t0i6& t00p004 l0P l|&5x6z:><0hv0 ?00T60H6 `tኲ,60( 00徲0 00 6哲  0l  ~70p0P |埾Ppq|50 R R   0S9  @tp`8 ᛪ040S  D0姲A?40D000 4hppt@p ]7h 4S -D00ڪ0004 0|0x 0"h0s0Z+ dSL妴0,0ğ00' J0 ~倆yt zl0i0 }P0h0,00h000*0`PXpP 2V60S0 S  S3 #!R S R0SpW0Q0V` d ` d0R82p  `0Rw pĩP T 復Pj 0S ` SdpG6 2 "嶠Y"2 ZdL0  `0P p P Wۅ0` -|Ӆ80S n8ppglGGD …4-L0p0L060SP00P00 ST00T00  `0@00P ~U-xЍ&p&&&1@Bд 3&`&&t '$'x='\'i'z'''mQ1'''j''00 0/G-@M~d`qp`T4T   7 V@Pf 0 4ΰ`崃T0iP:  B⤰ 0 3ᱰ*&X.TXp7l3l#P 0,.(3呰p0P .P ̮X p WX #` VX V@2V 2凰0S C0FSp1P`P L2VH ,2kmV0 0 B-0FS,`!p 0IP |!# I`"H 0 Z,hG 1QHI!0㖂! eK 0/ 0FS- Vp pP4!  : 00.0 !Rp 0 S?3 V` V 0 0H.D0د@Qލ'P @A(K(y((((((((((( )).A@B'S[)00Q P.\ @  @Q/O-(5ML2 5H2?0 =0/? @xP D 2P5 @$2  p14 au4 4%N H  00$d`20↻PT )@40S 8,0",§ .00@,F820#("<!p !4!0#3pP<2L$04 `@{ p %/000ϰp̰p33`0(00%<<"4\Tp P /000000 0("o. 0@}SPr`20S t%>P(`0(2E0ST P D]4< 0ಀ Xp  XP0 SMx$P" I X0 S0*S 4}PSS0*S  4 P X APU& PX%X84 Ŧ p% 00( 㽦4%48#8 p42峦  ᯦<0p0=? (00 a000R<0g000000 0.]P(0 0c00 S))*)(5)P)_)l)))))O-MM-20"2G> 0/ @+ C^ Px000 0p ` Z- 0p`勍P@ l 0p`偍P@0D嗰@C. G.0S Y20aPF>0P  'P ` # [F>p 0F`0 0:0 !0 np`F VAn `|᪭|40 1ޭ T G [t@  3P ٫o|ጭ Enp0`园 ե; % 4X40_40+` 0pƭЍۍ&ߘ))`)*д' *;*H*30\ 0\`/0P/p@-@c @@-,@ Q00S@p@-,@ A00S@pO-pP"៥@ᜥ`ಮ@" pe S0`S B0P`@-0#T   @ 00  00Sv p00@-4P 7KP @ @p550 250 @-@00S@sp@-iP 0,@TpU*@-(@,A0P,0f00p7@-PJp0P  ᝼@PPa 00 800,1@T>p425 t 150p@-P M@P\ t!t100h1 0d1d! 40P0 0-S0lS P⑭@P屪 ~ KOgHU@ n= PP :PP - `P DT 7ܤ8~ Ѝp- po*t*213 *226 Z. 8@-X|@ (0tP}1(0(0 bX( X(/8#  8pt0s@-Pl@`00cSP 00 0ʬ!QP  J`|p*C-TQ 0tMЂ@`"PI V $;` 4P@ 1!T@@ 0A BRRP@QP0: S cT # 0@   0ာVX`p;V0<C40100tЍp*AA553 *451 226 G->MI0>C0x0 09) 0000 0Pc 0 R05 0 ` S10a0 R 0XX JTT G0P( 49  (9 (q9  90S x ˫80P I AP 8P姼 8P塼 |8P囼ph) P *MP@ . P~ `p'-z- 0Q ;` @-`pJPPV et 㜶2@2(0.cP$ ޛpڛ ᙋP  Л0S.S(p(0StpẛP0(0 pWV 0% 1&%* &% 0&%PQI%QP 00 0GI 0% &` p0 R0&K` F% &`P` 0IP%QP $&RƟ` pPf! &R`| ~V & R?& |*㈥`PV0S-2MG-`hMH0d R"僁!""0 q0 Sp`VP2T0(@2@0S 80dOiPP "0iP0| Vw1VP|4 Mw 1V |Q1, 1>wPW @P ||  0QP$ iP(!0fiV&| % %w&P 0 R0%%|  0wP|0  0P0 | ZP | 0@vP@0@ |弤P 0STZ3* RhЍw ` --3--.x.+.Q...M@-:@-(M` P0pp@ 0dP/00 /00/r@P0X(U 300S  {dGT002@ 0/S嬟963JHF@2T@:㥉`P ]7P`pV :00T 2L@@HQ 4 LQ $0S /U W 8Q <Q D ☢▢@P9D1  $|/L0PP @@?P8%P0. P09`P 00x@ ᨙP0 0P @TP T000S ]e0 $Ι̙  .././"/./;/`/y/` ////////00#0 -0 @-fH-(;MP @00|0S0#,,!$<400 S 0S0S0#,,!$<4*S 0#,,!$<4l* 0`:@$0S PD:0S4 G0ٳP |PP0090|@qP lPЩ fP㼩 뤩0`/S M0@S | ʇP    000 0 $9p$@f@@@MPi?PP  P e 0p /R /R .R /QQ .Q /QQW 0w/S   0 R 0 /S P70,P700Sᱢ@` Z40 P /00X /㑆@P\7圀 0尀 @q CP X  /R @0p p0 @ @ ,P X 6 lRʴ60|`J] /S? =S P# 0"" P0S0 3 ` |P2P+r P T0P" K !0 М 0-\P R  H300S%P20@ @ @ Pp=1@PY RV 0S> \1 X200 , R*X8 l`P P#0P}  ڮP} p0LSH"H"0 0P 0 0PGs 00 00  a႗ F= c ȅP0S0/S $m|KcEP.XpP0x`  ȖP`V$K%0, 0 0/Sb<P T0 0P00  05<0Z 40Z 60|32@0'-E0.L0Z5% T0]0i0o0w000009-!.0` x000A-xM`pl`X3@P340L30H3 $00%8H#(3(#( 00p00400h0 0l0000 t0@` tQ ! ppP@0V`@ 00B S 0a0CS dr@P R D2  @@1$0A@0B0C hpq@ `l$ |)㷰 )100 P S R P1:P.# P͝X d0s d:ApD弛d`09W到1W @@ 㜕0 @0噭  Ix@0X0$ ;`P00 0ѮpP ^TI4ܕxЍ03Z0011D-  t 0O-StMP -R aR0S4 P P 0S [ 0P-S@`*@ UP0@  FQ@d$C0 @ $C 0p0SkPE@@c3`f`` >  S p/BP   000H6Pd4 0+S 0S   >S0 00# P ! \ 8@   2pႜ(0L000 2H圜0d0 d d`=P pWP0 $:P0 0A \ aL^WL P :QQ "P0  p Z APPP l*P0 a ᄸ p Z6& $ 1 W  㼰 0p0 000 :R08#8p RS 0W-S @ @ 02 002` \0`VtЍL ;3  ( $3E3Q3)3X3pk3&v30 5<p@-P@ᮛp@0 -$M  $Ѝ8@-P@P ؙ8z48@-P@P ̙84-$M  $Ѝ"p@-@ 4P  ` @ `p!'@- M@ ⨓   Ѝ$p@-MP `@᠓00`W㤚D`Qp hPP00_S Pᐙ ژ80000S 3Ѝp4F4h2E-@dM)` P8 D岝CsP0Sp2  KP0 3M1 0 =PpW0 19  + pPx0Q UP `L0S0 S(XeP ( 71P/SP*OP N!0SP00@p❚ P xP X-00'x dЍ4 444 52"O- LM@?2p}20 @  QU)`Ț㆛@T` `yvP3  F` P ጘ9  (`$ kPM t(aPH d th00( dP<)9 Z73᨜8   HP >P)0SWkX nP )P  `@T`LЍ5%5д5*5=55J5\55555p 0 0 /6M@-M  @Pڀ0@ KЍ@-  ` P @000 0A Ѝp@- @ӑ00@x8@-0@ 90T0?P ᱗8@- M H D @P 1$ p# Ѝ60@-$M P L @P P04 0 0Pա $Ѝ006F60@-$M P L @P P04 0 0Pա $Ѝ0G^6Hq6@-(M (0  #0 , 0 @P$P(ЍF6@-(M  G0 0 @t p pP . RDR R 0 Q0S(Ѝ6@-0P(0S 3/p@,`0p0p@ 0(00pTp@|0(0x]p@h0(0dp@T0(0P4p@p<0(08(6;6t;6:(H<6:6d1G-\1AM@MP+@0 `PE0 SD S 巖V X XV:00C8S)X+ p H0S BR  ᘐ ŐP0S000000cpXڰ RR000`cPVʮЍۍ6700@-P$M0S ` \ @P00 1 041ᯚ, ( Z83P%$Ѝ0-7G7X7@- 000 0( 8@-0P0S00@@'0$03/p@00@0@t@$ X0RPnT  4   @8<r777|00@-@PM 0`M0000 P 0000@$= 00Ѝ077O-,LMP\4@00000004040404$ 00 00000 0 00 0~0/0`lh4d P 8LЍP8P  0iS aS eS pS wS mS 333333$094 㕗S N D3 ]\3  PP>LL嬙X P4 p30S pp >XP 2"Q0S ᆙ&60#W00S  #P0@02 0$0 p pPd2 R R RD2   hQ d X @ ~8P 0S TX 4 P0IY !S90S pX7  W L &UY P YPPPUPU eP PW PUPWPU  嶱 就00S <]&z7778878<;t;:H<:N8( D 3d8z`{88` 8776y/P/8@-P@x}P`8A-`Pt pP \ P@Z9& 0 ᄁP@0T8@-@`uP p D}P0=S @TA-P@U`p Zpb PPE-\M@p( ( ( P0PT0[V %V@ \V ]V# T `0`ST  %'0` U[S TP X 1 0X PT,0`]S00U0S X0PE!X0S0 T0`UT P@|`P!T d LP  |P ؓϓ ݍ  T+\ |P'L 0P! PP P "<<!4,40   0@SP @ᰍ TGX 0E1 X `@`VdU `Vt t0T0 妬 T`V 0S 8/PᚬU``\Ѝ迗ǰ'883''0 &8p@-P@ ( `Pp880  8p@-P@ < `, `Pp9@9z90 9p@-P@ P `@ `0 ` Pp98:z9p@-P@ ( `Pp1:8p@-P@ ( `PpK:8p@-P@$ Pp p@o::0 ;p@-P@ ( `Pp1:8p@-P@ <x `,s `nPp;@9;0 a1<0 [E<0 UX<0 O<p@-P@ ,G`$喹Z:% Pp<8@-Pt0@S@ ({0S00f8@-0M0(0   0 뵔|p@ P x6,喌 唌($ⶳ2(凌$兌,ǒ ƒ 00Ѝ7@-0L0ƒ@P 8z00UPPe>%=@-R@-S_0a C R 0C00 C  R a B R_S00=S SgG-Xq@`VP PP`:P0冡熑 ݋P ؋P ӋP ΋P  `0V 0`x 0p`  \P@@ R(4pw986===G=P=J=V=.!@-0 0 f00먋p P \0X00L 0{1 @0 ЍpE A-`P@ 0q^PP@0T刓A^=0@-0l@3/PTELP 0043/P $PG36=Sw90@-0l@3/PT LP 0043/P $PGW8S==O-0LMD0H@L90$H @9@)<9009uQ  $ 9001S9 0 0@  + P `@a0$0  Hp(EP 0#S P ` ` ; ẓ 4)P0$  0S 圊P` P 4倐4Z;0[匓Y P   xP `7 XX ` <  b P ` V ` `[ 00 I0P0S  Y ] |6P  +P X 3H4PnY Y? f400Sb P P  P P 0 PE 0X 0S   04刁000* ,ډP0S4Pے ̉P0SՒ49Ē000  ɨ 5pP nqP l8 "c40 0D0p 0D坒D0=0D0PwP0030L` d3QPPᗓ 3 RT30`M N 0  8P@20 < je\, 0000 !ze0Z0b ( (0 ,P 8@00 P:0P 0C0SS:,b0X`V`   PP03/p0  %pPpXP10 9[010  p6 102<k0 R8H 80SP< 80P<8ۧM&>+>N>w986===k>R>R>>> Z<* >%}?D?J=%=P/$0" 0 /8p$ H0@0 0@00S@/p@0 占P/8@-@rp n8l<jHhLfPPPbU@8@- B6 0 |@QP  00S R+0SR 8K  6P p??P0@-0`0"@H0 R0P0 $ @ P0QP00@8p@-@ᖢuro @3 30, R/ <, -pP8@-@nP PPP$P@8@-008@-P@ ជP ᆍ@0T8?x0@-@0s 2S40S0S D@T00S 4:p?0s@-P`|P ڈ0@0SD@0,B$\LQ<L ᕑ00TT`|p @@pH-MH00`  MP@0l @00訟P740K#U@ 0c(K@000 AKp/@@-@40#fU  rc/@@- . 00#,,!$<~pH-MH0d0`  MP@0D @00_P K !@000Kp@-@ !M-XMH0hK0  MP@0J @005P(`@0SdH0D0D@phKpaGWH  ឆ`H g⚆D0@ 0SD0<0D0 0 0K 00K@00 hKJ 0㹟KpA-`PM@0S4 0t@L0 0M0@PpPdGUH  j4H ef@ @0TJ @#pZ=?@-@ ŐP@-@ 庐 P H-Mp @ሏH00  M`@0*@0PPᮞ P@000TeK0@-0,M$0@$ ,P P1$#48$ #8YP $001<$#48#80PP0U,Ѝ07@C@A-@ YPP,A؋ 0S% H100S2S 8嶔P 0SH$}H0 叝P0H `pϝp2SH3H0 yP H坋A2S0ҝP)p`@D9G-@Y0M<pϤ, 徎<8P 24BP807 ( D0S@8(8Pᱤ8P`:uP 00ᔎ`0SX<囤0<0<凎ᄎX808 嘏ሤ:800 0 o `aP0!0J 0!06 P00 0!0-tP(/hsP| 䀀( oPl`|0-S  |_P0P|0`0S !P0$0P0$0Z600$0S `(0,0.*sP|  |4\60,0S0nS00o0S0S`0PPw.8`sP:sP 00<Lل`P܄P`T 00CS  sP `VC2 S00R@;껍LP ` V2S$0SS($0S& $ `g埍 囍 8嘍8<啍<L咍LZ><P反YP00䆍D0D0D`,sP4`lP gP bP DX l'000 Y0D0 e/tQ0S }00000S$00,08 ,0808 < 80<0< L <0L0L L0 0PPQPP 0t60P(0;l Y <0S 0S P#c000s0sY V4)0 0S0P1#P) l  O <P :긐0*S0S P ") (!"(TP 0܍HQ 0RpP &EH形0H0 ᷢ0sDᯢ@X !8tP(0SDPD00"0S 2S0Ꭲ@Tt 00pЍpl@?AJ@@@ J)J@H @@@Ap@-@T@ 0 00@840M*,(0P040$80 ( 8(801Sǟ4040PSˆ  7 P7 '00Sz*!s.51Pǟ SR @ 0 @ Pڂゝ| 707070VPPP P^(60$0` 0S0 0$   P(Ɵ 00SƟ 0$0 @ P0QPn%,@ ~5 0 -PX$0S g;  rH 0"! 0 R3?  AZ?) Q52S  P $0S' :"00 QP 㪛P @0$儚 X H0 P呂  O @0S "R@0S= , R$ 000S00׍ 4S:э 400c<S J  c 000005 000 @0S +.Pև㪰@ @ 0@`V $ tq 夊T 0-2 2S @00 @0 03/T - r 0 B0@P@Pm 偙֠ 8t@P L8H" 0<P [P  <"̋P00S  S ‹F0S <0S 0 0" <0S @岉, ! QP 4/PhE+ 0P@P D@T Yu PLȨ 0L! 2S  @0w' D  0RSj 0SBEp+AAA;AдHA(?x}$kcLc8zsjAzAAA?d0p@-P\0 `@, 0s 0s 0S D@T`pp  Q 00S/ 00@  R/A0@S7@/@-`0@0PrW :PPP'r  pWL0 0 @p0P:S@0P0U0S  Q 00S/ 00@-0 '0C@ T a0LSWL0  0@CP U @aPDUW@D :SS,  T0 0 0S Z@0 :S0SR\ 0p@-`PpPP 0@Tp p@-`P_PP 0@Tp 0p@-`@MP @TF㙉Pć4 T @00S0@PPPpxps@-  sPP@ M@5t p0`ẇP@ 0MS `@ @0T@J|A Bp2G- MRp@P  HH劆PP@8@ h hoP`eo`P`_̅0:SS 0C0SS :S @aTʎ  80828]p 㠠@ 0000000 0000000000 00$0<(00,00000400 0fV V 0++00000W0 yP 8@ hP2g@P (60 @ XߍhjpB G-`@ M H pP ц N'P20P" 11 |⼆  L 5'P ~11 ᩆ00 $'(p P00 ᛆ0 0 ' P0 0~ ዆ 'P0 ဆ0$0 t&8pP0$0 s0 1~4 &P50x0Hp ^  ~ & PXp N ~ &h@P0 > ~x & pP0~Po @ʈ Ѝ B'!pB1BA-|M0@Ph`pQP [ `ZA %[05V1f{@T  P ZЍA^B@-`@p0S1㊇@0@`P ,@ZTP0`00F0d{B00C8s/Bp@-8@P`[00C8spp|B ~p@-<@P`F00C8sp ptBO-@MPPPaWpPSp D  Z0S|   \ R|3/| Z1  l44 hZ1  TY .x0S# 08p3/ Y1 0H3/Y1 0X3/Y0h3/YSP@Z 6D}P180< pp0 40 xP Z  㪏 09T 4Y0Y00 S  S S  @S S XHP0800000 004 0# 0<  $0 p@ 40 (ptdp@VhsY1SXnYPRpL2 1 <cYS}p0S R VY ㆅ0S9 1!VV``IY0000000 0*>YV 9Yx7Y0000100 0x*,Yp)YV `$Y$q LYHY @!n 8!k20S(0S00( Y2Q YQY(Q , X3Q X ' %Ѝ R BB BBBBBBBC ClP   9 pP3 `0wP3`)iP3Y"fP3neP7xs0S30cẂP3 000 0S #0#P20pSp0Z0SPh W U0u03UPPU o|Q Z$W1 j 奀 ᥐP4[ RWy AP  0S  Q  R yP 9㭓5y㢁㗁㔁 0RS 0 0S"!0c " 000 P x @ 0@#P~P>"!!0R3  T`PKPؑP L5 R 80T@P JдFHRHzspZD @-~e@-@4001 0SP\%SA-@M- 0p00C S%}P ` qX?`bH?}}XP}0!D `@`YWV ߍ)YHPs@-Pᝁ@P<  @g P:}00]S`  fP ,}000S` `'V<l0 0 1@0 R @0SK `b|\HeHA-`pPP@ T 7/P 4 @PANQmHs@-P42@00$20 W0P000000000  %Q%-k 1a0a  0 0!1  "P0SP00PP0p \S0 RL DDS<?p?G-Pp` 10@P Z  0&  0P  0 & 0&d0 'X@Z  0 " 00@@-@` 0P 0P@-@` 0P 0P80@-0I@0@ODᚔ0D0 #0@-lMPQ$@ P  @0\  @0P yЍ0\LC-1M@(Q8 0 040S V}A e{pMP _{`GI0 #W{P? 0P{8 PPPL#! "ЍhLLzLLLLLL@-P`p<@| 0H H01 <(<"4 $<(<"4LD@A@-p` Hb 0 008# 4$D@0܀@7@-0#4 <0@#4 P4 0  0 Ѝ0@s@- , 0`,!$<&<(<"4@ PZG  0 0b|AO-`5 \M 80DP 2 UM0 @PM ,pp CFP#B$4K|PK$#KK %KK%&KK0 C% K 4#K$%K"&KKKp$p4 0K&KKI8$84 04  0KSP ZpPP  3v `p0  lP0# 1 !*\ 0Q:K0E@   Q# 1 !*\ 0C@S0RKK"KPp@`pZ`F~ #K#KPK"KP 02Y!RP@pZT`  h2tTEP`&Ur $KP K 0@"K2${@ 0c 0KtTKU $KP KKPU@ 0K$KKP @F ˆ0L PLZ:T0S  Q S  R:T KP00< "K`Klx %"Kp<!K0P  p!PK`P"KK\ "Kp!{Gz??iUMu>?@7@- @P8 80 0 "000 Ѝ0ư>OuAA-P.`P lvh1@0A0X1 `"D4004(0t`,pt Z&z{P\00$0 1 !1 80080 0SPC0P000 {0M000 L0ȉ  600L" I| LL(  1O-@lMZH 0^$py00 D @00DP0P` Pd100 SN TIv " @<zwBD L0 $PP0.pA0S@ ԕ 8PQ%0  $ I0P&00'0 ID0& 0AL0!;400<0@W R<000$0H 0 01 /lЍ7LpC-`MT`@PT 0X!1 0 'T 0  0XpuT0`0 0>`P 0v>0 y0`, 0X 0 0 0`Ѝpư>.AM M%M@-@H@&3O-آ@MPH`Lp  &P10 5ЁP* H0S S0H0  0 ` 2P c200@L00I0 0A0 0  0HI0SD0S0LI0 0"%1 L2y82P 0   2  0NHP 1@@ ӕ 0zf 0s0A 0R A0 0Ѐ0@00<0# "  D!D1%  0 ,!,1إp`+ P a q 0 0   n10 000,0@0@ , ,0 0,0I00C00Pxt <R0 40B(SP  H%xЍ`@FMp??LiUMu>{Gz?.AKMTMO-M@DD @0҆phnt`400p CeSRdS oS cS SP1uDP0P xH1ZI \ RL1` RD 0S E0S SP x 0HLP00d0Тl0X3`PVЀ ``a`FBnAnA`BpG' 0 `(  0#  0  2 0  #  0  딒 0EPP 0`  0P0 42 pG'0S0 A!0S   40S10 0F&000000 x/e`P( t10F6HpL` aT1P!X8  01  0P L00$SL0'I0L S0I0ŕ!L I0#"$rL  S0L0I0S0CI0,` p0SI04  0{ `VPm00ЍMMM?p??M?@O-M @p MmP3xX@@vvX0 0`P0s 0 2 P= Lpj@"yPQ p@0 0S00d00ⴠ 0 +uZ00  \2[K^H\L 1 0   0pam00040S 5w Pm00 0'w >!! P! 0S!1A0P0pW" T0S@i0  3v/#pWH0S( $  0 P '}P0s@ 0S pG,@ㄑ 0S pG@WT:00PU< x @ ANRNN@N@-@Pp;#;1hh00ZJ000L`\tP r0S 8 R R*+80S @  R@ :H  0p00P$:  1\Qc Z8嶐l~ 4)48#8 VQ Q@0@ !<mt0S  R: KpO<z' OOHA@-D4FF,CF$@F Q ;FQ 0d0c/F(Pu$ 0  0 ,`p:P2*\ 0 F0S 8 R  S*㊐pOP(P?PPPcP@-lA08 0 (0 T1< P! M800<000`0P 0[` @ 0sPp=p 0 0   D8 0SP 0R0 0VD HhE P LLEHE0 SFpPPдPMP O-20/00=0N? 0O?0Q?0>0t M?zO P@` POPJ@m@0TS(V0pR `0BQR?p`:00GJVD1 `@  ?z V$@ 410| 0fD>(`@10<10810> 0 >8-D.SߍRuRR2RRR6CRA-@M` hPPt g/VPP  PtP0 @H g|0U00L00TD0@7t,0P! @RX11L 0PD#PL0tPHm|0,L00L0T P P 0 S0@j0pW  oTPpP T eg oL0H od0P0V ,,0,,0oЍ( RdT E33 R RA-pMp0l#Px00Sp T 6g0/0vU@P4c  20`30#,,!$<4400`3 P+T/00WPp0@  2!404bP[P4 RU``_P$l0`HP4B  L404P: P4@0@)4T,P40!4X!P4<4 HEdP R P P 0 S00P0i00S4  P0S0P040S #(",       p/lU4040 nU <<0<<0%npЍT( ZM RdT RN S/S@S R RA-PMm1X@B|MP0000000 0000000000 00( 0cM P PMP:k x>0h` !0 x0f060 l0%0 l0p`8zx   0h6B75X(00H 0< 0&BЍcSsSSSSSRT1TBT0@-MP eP eP#00@T @ PeP eP@0 01S 0 GO\\P 0Sh JЍ0TTYT_T$CдR@-(0 |ZP pkpUP- DMt0@p8m`< P@`eYYP@&P$pU#TO-dM` 20"T0p0P0pl2 1S@hXP4`PXD V` PPP/ QP jp>nXYPk!1 pl< d   e@>K> !0#P0 .YKY($Y.YY p@Y%Y L`T`P` 00"0lPL 0lP[ dЍ剓\ P\0@ } T屘3UUдT+U4U$pjx>U$TtHU#TU&QUQT@-0 R/ np^U@-0 l 00@ƇkUp0 @-l 00@踇J=pE-0M0@00 007'0ZN  p7' 000000 00000\7P \0( i ǟ0 R :R g0L0cdTL&(0 RƟ0` O6P1!H R 0R0S61tWppW`6$pph~`` ~$Ɵ0S  $ 46HR $!$0 S0l, 0,@@ Dk$ R ,k,k,V llLş0S DV@ \ 0 nHn850P000 0R*,P@`$@LPpdT\`|` \ K{0|`0000 0`Z0S d4T`piT Sl#0S `U3 4lß0P 4奂X T @06|T,P@`$@LPp0 mk,w$`@ ,,D@ \k,cp@h2iP # 00 00S 0ŸS@2@lh00P@Uk@T( @1Ÿ0S`4(Lp `P8p4Pm4 8 $0S |  {`TP <\ P<@hpP@0S >!0S` 4 !m(0 18< 40m( @3$0Sa |0`0P 0zP`L6@a@04 (4 (  < 8 P iH `́ˁɁǁXk b}rH0HhpsUUд)\N()J JUU7RHUU#VVZO:VBV>VQVWVaVlVvVV]!$0@-0@S lKpV7@-0S & 0S0C 00S  0<C4T   ,,R@@ 0 8wlA(@PP0S >VyVVpd0p@-\0@0 `PVM,0 000p0@ S:p耵E-@P`p `00P bP`p800W:x` V00!A 脵@-@Rk 00@脵0  /p@-@ ub00p40p@-0@}SPp@p 0S/V/Vp 0S/G/VpX0@-   R  44=@R  =@pWVV@@-HH1@-0S 4r $b DbP40eS0 cS .lS zS" )0 R%0    00S 0     t 4 a00S 0 VpkW@-0M SQLQ L Q̍ A@0PR  a܍G-UM `Xh=G@ UP 00VυVT88% ,$5 1aV PP PPU #di004 z{000P10  P40S &h0S P kPo1S $ jpP# 9aPȃ`0SQ00P CRQ00PQ0  P Q ZP& :Qĕ0Q5 Q Q! SQ4 'Q- N0SQ S   SS 0S " 0x `0  RR 0#0* 00S$"Z0wSJ@><)9 7*4 20.l0S Sf7cSF Q0F Q `0P P#'Q*`0P'ZP000PQ 00`V"0S 0S 0S00U p@ E`0p0д{W Jt W0p@-@pM hX! 0 P 0 0%g g00 d1x0@gTg@ 4 @$! 0T @ kg_@P~ _:e003 @0" XP+ _Zhhh됍`TS(00(0 0;0 00<:0zf40$ hhl@娆pЍppt W 8@- @P0 ̅S00  0S00^_\_/~0 00 Q  0Q S8pO-0SM H@180 808O?0=0Q?00@ v0 @S 7 d,7 Y /P    <@ fGf yy0sy 0 # 0$Rύ!00S0, 0S60Pse/0S Rύ"!d&SZQ3 R21 " (0S Rύ"!&S R21 " PY R/ 1   0 R $0  0SD!814!M? 0 0, 0q PG YRύ10    uPPeP00k^P &0 00Rύ"!!0R3k 0,~j Z p`70 R S#3 RQ `* 0 SS`% S%* R` R0  ` S*R0S0 S* 04,2 04R/1b `` V:Vh 000g00jppfp ] QiP<300 S 00`003P00 R?"!!0 R3E $p(0偎~~g pWp`W% 0S   "iP`pG KPPhP  iP`pe P PV` ` PV200 S g(00f(0$0`1$`V0$00S00"(0Rύ!S  0$00R3# 0~.a~>c 0 ,R gP> D100 S 80 0+0S0@0000P00R"! 0R3! (0~.a~>c 0 R YgP 000 S (00(0 0X0 P0 0 PU PSߍpmWWW(tTW@-P$0 R   0Sp8@- P@b80000S0P0SP8f8rXE-pP@`0S `VZMPpW`@f*X@0p00@-@MP0/ 80TZR0T|0H0S 0 S 3 405 : >I Et,y; 00PЍ0pO-M@ p$0P`we te BdLQ 0 1d 6 R R$P ĸ60 &P  (  R x&S P T00\yV T00=,&LPP`P`c -R0 00S d 5$0\ P:fPN$(J(0 }J TVPPP`PLU 0I00j,S  T(00 T 4_J $%08V6 SJ 08 &  & 8&# $Q  D(4"< `0(0hX40&h  ePPP`P 4 b+40402 P,00 00,04 Nc$0S F #?[00 S00 fP P P0  R0 P Pre?0}S}>0 R,00 0ps@P,  re@PTڰ0#0 $+#48[#8T P 0 S 00HZX"T ᴷ H -ee R5 [-00C 08@ PP @P 9$ R #  "P A` 0 vH10`-p 0d 0偟\! [Q S0@ PC  d P MI 0 PP [  R I  F("SBZ@ P P%1IP0S d4@00Z000 dbЍZS% pAXXXX7X,:` WXXt %_O-MPE@P]c0!01ူ10P nb000000,0e10 @RV*a ' RQt#tx'x0GSJ*0.SJ *PIPE*6Z(+Z:* %ZP5jX  YP =PP00Ƶ,\W  IP W\x0  \`0  :Z h 0PЍ\LH\D{HYдpYXXX YYtA-0M0001 0,1,! 0@0 0Z 1 `P pP@40X0 S/7IP0S !1R\E 8+ 082  p2@T 0-S0S  ЍX+Y:Yд)JpX0000 S P0@0 S?$0/P/0/d CY O-PGM@"pAb,>(>100>. A?0<000> 0000000C?B/Ѿ=P,    0   0   \=0 0D0 !D P4    -<09@0 ,@( 0 (<(`  @ T&P  )  T: `a`)1 H<`q) 0<`q `wa 00 ;q T` ;`qP  ` `Va\;` 0`qP` v^, R  E?`qP4 ZT?[  ;q a:`岆T000l  Z  T` 00 0qP ], T. G`V@  :A`0 1#!`P  yX@ ` `@wN`E`d9a@ /4Z x *40 h &4`p_a  W0Va0LRa@? \P dP04T0(4 @0H<8@0#Q00S \7`cP8( 0  p` R 0# <'<<!440 p0  7P00 S0 ) pP ` pP]1 `0(4"<!`F0  0i_P  \|;cX0Sa 00Q R $70@o k  3h peP R1!!R S SS QQ(Ƞ,!P SNHH& @8 $0Ok`Kk$0@$00 000B3P@ ;3@PT p RW W%00,Q080Q0#  ,<0P0# < Q W,@ pP?$PU 850@ P @0 iTl @0` iPgp  I0002P2 _x20S0 S _P@ U _,@ pH0S L  uVP9 j30` 20S[ _P 2 uut30@ 4G40 SZU* 2(I0 I` P2u L GV H X0``a' }2t2`0 Sd  q2un E Q> Q6 Q. Q) =Q* Q 8Qx3Qp0&Q*  Q# Q@Ll  Q Q ! Q  Q? 0S; <2080832/ H%2"2@,@0P`P 0+/uaP,400 @00,0 Pe8< 0 < <D Q8 '^[ T D0AT(  ( (00SGߍ,@ p1PYWYд| Q6t  tYYYOYYMYYYZ$Z;Z`ZZZ(zBcZZZSZZZZZZZZZZZZ[86@-1DM@ <010"|1|40<0`0P @SU@1<2\8o^$ 0p,]` 0%] ޾0 0ױ0`P ]P` 4ձ` 0] 0]  / h TQ1`N1u PI1 y]DЍ[[ \\T@T@#\9\T@T@` =\S\8@-@P00SPXwEPD8P@-pDM` P^8 T@00 PW 1XS0$0o\PU  $ Ul $U  $  \00$ 0\DЍ\\\\r\00 R /@-~/PZ,]8@-@PT 0P 18v"p@-@]X PqC`PDDP %PP` ZV) $ bCP  P0P0 Z`/B?PBU PUP#BU PUP00 P0/S00 F f#T00C000EPP@CP0P0pI-] J]i,]` O-0p0P`]@0P СЀVU0H0S 0 S 3 405: @ 7= 0!u( 00`p<1@-P P@ \0 0 0;l <P\YTCP00000C Sp` W00p` $.]p@-@ Pd<PF 0 0 R R =ACQ 00000C Q aAQ-S .S :S 1YP00Y`P0 SS SS 00H0S 0 S405:?; Pp`p]@-T0`P@:00 <pP';P 0S 1E-0MPxA00SAO40S ` VV1l p:00 0<`Vp :P 0S paW:P X  [! 0!40S R0 00S   w ` 0  040,00ߍp O-FM Ml*T$h*P$d*@`\*0Xd4\40 0E.E> 0 0E.F> 0E.F> 0b\TU P` pRPUp[pPE   /P\4S p9P0B,T TpRP 8`9`)Pr0P 0S C @Tp440H4[pDZW<0D0[S%@PP ]@P 0S:S( XX0d/SS8X4P XWXX4 -R0S` XWLX XP00 0Z$DH 7D$@0l.MqW84SxW@ (48ĝ07\' 04V. ($P.|0$P4K.,Q eX B.W @Q Z0 7.  1. 0S t; B ` Q0[ 0s3S!S &S'S (S)S *S-S .S=S _S~S 0C \ aL\Q0 @D;Q40 -p % Ɵ#000 ,;늏 K:Pe WWuPy dP Pt P P K?@S jP aD-?@00P:0P S S ApW V 0R 400S 4p5W!P |04000KZW!$0 p0S$0LV*040000/S>Z(BY04D444H4?pXP,4S"Z,`(p0@ P Lx,:"?( pP00T,0P @3P8 0P (.(p 0( 0P :V 0R 200S 040(p 0P (p lF)@@(p,P009@P  ,-@P   !!   ,0  1PZX< R0 (P( 0Pd LV[D1DXdY  XX ) ?bP UlЍۍ6 ^!]^^Gд'^2^<^p,G^?NJ^f^z^^^^^^_ (_@_)`Z_w___%__K__,__,_,^`,A`@-Bq  P*00, !$<O-DMP*`Ġ@ O0  2O O <"p  22&@'pO  4 0O  : O00 0WDЍpRp@-@ c`pWlP 07PP8 U400PPe 0Yp\`G-M@PH rO5% D0 * %W@Xp4  4   7cP 0#,,!$<4#8$8S T|4|``FA00WX P < ,?W V4 V" O Op0S"W箸pp0x0070740SRpW4Z4 xZP PA W񟗷E$FLFHF<0S 0 <04/p440 @0}>40p@0S0 @0}>40 0D00840 04008040S ڇZ㑨(X0C40EJ47  XD0Sh  cL* XPT%|1R| Z  ZwL gNPh `NP Z L& WNP , QNPWZY) )HHHXHHN 800 S80040p^040<0@0@X> 0 40p_6X4  pDpEBp4p0 0#P0S RH!00R00S 0S+V X0P J 0 0 c0R@13/P  JIZ[  :U  4Gߍzs@-@% -R%0-S0S@ WP0   P QOdcPT@L0 H0 @0SZZ*  0 (0R\   ``` iO-eMF/@FL00 5.54P0$0 Pp`'P񟗉PPTQTQQPRRRR @Q{ Z$ Y.$0eSd1$0 Z?F,6%0| @Qb X 0+S0Sm -S0Sf $ |$0SP1$0Q10F U?QV @Q< 0S$ d$0FSP1$0Q10 U?qQ =0Q1 @! cP k1'0P,` @V(p @W KF 0K0 @SVY <$ ^$0Sx1$0y10F _?1y@QVV<<UW K :P  /Q Y Z R 0S ^Yύ00y10F _?%0 S7%0@R@?2 $0S l QY΍0P0 T1 x ̠!̌0,44!̠̌.Č0 bQT1Q10F U?U T x1Sy1S |1S0 0'0KO0 (PeߍiaMa3RaZaA `afaa@-0@ PPpa0A-0C8SM` XJS@$0S  R40S 0 pT J 0.QUP 2SS qP0Sl& d & `V `VD `0&H``&p<R@ 2P &V &&0S &$Q &40S `T&,0S  Z[?c`P`p VJQL H1RPJJpQ &2SS+1`P` r&P @0 A00030S 0\&@0 A0`0l03 RЍpaaaaaM{c 0sa b bbB!b/b7bFbMb@-`0yM C(R*QZ5TaD R S} I00C F1PS111S11$0S  S 0  "00  "00S Q qP<0S 1S | I01  BIh#P0S%  0   0RP P0PPP rI0 00   0P 80PbP0S%00S @] %Qx Ql%d%Q  <@22qW p (IPu% < k%Q  <`%Q  <U%O%0 00hH%0@ @00PA%0  008:% 0R00ŵ2%Q -%P 02AT! 0PQQ \r7X%@\tI7H H%x% 1QyߍSbpafbmbwbb9gbbbbbbbbbbcc(c=cO-U5MM`P pLHH0,020pS4@0(0XS 0SAN2SJ `" 09 0Z\% P  HP 0D>D> 00400 `S 0 0 `SW p`pQlTL3 -9-T W $X 00< 00Ѕ0\  8 80S PQ l 9- pز[[9 0^bHnVP 0RP(0S S(>,><0S ,>S  G,00  BG T#( P0S 0Q  ^P `V2pW[Ln$[P2SpH^0S0S0 R ( R 0,B S uPU`Vߍۍ00pi GcMccZajdY@-Q@ X'PLMP@ P@P @chc@-pP@P `G0@T` @-Lc@- `P {`P  @!O 0  YiO-QM Dӣ`P<4<   Pp@Q PP@ PP@ P`V9 P1P Q2 0s qw/P Q# |嶣Pt JJZ!P Q D娣P<@@PPY  P0SPW 6pXWHLYH  Nh  F )N 2;N0 0rF 0*x * * }N0 " t^눠 Z]0F0尻  0WF M[ ḹ 0PmP   KV eFP HMMh d1pMF`0s (p  FM 8   1MFY  0pMvFU pM 0`M!1 $ X%X0@P 0QMWF ЍodP d3c3D$j `a3H*d#Jd"Vd$ad&v3@-@ E08;p@-0@ PK pa0E- PCQoM"~FQ SxRZQK0` S S ppR R  a  ^R RY RV RS ROpx R SH QDʌ R S?(RR9 R S4 Q0ʴ R S+;S S%R@ CE0  x0S gt'P0S 8SgH P0S b(*P0S ;Sb P0S1 1 S0S`1S 0s 0   0R9P J `0``` D0 00   0` 0`b `0S!P (0SB  !L1S Q  <9   <2Q   P1S Q  < L <8Q , \Q 6S  < X1S D r   dQ 5S  < `1S  0 S:xQ0UP U2 0SZ^3)H1H `V" 4qQ(KP m/>+P1!R10p0S~o0r  Q m T1S < r % b  Loߍ萲HepSb$Gcase8geenezeeeieeeee@Be eE-JMM#@ C*0 0|3J.p3h3P00p`KLܠP0r|rrrrrr=Q#   0S404S 0  I>h +80P$`VpW$0<$00Se  0S404S 0 , I>B 8@0Q0S V FN@ M @W@0V0  S O  0 ; T F  0 2 0 @SF0 0A POXG UE ,1J0S,XZ IB@ PC0  D4S  0N2C1004SHW84Sp<4SV44S`\0J P0 F  P  jЍۍrpifef"f/f4G-9MT`@70Z0 0SH֟P<Q 00 P t Pd-<<>0x0ISXYpWmaYQ\ *YQU 壟P P0 PW   P c <>Y00GYQ7 l兟 PQ0 ` 7 PQ' @ P0S $ ß YQ c YQ  YQ  Y0S%  Ÿ00@pQdVZ_& `V``L @y  @X@0W0 S  0<08T  0D0@Z1 0s V NK@P  BPʨ!HBVS 000 0<0< 00L @   H0S< MP 80s    ) ^@  pA  A <#09- 09 (> 0(>,>0<$0 0 @`IPhG L I9ݍip Kfe+U&$d\fjvfE-VMMP@8$A00(4V.PP0CⳠ4Bn0000Z0`0 000000P0 0 pnPQ}    0SH50I50` PQj    0PSH50I50 xPQV ZP0SO   0eP Q@ U  P\50PUP Q0 U S P X \50E0@SpW? P P   01P0S 000C S U  P0S \5P0     0,SH5040I5PS 0 0= 0@QVRN@ W  00SX  0[00C0 0l0S S0 SS S SZ0 000RS0 0PYߍۍid3+U&36@-Q@ t P'`llx@y@i  #F@fhcX0p@-`Z`% @V`T(M Px" R (Ѝpi\A-`M V@XCJ}@ P8@0 0S S``X1S ,e$b `H1S Q  <  Q < 1)Q EB rHD1S Q  gFgRgZgegpg{g@-FMMPx#@?hh3F U\#PG>00@00`,I0 3  ESQ }p p 40I40 SQ| }p ] +4x0I4 00{ @R Pf \ 4 0S QZ E KP_\40_S PK   0RSQ> E PC| \4 @R Q, E Pp1\40`0 @P pW ? 0 CR P  0 0S0S S.BE P p \40@QN0S00V U00BN@ PdЍۍigP ggg$Ѝ0hE-@lMPZa04 Z> 0p0@0 0 0Tp 00 0@02BP&Q ;0@S)0SS00@S)0/SS /0)0@P)0)SS HH)048CP`V 1 011. 01Z,P   <<("4 P`V 1 01.>,P <<("4  P`V 1 01.',P   <<("4  P101 P10 P10 P101101P101|P P0 P@02rP QJ 0嚚Pi 0eP Q= 博P\ ,XPQ0 T4EPPQ( xPG + P(>0@SQ \eP dP Xd00!0'P0S Z D2WX 4 H=  `P d00pPQ)0S =P/0 l =P0 T =P)0)0)0S)S1 1  2T0S 4`TD E0 PDg=D000S00,"R01 010S00,"R01 0100<2S,0SPBlЍjh!hFh RhWh\h`hg[rhvhh{hH*3h00@-P$MP@0S  aD @D40 U(0( $0@iD=$Ѝ0hh@-@8M 3,0S 2ST -0)S /S S4 ($ 8Ѝ6Bhiii"i@- MR0@  D @D  0@$D<Zb3 ЍQi@-@M0B/<, </@0rO/@0mO)0S0" /S(" $)S " 00,S2B?Qk0S  2BD_ 1`Cp<W mEPP PQ[(Q IxF!0S hA!0 X<!0 /P PW ,02@+1    P 0  R 1  1 0 1 01 t0|1 X0dߍrh_idihiiiiiiiiiiiiij@j`jA-x-M@pXBPP 4` [$ W$:)P 0o0 "P E{?0 =0?0? 0?0?0+>0?0? 0?$0*>(0?,0/?"PU0S };PMoB gC @@1pC;X,7!S S E/S-o4 .;P#0S D"R0S E;P00S d"R,0S `"R 0S L"R uC4p #Pr-ލpj%_}jj'` j0@-QdX[ ,> 4Ѝkkk,lA-pM.@&PP'  k PPX 8:&d `P00P0S8BV0 P@UЍslG-Qp @ RR |0R 0GKVL 0@DP4 0@DP`P` VZd< (z'z80 0S/0S/P/ጵP@- P@-@ <  脡p@-@ M QPP ?0@ 0N`8VP= Ѝp3l8@-PP@,@ P@ 0l8lꐵ0p@-SXMPC0S@`@T 70 0C X0S0 P0S@[A 0 `a R `PU,A00P000Q000   B R 7q&XЍp茵@-P`P@pD00S p7&W` ` Ll@-`pPE@ < PpD A @  0嬭P"xlP0@-0S@@<0800404,04$03 @갵EA|-ll@-,@0S @00@갵m@-,@0S @00@ꨵ+m@-P@0SD@@00<04804003(0(3 @꠵CmJm'RmWmG-@PP` /7P00pX #7Pppp W E<Pp@-P@q0 0p@ꤵp@-P@0 0p@갵p@-P@0 0p@ꨵp@-P@0 0p@꠵P8@-P@ <189,0 0P8  $87P8@-P@ <8=,0 0P8 87C P8@-P@ <84,0 0P8  87P8@-P@ <Ze) 8,,0 0P8  87p@-P@0SpD?<@P00p@ꬵtomp@-P@0 0p@ꬵ@-Pp@/pf$p`P pHP/00 0@80/000S 8P  0007@-P@ג0S) S & @P"S S S S S S  S S   Y0S 0PS>m@- @ P#괪Ī̪Ԫܪl@h@d@`@\@X@T@ P@ L@H@D@@@8mA3Ra3mmmmmm7P P /H>n@-rP`@ !d5P `@@$<(<q"4`LpD 00"@-0 ;Bn@-0 ;on@-0 ;P @-;np@-`P @@5e5P `5P [5P UP0PPP0P$:k#P UUPP IGP0 UUPP  ;GP0000Pp( di@-@M P  0:Ѝn|thRG-@MP!: 45P p4P `4PJ/# pP00z`P30 S0 0W07   ` :000S0P  ^P%0S㲐 "<<!4,4 c  0S0R đ W /0V0 88 0<:Ѝ`n)o( din$R@-@$$ (:$P 0 :nhn$7@-0Zf* @SP  wX00S>7@-0@SP  fX00S>E-Ppi4P``=  @P#4@-޽0  08@f(p8@-0@0S P| x0Ptp尝lPl0@Pr400TH04T8,0 "08FJm5p,p@-|0@0P0CSH ` "H <|( $t0 贵Np`opO-0MX30T3P3C D0 09489<89) 9) ?00?09 090?090?05> 0?$0?(06>,0|9@00/l7>\CHCOP =t H@ <p AD l :H  Qh 30L0 dG `y@08⏥@QP9|8 10 " \#R4HH8P@  08  8  %8}8x7Ϝ@0S   =0 @0@3D(R<D 7@@L 7`0@0p60S< $哜D ͍ = 0 08<8P @ 0S><0@c@8j60S\ضHLH@J@P3ZZp hT  HWXW ,Q@`Xc@P3ZL Tc@5 5 vd50S 0@<VL850S %T5 `V `qL 5h . P$ P' P( $00CZg?S@$,,4@70 00|$0t40S`@ LRa:xߛp40S3 4$/ P") SL p0 @ 80"T`#8080=< 80@bS@ P0<0S D30S < ᦛN Rh(1P 30S h嗛L5xPL9<20SXlXXX0S6LbP#< 1@2 `Pp\ 0S_3LKP <> 1H3#,,!$<42 SH3 0H3 400\ 1@P(C<L\ c10S  v1@@XcWaS_@L8 00S  9`@00 )04#!P ="! 0R3) pP% R 0 R YcPP P0 S0000    GP 4pP p 0S00M0PP ="! 0R3@ 0831>0?0/0FP3 04 P<340PPZi*  PP P!  71>@   p:0  @2.0 0    jG P x+4pW@TpP9 0 0cxS00eM0pPP2qtp2G-@M@@P20$L2L" `7@2@"  4Ǔp<'7 2 p`: 0 v8Ps4 00" #̠,$̌!Č<@ 0##@_TCͱQ  Xx B\!  0`L  0#("<#T  a*W"dY   }<y< 0  @ p00 $ 8$P @Ѝtttt` t(z'z` uuQ"u+uP/00S:/!,8,#$ <$<!4 0@-T@0C-7AH1 04 8 ,4 0P T0X0\0j0##S#    0  $0(0,"<< 4,4#$0 #(#< 0$ 7l0%$0P %(%\ P$@,0X: -LQ D 4@`KpA}A-@P`0@3/T@@pnGP 7/P   6 7/V` h h0啢P T0Zj)  " ,$ " ,$ kup@- @100p38@-@PwKf58@- @0P00gK@-@P$L K \F 4E   `ЍpG-3 pP PS@P&P 0#0`0C S44T   @ @P T @> ,`PV`@9 SP@@/  LP@@'  O  O  O8#   O  O <<("4  0@@t@3Tw `2`P+0S&00S 0 4`4 00  c+  0S P:0`70S @0 = 0S0 0 0Q400S 0  R! 000   0  "+0   0 Z 0S R \J@Ѝ0 h,uu((uuX00@-,P0  0P@$DPHPLT  R:00p@-@p` @0P P*$@P `0,0V:Pp@-0@D0H0LT#3O-P@ppW 0S ` W 1 *P T `100 $0(<S01$ *$`,0X:0 ,0` p ppQ`11$0 R:V' pZp (  R # 0C^S^00p0S Z*$4@0Zk<$8$L0@k )40)8)0ps@-T@`00 0?PP z>8 $ 8 0Pp|pvA- PP RJ\Twp4\@ 0000Spޒp;w`wmwM0 PA0Q   8#80C(0 Ѝ/00@-0 2 "Q5 0 :'0$#$(  /'0$#$("( #' "<+P # c#P00S  08#4Ѝyy3H*y'` z0S/P/@-T00S@  0   Ҍ@T-z8@-@P #P8@T8@-Pp`P0S, @"`G-PhM@ !k<p``(@rp(]`< "p " "12<20 2 <*2&p'Pp"  :0 P" " Y`< 0;P(}n.0 6`P.P p`< -P)Pڸ2 S 00ST  "P`.```V@@`"800S ,0T((#hЍd dzZzzE-M`).@ n" )., PP20S| yXZo% 10Sepq)0d#dh&hX10SVa 0S0ES1)0$#4|!8 #Rl0$#48 FS 010SD8C<1).㳠 Z 00S (3 ").0帀᷀pW W 00S`F !0 $0(0,|0R t啋 000S \压ߍwzrzpzz {*{cScxZ{p@-p@P` !@Q HQ LQ VVpDp@p8@-@ 0 x\ hPU̠ 0 <QS8 00@7008p@-00C   000Ѝp@-M `P@pPp@ T 40 ;C000ߍp{p0@-MP@zTP 2 9( @ߍ0@{@-M@P`p[PP 26 Ɗߍ{@-M@`pPA`` 2t 6pU@5姊zߍ{@- @0S,B00@HBĵp@- M `@P 6PI,兊(0 ;C000 ݍp{p00@-0$MSP n (00S@ b0 CR;0DS00 |09P\00S `J000  0P(00S $;$Ѝ0{{pH |.|O-M @0 ) P0 0@C.T``t3p pC@a?TWppWV `.V \@ ZpQ ADP @@@C0e S ?U`5 0009P@Zp T @ pP? TP @T 0 0P @ @@ pTX@?00ƥ P0`0S@ PPe ``ЍO-P @p`0  Y?V `?p R  Q2U 00 U . @  VpU  ``Bl WTY:T U P ) @P0@  D0  0C \ aL\-S _S00S0/@-: 0"+O-PM` `'`(0 000S @" 0S P ,+@P,U 0S U @@*@ ' 000lS 0`'@  PP 0 0a0CS FFp0GSpGUwp    py P p  $1000S0?0 P  S R tBU  ] T (pP90 0C08(0 1 Sp (p * ?$)P  )  S)P0S U 00CS>@\U @PP )@DTЍA|_` R|[|q||||p@-M 0@0dP `)0S ~ #)\0\ P@ L(T ڀ 00S S@0  C  I*X%Ѝp` ||O-84Mp0]{$4$$000004rQ0 13aP>P30 @ P0Zq 0匫300qS@p  x 0d pR &  40f(00 }(Lᱠ1S20&`  e0-SpW &BP$8(0 p&l20"' PY& 0@ F& p 0R   R G 0j pG  P0S ( 0 3t  (X0S L( 0 %%,%'%QP W# L 0R < <0S '0S 0ػ^Ѝ` ||д|L|}Cc }}\%$})}7}F} N}W}}}}}}}0@-TM@[D0 PS0D0D0$S04(, ;%U.,Š !"%D0 P$04(, #5 D0 P$04(,00S 0-S 000000 0Z(  , $0 0|0cxO400 0h0cdH 00 4 $0a 0c<4<TЍ0P ~~` ~}8~~Q~=~C-pP0`0A0 ЁYXS؀YX P0@-lM@ PP&   lЍ0C-a@0QP QP 0S%@@`ЃM-`fMp@ 6PPB XؠA ]_ N#PP+ !b?Bo0 e?PP00l00 1S A 0@ 1P fߍZr W~d~8@-@P0 R 0S%@@P8p@-MP` @kP ! KP @ЍpE-P`h@P 2ypP 0 ^;P E-`GMp@"PP. $B?0E/>4PP 0!00R00S " 0P @ PGߍ$~O-@DMP -R -RQ 4R6R0S `P00S0S`ttp2PQ@,4pT< 0P < #wP $pP  <@:( P!" "@PX#pP12Z  0SP( uP$0 L 0< 0, 0! 0  0 0#P"X  I@PP P  !@X d`X #@$DЍ~д~W~@'~YH~CbO-@`P1PEUpPY0-SV0lS&`V#U3@P000C S  ; 0SP4-,@`Va[qS 0S PUp%0-S l[p0oS U 0sS0SpPE̡P$`pPEHl[DV`$200140 S. (0 S+ Sp#'0-S0oS  0RpZ  0S  $` (0S pW(Zs ڒ`PIU8$a[1`P=` ~0PSpZ`$ P P Z`$ pPk9pW0 Sp \0S Pe$xP @  `pWI!~~~'=O0 0S4 05/q@-@?@DT/0 0 /@- ]#   0n@-@R#D0 00 00CS0? 0 0 S&@-@:#0nS 0 000!$!@-.#00!@- '#00"@- #004#@-@#  #D0@- @=(QsQ@B8@-PP"D0 0@= PP PU_"HPL8&E-P@W  `pP- 0Pp`P Z Z ZZVT /P   >0pP R`00G- @Q- $0 0c C1P U` e"lP:"pF00  xY Ypp VpW `<"P p` -@-0 00 0ЍЍ/-@-0 00 0wЍ Ѝ/` 8@-P T"0000@S00 8X"8@-P8A"U@ 0S 000P!48(%p@-`808P@ 0PcPPP  0P Ppq@-0 ᖀ0 @0s1O-@M0S7 TW`PP0 S S S7 SP` `V F= V  0  Ё9=Zt P0S SP0 S$00 0 T  0 ! 0!P% !QP R0a !SR! R0 !0 !0} "Ѝh0@-@$T 0P  aSR!R\܀880@-0  P Jh0@-@$T 0P  aSR!R-܀}h0@-@$T 0P  aSR!R܀@-P0`t00< 0P !PЍ` @-l0@H[` 0PHH 0P  R0" 00@-,M"!! ,1P@H1 0hP$ 0tS$ 0#5H 0XPH 0QP H 0JPH 0CP ?! 0 0 0! fQ" B@TP$~,Ѝ00C-@0M<0000004 0 P  Ё` SRp` p! R0  P@!* H"* A0ЍЃ0@-0@ O@ 0T$M0=ID0P0 MDG `` 0  0C pW `( 07 $Ѝ?BO-M(@8  d2HPL$i0000000 00000H 0P `p  a(0С ( S R@P @ P! R0` p8P Pa? a p@`Zu  (P01. "0$0!c!`]@d08T p d0 dP 0Sp1%A@ P0`%A V . P! S8 80U ( (0N 0 00D H H0IP PX iLJЍ<0@-0@  " <03/@TE-l$MP_2@2 0202000SC   P0 0p3p@@pP`%0P=  `%RD 0[S S 0]S`00A SQ 0P01c113/P U@ @p80S U@1Ps1@1 00S /`V HaB`"Zp  gR  p0S0pS  0P  ?Lba0S  P_Bp@B@aD0gQ 0   PMpO-DMP( 200kS @P 0-Sp@0@ 800"02080$z 2P200kS` v7C<0S<10 08 <0qZ1S 0S "Q  㓢@H(0 SE PU hP0SQ C0C R*80S, S1<0S4 S+0S 00 0P 0 00S40S000 S ( 3  M @PX  @z3DЍZvдG-0 0"0@ zpkpP P00AxxP`90P Yh fP0S`3pPZ   $(дI- KM00"1 y@$P P   K Z 00C S 0 ; 0 0@87`,PK 0p\{d0'`K 0x0(  `( `00MPh0vРD@PK.31@16XaO-Pp 0-S 0nS0SP !㓞 1`P90-S Q P 0`S+ Vm"P  0S Z  00 0SPg  ,P ,sXP@Tt{E-PpE.0`0@.Z !PT/00p@DT00A-hM @0: S 2` `gPP` 0pP 0p.S0/S`X2P@P>0@/W.  0pW1` ` =AP U 0`S<`apep!A=Ppx100ST10 X0P L1L   /0 g`-M!Xp!`!00 0H0S 0 S`405: Vp `V`V111hЍрA '-s@-@2x0 0aP P 0P PP @Zw P1 t t0傈PT P@ P @P@P|DдL]J=g= 0 `/ 0S3/1/0`/ 0S3/1/@-0@p` PP03/P@Tp00  !P 0S`/pXQp@-@:$ͯdPʯd`AV 00```0`P 㻯.00 0/%00 00000plO-SM4{QP 0ONo@P! P M?0> 0= `@1#5@1<1#5<181#58141#54101#501D1#5D100 0  PM/P0810.0<1D!0c@1<14081041P@PYP001$ 0 @1404D0KS@1@ 0R P8 pX a`@@0Z c0S N0 cB pb PP0F,08 b 00 a <B) a D "( (a H0 0P`a L,0D 0<00 H0L 00 # 0a80WRoPPfO  0 "0PPPIp20DQ24x"}ᳮ(J X* 㩮1P`Pc1SQ5X%X<P<Q`u?c1! ፮P%Q`F U*ヮ@04 C0 g[@p8AP<F! 148 !! 14@1JU%% 000 P,0̊,0000J? 0101 000 ,00 10$100 000 SZx 0 a}00@[Z<00  Sߍtǁ؁%}%p` /Zkp@-P@3`P pF@L`p@S@-0@w 00XO-sM, `PL PE P> P7l P0T P)< P"$ P  P P @ P P@ P\R P0QR S0T" L2L0H \ P0QR S0!  0R S !0 0 .,Z&0 s#$ !P1h0\1P!0K[-@$!/ !+!'!#  $ ( , 0VHA0F 0P g0[ZX00  Ѝp$т܂ !AU@-]@8.000pO- M@P3 1cS/0000 00(0 0000800F 0P` ؁ 0aآ 0b 0 0 0У 0أ 0$ R 0 R0$ЍЏpA-cAP hPhPY0S- 1S! B!P0 1!P1011PS01`;1 !`! 1p pP`1WA꤃pPPO-@PQZyp%`0`   00`[ \0! P00c0!01 0$0Q0Pp0X\n-0\00`0pO-0dMD004E4050% L0h⸰P s U 5PTp P0 -R0P0PpT`` L0 -R0L0L`8<  0K00œFp4P0l4T0h4X0?00X0`70 0!X 9X0ST R 4RT0S3U# 0 0o00 ( 0 ,      8  dkhf0 x0,0,H L00( `0 0G00 h O0( LH   H  TP  \X    T\  $ T ( ` , PQl2U `0S:e0 h2`20 1X2X0 2U TT1MV`Vl   <`D PZ _ P000Q_0% RR 0qS_0N nS!P  mS`!P T!T T!X 0Q(! U hS RU%pS1P01T01tS1P00T00X0P sS \>,0\0`0P_0rS  " cS1S 0S1 1 &, $, 0100s030+ GdЍp\%!36NN88809T98@-30@-\MT@ǹ0@⳹ 0 P 0Q  <<Pル@<T  0d. . ( "( !"(#8,\Ѝ0ɃQ` &_݃A-0 0"0@Zz r00aAp` RP @@T +  0PJTP 0D@i+@ :+1д}7>NJ0@-M@ P>T ?SR   ᪺pЍ0?G-MP`9pph100ᄻP0SC @0.S @;P0S00U0S 00    F 1 Y .< I 00@ 0P:0 0C0SS ቺWp, ܍=`k`3p@-0M @cR 0oS1838# `00\00X00T0 0P00L00H00D00@0 0|0$0x0(0t0,0p000l040d0h #q2`a P T0_`0X0D0h0P2PP0`S P20 dR t  ZeR |  [eR0uS0Zx00S `  D X  h@ P L \ d  H  @   t  x8$<K8FK 8|  p&T <bp <*8!  0 0l 巕pt 2  .  * R24ʄд>=10 \ / 0 p@-0  p ` p@-@xMT`:hPB p`7P'0@- p@ T0 R ۰ph W1tt RpZ{ X up3 @000S 0xЍpp$p8Saz@-@ 0/00   p`  0  p` 8@-P@@P0 8p@-RDM0@S `P R pl  q H2Q ,P$pP0S S S 90 40 /0S 0S S " 0 0 a{ 1 l1Q 8 ,  `1' ,$& <4000, #,,!$<4400800 <  Ru d 0>00= ?0`PP, ; ` V l`ݶX0Q DaDЍpɅ8VM܅!60@-S@ tP㺱0004 0S寱dS姱x@00@-S,M(10P1 0@  P @0(300@10u0 0 0S q7Y p@ P#P0S  0S Cl g 00 0PL 0S  000 @,0  00,Ѝ0KTZpqjiQ8@-@0g aQ 1Qe 2Qe pdQ hQ cQ@ iqQW oQI ,kQ `uQ xQ tQ YPLPJ0070SN0 0z0SH 0SE ,B0S P 0060S pPܰ00 0S Pа000J0 0F0SZ|PP P P R Pᯰ8@-0 0 p |@-FcMPPՎl   6@l10 gb4Ҷp,PͶp500S 1: S 50 a0PP0T0X0P\P孶pXPx㛰pd ,ㆱpP  PDb/P01E ㇰ500SS <-< p2<p0S9 lp( ,WpP  Peb?P01EP| RVp\  400SS $ -$h ph3C@+D&Y0S 1lpG" 0S l`y2P0S L0SX0S  0S,0S $0S 0 h1<&@0p1<'l0x1<'!"Z✰/-a  P  2`PH v0SC 0V#1H00 000(00(0$0S  p j0$00$04p40ppcW50S L0V1H00L0P0T0`0$T0`p`\`0ppcW5a@ P0S al P0S x00,0SY$ RVLP?X RO X0 GpXX8΢цƆA 2ۆ=.)EA[W6M@-0  | ph@- 0 p~|0@-0SZ} @p@TT@P @00 =0 0- ` O-MuP02^ "0 A S1`00PPᵵpPB 0.S  ʹp (0: S'  Ҡ0[Z R  P U#P~`0ا002~0R P0 0P弴U a`0r0 R P (0 0C02PEP0UЍ=p‡2O-"M P0 00ak2B`32"Pr1l0 pXX7 T`♏P0 "0P S: 0bS.p$ [ hP U ؇ YXa WV ^p hPa؇PH4p ,(Ѐ` P[> 3#0P 0S 3 AP㶲 P00S 0 2P t0Zm3`0P PoЍ z҇дp =և` L  0@-<  &000P  @L pN,#0   p0   p#A-hM Tvp H100SP 4140 CPA$0,`#||("t<Vt 30S S  0pgV U00S 10dSx20S h U T10uSDhЍ8p-IOXfMq܅Z~ @-L 뙈@-xM p 000S@" 00@6 0@ll0p@XP \0d0`H0P0P " t p u@@t@3xЍȈpƈΈV0 0 !0 0 1p@-` p@000S p*0xS P `TV@ @p,8@- p@000S 000xS@$@!/ p@|t P!u U@ H@ 0 00 @8XpMe@-P@p00@`嘩p T00P T<P ( p΢ʼnr@-@pf P0xS_AoS, : cS dS LuS xSS tS ERN 30S#R=R< R10dS6 $ 0!̠̌\ Č#̠̌X%Č<aWV00R  R)20S&P# $ 0!\#̠\ľ T!Č<R!SR10dS 0J0B w pO-0M 0004d @=#TPP8#P  4$  0h4 a1V 0S  |D1 ?!!hpp\ X400fSf TSh 1S:2S4DSu ESl xcS$ XSf aS dS& eSqSoS *hSg:iSkS buStS*rS5 sS YxSW`3V0SxPp30lc L `` VLDP$3 0P(3  P `/30b䒟*P20Z P2{P2 uPd2nPp20LbL8b80.0CS=p 9p0QY 9/p0 ӨpE 0000[VQ  00c0:{5 0.0CSp px#6/P 0 R1:L1ZH+P !000 S Z  0 ፨pw0000[Y . ٮ 1 ?!cPc#Ѝ дp=և&_sȈs\qH3Ws7#'f&4BQ\8~h0 ꬊ0  ꬊ(0@-@0S  0,0ъ(0@-@0S  0(0؊(0@-@0S  0$0ފ@- @#00 @-F@0G-A0 M00@00@8|pP ,1P`P0@ScP-0tSኮp   JPP  00ᬰP0S v0S U`000S P L 0@S Yp(\ Ѝ=+K`t@-M@Ⱘ 0!  , " ,$ #,,0!$<4 0@00 Ѝ8@-$0@s8000S  $0$0(0s8L,P(ͧp \@(yZp ,90PP(P80P008@-0S] 0S  dU0R0 0Dp PDZXV100ZS  8 08@w . t0R0o & cp 000S_ |[  dtV  h00X 0'<L0 - R ʋA p-<V@-@.EW 0@-S$M@ 1PP  p 0 0$0sa $囦p l18P`pW \Ht0R06u0R0P儦p p3?t0R0 0 s00p_xp Vyƥp u0R0p tCll\p 0S T |Ap $Ѝ{Ɍڌ <p$0p@-s@hM 0S fP 8$p .0Q0E0R008PSu0R00S01`j00 0S 0S 4 bR140  `R 0SR|,bP(_p P(yp , 1`0S  0g ֨p -dp( (}P,  0 G(0 0d(i㱥p d,0@喥p hЍp1Onu}A z\2O-pX@0,M4$0PS R:C` 0`cU`2P ,0Pc 0SY 0R:TL$Xp A000#0 0?ҭP 0@S P  P  uP0S T0X0@S 00ᾫZ pE p 0S x 0 0R 0 `V Q aS:,Ѝ=t:8@-t0@0S ddsP X ^0 0 Q:.0P8 DK@-M`@ p^p$ $層p:\2-Kp0 p *L4@唤p 040 0P00!0V0 PP` P P P<  P(400S }| 03P@00S  P `P000eS ES +S -S !SD ONS( LsS tS' nS EL3`#0 T3R H0P0S00- s(≈$ⅈ fP 2044 R   `R 4 0S  P VP P 00P,p`+ ! 0@0S01. `Q 8PG R 900֫0S٦p ` 0P D100S DLf1@宣p 4$ -Jp( (cP, 0P 0+(}(i㗣p 0S Vzp ЍQjA @B8 `  0unҎzߎ@-d0@Pp4@` 0`X@PpD0V:WE0O-000t2`@l2Hp(0SP XPD0Y:0(0$0S 00S,0S Z 0,0' > 0P00S 400cS0 040 cR0XD0[: X0PeX1UPUP/ ᤥ G@  + @ P U 0S S )$0S %$ 00S S000080S 0 P @^QPWPp  vpS@ \S  SPR@ 0/S\00 000SZ00pp臐Q008@-H0@P U030#P0S  88$0@-0@ 0Q@O-p000P9S@0Sv*$S !S #S ~*S1 -S y?S @S% t222020P ]@x2@0T"  1 RP"@!  0S*}Q l2 0 0 ``N0S PP 10pW@h UU@ 00VS U U@ h1X wtD1ZG PC10 P>P000@a`W =d`= P  0kX  P `pWV`V  UU@  0 40U U$0  d @k0G-P0@p` p 00 S 0P00XZ 0PV000cGA-P 0 `A@ p0Wpx0p`0`=0S 00, 0c 0T:ЍG-pY @@0:SS %S 0`iP0S: TP  0/  P X0 %R@@ @0:SS0:S@0@0Gtx@-@`pPPT 0(10Q @T 10S P0  0W 0 1S 08W00Q/  0pP00P00000H00VS 80@00 T裒Z ܵж@-00S R R. 0-S+0 R' -R R R  :R R :P 0S@0 0R0?,0 0  صl8@-LP@P@$PP8ג8@-D0@ PP  00RP 8p@-`x@P`h0PpfV P vV P 0S@Pyصp@-aT00   @00P`VP`V@TO@lU@PP 0L L0D @<0  ,P0Ppzص@-0@prT@@,pP 0P`V =pPp 0S    `V 3صX1G-pP@ 0%SJ0`S  PR+S%S -S TQ@P8PT5 +P T 00P*0@0@4$0 0圐?S0`P 09/P XhP@TX @Z 008@-0PS 40@04@5@ 00 8G-Ph2 0 X2@0+S-SPP-S`0S -S R PuY{S90800Ss 0Y0cR`X`_oR;10pW 1P1P& XU\-+ U ,11(1\$!$ 11 Q-+ pp<W0 Q  !lRQ0,0 -RxP0,00dQ01P 0SUT-+V R Rlص6rȔ@-Qd0 0@0   G@P@$00S@ Hص@-,P00$0SK1p@-$0S B00@0S 0`V- 0S000``0%S 0PU !  B 00S PgP0S 000`0Spصt04O-P 4@Q`4 $00$s0M  a ^T0@0 0cL30` 30Sc 3吃0p 030 0 00St3P0 0000PB0S PP7 0S PU0Z00 S Pp&0C2 P 0pS00U*0Spp P t PZ PPp00U:X0S`0S p1 p1 0PB1p2X#P 1`000 댁p- P D60W 1010S a0PEP00S P0 PU  +0 `|0 R PUH0<0L8 0 R0 ЍеX| Q@-@30  #000CS)` ` ` ` ` `     000P  0S P0S 0000 @Tܔ5O-0M @P  9 40   p `PHSPPV 40 P  B `1p 0 PU  #X400L40P CR `V 'P 000CSKp p ,D ` <e`P5 :0S* p᱋P0: S#A`#H`PhP 0: S QP& QPS C00Q"&`PFBP0S  0 P` *` P#wusq 0S 0  "@P @1  a"`U   jP`C`bP  3p  XZ3 VnYPU1 V Pu  P U J0SU 0`US00SP@T 00Y00S 00ЍBAA#00@-0JM0 0 10 $1幁@P 00 0 T (0S ㊄ $100S 0S _JߍA-`PV``@8V 000S x00   5 pP X@V@VcV 0AFk@-Z)\0 00 00<00000 0 000Ѝ@-0 P  P x00@h00@@X0@0@ H0 P0&0@` 萶0 @-@ x00S 0  0Q~3000000(00 00 @T1 PA- `PPZPT@P Pp L1 Pp p$1 @ p0S0 S @@00UP 0PP0@W ,,PV h0 X0 MPD00S zVB0 脶E-mM<0,? 0@ ? Q  8 /Q 0  Q1 $000,000(0> 0 00bS  P#<tdp"t000 0  PR, >@0   =0S PP@UQ  R ~00( Z& 0R0\T0S @ P5 >p!c0 BR1 @1 !0@P@TxTP1 !00@ S a@PPUoU 011 @0 0 Q@"T'T L \00@y0 P@0~   0 0 P(<0S q80$P00S 0~   0 00\T00S $T`T  R"T 0~   0 0G P ~00 0@00h Rw0  b R 0SQ @( U 0S  00 (0 R 0S0CA0|0)0@08$$ @$0S 0C@$0) )P  R x00, R   ,0)0 0S&TFO>P&@9T @@ 0S  R 90QSt  R D9` 0 89 00$9 `RP>Tpp>T<T 9T00SOP\p808! 0 e 0 0080 b 8PQj p8T.@< R( P @0TU_O` T PU?UN  P U00U?0 R P 0 S R 7L0   7 7 +U'0S` `WP 00B>P0) |P0& &P00'! 7T0010.<P >P &P 0F0PP-P0   000006V`Pp6mߍP@{P(P _P 0a0C0S!0@S &23 'T (  $00(T(PZ< p}0050{T00#P@P}P @ PT_T 0a0C0SP%_P 00 C R 0a0CS00 C R 00@0 S !@DT$2D 0 U``}P`V@=U6%T #T /T% :T y:P$P@ 00@0 S`2` P`*P hPPP]PPP ` U/P`P ` P R0S `(3pj0`0U`Y  R0SP L 3@0 40b}P 2 20820   p2P0@@S  ~20 !@   QX 20`020S `PP@  P/ \P 5<@S2! PP 10   10S `P\P $P  0r03"P0S \ `U$1p0 1 10   1 1 `000P c^`5P`V 0Q|0pp` RX0`p P v0` 0S #d0 0P8ȵ?BOj>̶h| v]0S1PS  <0P0    01dl04t0!0  R0S z00V{0 0 R00S0J0y  Q   0 00, 0 ;  00 0, 01PL1p@- R 1p|10S h10 `1 P P@ H1P #P P  P\P P 50 00Z) 0 000S  P` P00   0 0 P`P PeUPP` ~>U&T P0`cL0$0p&@ 0p@^긶|8ȵ}@-00@@T T"00S00 0=P p0@cl0DA@L00 D0P 0S 0 脶̶x| 1A-@P K0S-0`00S000pP TP TP 5 P @TOPڔ%|0 00@0 0S`0CS<0 ARCP h̶@-q0 01踶xX P P@- <0@@[PP 0@:긶0@-M@  40PUpP{ 0Ѝ0訶4A-0M00P,1 @  zP  (0S ,}0@T--8------0.,, ---.X3ET3P3A<3@@t@3 r0@P 2@&o21 R  @ 22@D0 A|200s03ST t2@T000 L@3/H~02 R?2@T  20 00S@1@+00`0Aq0P0PYp1 1pp@PV0PS00(A@@ @(1@@0,!0 0`@1   "0p$0S $@Pp0S 00 00p03U  RS p0`PZ* PAU@0 ,0 0 R 0S ލ?L|`ka_<,ԶĶO-M   0%@P0  5%@00I P0S 00 ~R` ;W9 /W :W W W/ pW  0SZP Y 0S 4pDp0 c 0 0 c @pd4`4p0pc  `V &V003Z    0x03R0Si Y  [ p:V @ =V V @@D0@P000t~Sx 0FS33\633 2583X0 wP 0S S0S -@x3 R@Dpp @`200V0 020   \2pX20 c Zp ) 0 0 |P _  PP F1 0 1 1 0p W  0D  kPTW{ F<11!0 0Rr P V c 0 0p`00F@D`F`F0S`pgd0`0S  3[."Z  rЍecdX:еjO-@P /T100SH1PFp<1ŠZ06Q AAS00<<SlFdUH  H뷛`$0S `v`300 00 00  bR R S3 .0S. 0 S0P"œ\ 0SPU 0Q 0000CS00S HD 000 00 0|` 8@-g(0P,0S@ Th 88@-@P@RNE R (ܜ @T 8@ Q@-@F@0P,0S 0P,TdgF8@-@PP  8000PS#0S 8@0@-0Z& <q ( < H@1` @-@0` RH 80080 p080`0\S\05Y 0 08 8@-@P  |00000S0?PxP8A-PP1 00lpl@*` P!0=S0S I00aU0 PR0SS% 0S(&p@TA-@%p` P@"0Ppq@P@qX 00 P PXw|дs@-`lPP X@0%0!X60@#@@P4P$ɛ@lt3|@-\0 \R0  R0p@-P@P 0=岭pD叿P<00 ,凿Pp0p@b)A-PpP `:ʭg@X  0Pm`eP pWrp`p@-@`PPl PPX  PPDa` 0LM@Ppٞƚ֚8@-0P'S '{ @e30PS80H0S 0 S" 3 405:"ҫ"50H0S 0 S' 3 405:''$0'S P0H0S 0 S" 3 405:"㭫"0S8O-1`@0SA(PPP01S |ޚ0E`֚PAUN @10X-p㜠`"E@P t`0ᘰY  X Yʔ0 9  p R |jZ3 0Rl` -QX0 -X R 0P`+@-@#p0 AT&0PU) =l`P g ]0H0S 0 S 3 405:  a@pWS CдFp@-PP PPl0@T0UL0S`X0`$VT X0 eT !ԽppPG-@PPP1S``XpQEP0FAQZ @D`VZ @-@`T ,10l@K@T@PPP 0-S+S P P*PQ@T'0@L0X`SpP0L00`0 0X0!RT0R@-   {  R@-@؁Q 2}p@-@P` +0 P0P pp@-@PW p@8@- 0@SP T`P \000 P 008jp@-@\`EPPU \000 ` 00pj8@-@P P 008@-0@SP`0ppqC@00A `ོ0@00ppqC00q0@-0$M00000000 0@e"pP h0h0A&0000000 00 0 P $Ѝ0oдR w%_@-@@P@!000 R@0@cO$ET1#H @-40@ Z0{hLbr8@-@P800P,0S 0P,塱 0A-S@`P%APpp W0X \   ` p 0P0Uj@-@L @8@-P@P 0S0S0S 000,0 8p@-@P P0$0000(0P S S S S Spr00S S000S000 S0000p@@-$ @᳻W@0@-SM@PB 0S?`V> `0 \R R 0*R[R5 ?R3 0 R00c0"QlQ8 50S R `b``@0SPlPЍp W 0lP {8@-P@p "@T80@-S@ P  R0S0H R  R4 5:ᛧᠣP p0000000-@- A000S@Ѝ/ꑛ@-00@-`P03/pp `P\P03/p@`$P`P \P pA-P@p03/p`N (Pp )P pW ZX03/)P03/'V 03/p''P/ "V 03/p`" "P \P03/``V \V03/p)G-0@P3/ pWpp 0a0C0S`03/`zw0Z% 3/00 C R 0a0CS_P03/p`00@0 S 03/PYV*P $P#P!P (P^ ?P@P_P| {P03/:03/}P`f Z #P< 00@0 S503/}PPP.X,Y 00F0 S %00 C R! 0a0CS_V Z#0FS3H! R XX p03/03/(P 03/+ ` 03/03/00@ S= a@P9$z诛P|v@-@Pp03/P`0S 00# 0p"z P1 03/\Vp:崧P 03/ P\$VP`V jgQa#=V0SSP00̛ӛ{0G-SP@pP `V T 0 R0S 0   0 00SS0S000000S )P00s0SpXm Xk Xi 0S`Ԓb P ` VSVQ 0 S X 0S 0S t;0000\b $p00 p0 R3 00p00S 00000a  0 ` 00 M\崸P0 00S N20S 0SS0 0Q@PP S Q ~{`Z?0SQ0Ppd0 S^P覗ٛ —p@-0  0~O-M`P @`:p000-0d d0PX:dd0P PQ03/pU)V( `pPV 0S(0S90  B _ Pp 03/p$00Sd0St0S )W;W L90dP < 8  90dPZ`|0SS=X`P0Px `sP Xq$00S,0S Ua pVpO`I0SE0000 0@0 0}0@0 ᜷P 0@0S "@ D03/ 0 P00S P q@ ` @j03/ P `L0PE00`V p0WUZp ` P|P;}X$0 Rn Rk0Shd0Set0Sb 0 R;(0S8V00V0S1 ;0V0U0S+ )V ,0St0S#`$&PU U` PN ,0|PS 80S 50  B XY<X >X-`  P,>W 03/ `  P<W03/P >W 03/ 0*|0S(0S0|0)X $X@ "XP #X 'X< &X} `XQ ;X\ \X |X }X {X d0S 03/p Pn 03/`Ofw603/ Pp[ ` y vZ* 0t0Q`0t003/p'K'PA `E0t0|0`Sl00#" l0`pPM7G$p`P?03/;P 03/,0S040 0,00|0 `Pl&W03/`P\,0S |W03/ ,0S $00Sd0St0S (X$p%t0SYd0S `P20SN 0S(&03/ P P )P03/ P P P {P0 003/ P P P }P ,0Sw q\P0U p PW`;V H00  B 0p0uЍ0 0)PpR| !/A̛O0G-Pp@d.P` 0S0S m\Q0?S*S [S bY@0S Xdp@8@-@T<8@P@5[PP 8~8*cl1s@-P@0S P0`  (0R `V$TC 2P 0` 0S `V?00fS,0S E0 "0 SP P`:]P `000S @徺00fS/|j} 00@-M  BP000մ @ ℽ0xR @HP @T%5̴PPxp0P@P`僺  Ǿ[(0 մaЍ0@-Z) `@?0S V PU1SZ- PuP吾$ QpTPzUpU V W1SZu  0sቴ@T軜@ 86O-P,64M@000`00V0 0 0S 0S 0`S3 0S%0`PpU 0S) P    WP0 00````P kPI`wp$W,00pY V`f 0 P 0SjP0H`0C0 rPY[Y~ Y  4R0S  `d `Pp>-pY,03/`0,0⌠0f<000<00 00l` R 1 :0S 廼00 0S 0Y0C00<0`S댠W = Სj  Zi,0 l p  l0R g0SY$0S `v`300C0ppv $  ⊲Z `( $@1P I$0S0S ZN ^P 0S ,0S <@T  0S BL.aP 8㧻(㤻$P/_P 0S  0S L1IY  0S嚸0000S 00Z 0Z($p0Z0S0`0C`04Ѝ , *4O-@M0P00p(0 SS R ( R S R 00C0Z<pW$00$0H` 40S(0CQZ``S RV R  V R S P  W  S`H`  CRS$X0( R0PH`X R  M 0$0c  S S S 0VS&Y 0 0p`d  `a0 P  R `p xP`p qSWl R Rbe 8  0 0p H`80P Z \  BR\ 8 \ R PP=X< R%9 Q 0m$ 0R0`$Q Q  0 `0(`P0H` SSpR ( R SV `H`SV 0 0 PU$0Z0C$0`0 0C`0 00C0Ѝ Pќ J=P0A-@p`P PUH@0S*P@- M@p ЍO-M@`0f 0 f H 000@S 6 *S1 !S S #S $S ?S +S @S `Sx 7070P 70H0S70TP@ѷp`7`X00S  0  !0  0 ;X0 R 00S  X0 R p \QppX0pᷰ BT0W X0pᣰ .X00S d0Q | 006Z<`BPa5"@@+6@帰&0$0 d @GP\PUt HV 噰طܶp @h Xp  4pGW @T03/p ᶉ 90H0 `p00 4x04|0x 40`P G10S0SH$H\`8 0c`` 0#S0pP 唞X0 Z p P :XppW  P P000C S :<30T PX0`a 0`U V ί멶p`eZ pb  #R00#R%R&VW S  #R Q2 0SP2P20姸 0p3/U`7PP`3Vp W ppwp3+Qp'W%  ?R"0S  9=Q`00pC#S Wpp `)p  囷 "`p 0  V 0 P  0 Pp V PH R 0PS000`JP0S  \0S0I0  ЍPH0iX`pp wmh ߜl}J=` @-$MP` Į 0@ 000  p W@ 0Bq0B1@ pW0C$Ѝ@-0@SP  ppW (F 00G`V14@-0 0@Q 0S +1C0@-DM@ c$㦜PZ) `㡜P@ $P @DЍ0@-p`P@@pTh00S@-@j00H@-PP0 +X@PP20@0S P 0S >00 0H`DH`U U k0400@ P`SVP`MV@TPЍps@-`8AV`P@D$1PP} Y`{0 S@ XPڜPP @t Y$  R@ @o[P 0@ ,,R@TL@DD,剳@PP|RzE-0@S 0S 000SS 0SND1P0S8 0S5 (1 0R0 `V` `TP$ # 帵`p 04pB'Z 40SZ  00S 0 0000H R  R4 5:ᡙᦕP P00@-p0@0D Rʘ R P Q   D E냵`k@-P 00H 0 7 @- M@.; ЍA-P@U`) /"PPP @p右@T ەuT0P0< <0c  p .V#V  0L 0@P NVCV  0L@P @ P0S0SS S0S  `0E03/V 0 3V 0@P@,ЍO- M8 0 4 թ ` C000M( pM < `4 `0PU2T  P00 ( 0R 4 00 0P 840 U U U 8 03/0P@  a 00M(0 Ѓ+0@ (0  0(0 `0PE U1(`P0K !0S(0!0S 0Q 0P @V3V0 `@ 0S V T@  T1@-T@ 3T2@P0EUS%V4T0ZSJ 0UPS0S:UU U z( K80!P{<0 Z4Ti @`00 @000 P 0 K3A-@P" 03/pP |0P`P `V0D`000  P P  0 Ѝض0@-S@ 儴 00,00 0R. c f_n<P 0 a BR_S 00 C R a BR_S S//s@- 7@P  y3@#2 HvDD@.CZ%  PT  P!u@Q`*dPP 00 R u|00` 㻖0PSV@P *@f000<SP`00@>S`0S 4 u`U :mNL> pP%_@- @xP tPu-r@-0@vp@- uppO-M a ק vp *uPڭ up 0@@x uph@1p0 00SPݧ P: "P# @ T@#Td0U @Q0ݰ0S d  ဧ  {0 0@ 0pl0ᥧ@@ T0Su# ?Np GENAĠv@-; 0vu"pp@-0P00C S@p@dԗPp@QpA-@N 0  P tP p` `0.SS  Sp  pP.00P Ŭp00a1S 0 R R0S  t0 幏P@P@ \P^0S0 zt"s   &дp%_Cc0@-tMn  P⿦0t0wd{@P l K) T Ǯ n @PỮ LtЍ0ơO- lM`PƦx20 , h2@P0S' (6 xtpD P0`pW  rP00p (dtp x`c dP0 Pf n1@0S Z0VmS`T0S% T`||!TPll P@@ᚰTH ᫦EKsp$  spP , , P0 B X\#rp( L300S( rp( \d2p\@XWO 㰥PP20SĪ0U  s RRPE |20#5 U00S  ᧤Pk L0S) 0s 0S zH00cwS H8L`1P  0 p 0010 0 00 @0㺽10 9 00@1X1p0<S  ѩ0 >R00?0S S 0   S  R@0^ 0 0 Z30 S00 0R acP:00Sf ~\0@$0s P]r$p  Gr(p  0 rH0.* ^r GENAϡ0@-@|Mr|0l00t0p00Pp \R RP0l 00.5|Ѝ0蕢%_A- 2HMD02@02<0<00000 000P@0@D  1-<<1D` 㨾1qS@}@04 dP,H!H1P?Pf'`@P㽬넁`P0@0ȡP#00  P(0S2S2tS S S2S Sx p`W LP`pHЍ8PꤢҢAд+@-=1!s@-   0 @  KP/   K0 S900S40} PKPd2 @ ` V0<S@ `@ያ0T V ㄫ|0\ R0/p@-@P 0dSd 0p@8@-P@0PPPP8O-dPMU@`pgg" B 0kCh0l0x0B 0^Cp0t0|0zB 0QC`p`1!Y 1AD 0=C 08C0 0 0$00(0h000l040p080t0<0x0@0|0D0$0a,PH L0 0P000T0,0X0<0\080`0H0d0D0h0 0 ~ЍmB?.A@@eO-[Mp`  i4`pG0嘔@0-SxZ& 4 ;+ ဢP $ZkWi0SF S SZ S00V JS S3 EdS7  SLJ S@G ;eS1 hS3 60- --$ *-('-,%"-- -----00000- -$ ,8 S< C<3" R@phaW E@PpG`WXw F d2`ᔩz p`@PdP ᵑP 0S C RR Q"R "S0X"S !1P`1SJ B` ơPF  dP5Hx 00 0000<0Ⲉ!0l p  t  x |  d h0⡈0 @Q0 @  0 0 g 0P I @0| 1t0 T  U[ߍc ( '("  7FO2"E- M@2P`0: S Ϧ5p 1P@ͨp0x00!1Q| t0<}:} 1幨0p0pp1 P寨`(}x0S004 01墨P|0U:  1ᙨ{V-xPt0T}} /Ppp P学 0o0ZS |JpWZ`|0V:TQ{ЍߘpдCcslzG¤H @ˤԤIۤ $P@008 ,40P/0 ,0P/Y1US/P/!40!8!0/0 8Z4 0 / @-@0/ @-@  Q0S\C@-@P 0S0S0S0S0S0S 0S 0SPp3O-p1Q0P 0#2"jj\ 00000a@ e1p4[ 0 = PU!PE" = =>0 = 1?001>0[00  = P!J" = P> = Q >0t$?P0PP(:400 ,PQ  /E-\0Pp` 0@t==@ l= =E-0Pn`@p0T0PpS WZPPp@`0T:O-0P@n`p0S SS S0000 I`pP0W:@- T@ 0A-@ ``0[d5B0Pp`P U{w=ds= =`P 0E{$0l @{ 0S`<@6{j 0 -{@B'ӥ,00( R/$ Q/80S/{3A-`qW@Pe<@D0tPPp@p0P T  1T z1@T 0! 0S:P0@U: ЍAo1O-P,M0@S`f 00s03Q0S_0 0p/$ 0)? 00(0 @0$0 S AL$0 @T?  0Y0Z z Z 0z$ 0z$0 S 0  0[0W0X hz  0L}zH 0xz00CW 0X nz,Ѝ~ħܧ(czX0@-@0S 0S $0SPSz0S@Nz 0S0Iz$0S DzxmX1O-`$M$00 0.z^x Pp*X@@T# ? 0  ?  Dz0S  pP0W$Ѝڨ(0@-@00S zhKFeP/ 㤝1G-P`P*@zvPT(0SS S <0T000T$0N@0\0 P0T  S R @D0V&0C0 (T DZ* j_  (0S |jV  \a\0:0:pW0`pGn`p`PF(F@00T``T$ GP07@-0 B 0K 0QP Ѝ0@b Ѝ0:8@-d0P @0^_ 0P0C0x!P R x!000 @R8@-@P 000O-3 $M@0100M pM `PP {, (P ,0S} SSz Sx ($( l0P* x0 80 ?0 0C40 0 4 0###S00  < @ x@< 0R:|  @ x@ 04Q:X  x$0X:@  x$080 P  S R  8 00x0 00b0@ @ Q:QQQ : xZ  P1 Ra a0@( T0@(0,0P(0 , 0(Qp\0S0 <0 C#ZP@⦎(   RUS bx !\0R:1( S<  TxP0U 0 $0Y DCx R 4>x K<hV֪O-4M2@P`P P0U00C S`V``"`x롮r/( ,`~`Vy pPux QP * 9p9$:  Q!$$ p !00S@00C S00p 0͛!0P0 p0͛, 000 0P` 0(D!wY  Y*?,0S / 00UPEZ90p U9P UPEpP R+0 0 0$ 0 ( 0P pw0X}(PP 44ЍOu4Ѝ^&` iejv@-|uxutupuluhudu`u\uXuTuPuLuHuDu@@uūԫ&;XnѬ2On0p@-0( R$(*@R d*<*R d*P*R d*0S#(*R $*UU$j  娣@@0P0T0u,uG  0娢P_|6G-@00/>AMPo 0  pUR pp`U 60IP IPUq vw, P U\_0S  BP00 Q `v0 0$00X0T0P0L0< pBP0T0 0X0P! ?0 R Z 0X ?0P\ 0  0 ^L P0D0SL0ST0S00H0SP0SX0S?0 04 [BP$+4SR  n 0 0 DBP000`00040 S 00 0`7P@0$$0PPUP`tn`p00SS S0S "v$ $ 90P 40C# (***\0SS\0C#$o{ LP 0SS S0C#*R S 0C#*R u Z0C#*R*X *0C#*R*X0E%0000SS S 0C# P Xh:0S uPPUpW`SnP pP0!vu00P`0UPЍ*,KhJrm`Ho֯@-Ru0 0(000p0 Q3/UU8 \00KS( 0(:@#M10@-0Mh 0>PW R4X P.|@d8!08u፟PP d ᔁP  ɇP@  ‡@p@3 lGP@ 0@@U RrT0@00P R0 S`匞  hHt0S<TЍ0[cU@vp@-VM;PS?0@U/>@P@`V0T00C S @D tZ n`d "PVߍp觰pO-Q0#03Q0S`X2X",M0pP$0P 0$Put$P20^/ x!y100 C S R-S +S-S-S+S5 1 @ 0 0 0C Q@MS @ GS KS: CSgS cS kS mS ,,0S 0 #!\` @0@00 0 B RT tP00P03Svr,Ѝ ?! !1! 0ء 0 0: ɰְ` @Bʚ;7@-X0 @00MTP@ ,0 05#:0Ss>.0A-`Pn`p@ P EPT@p`W:T0s(r@ATkO-T5 MM@0@"*,! < ( C#Z0100MM,1 S0!  0S ~s4 0Xp,0S``V 0`$0\0`FS < 1<00I\0p```F,0SP ,0S@  4 0P0Yp#0IK^s0.4!  pPH1 01UPX0 UU3YP PUH1;  U 3 "R s0 # U  R ,0Sp  081 481p4 I?K00X,0S 0@Q10 # QYpPX  0B"0c :\S0 :0SP4!0 U*V`A"U*V`A"0 SUqX00Caa,0Sp  C4 p?4ZW% P!0IKr,0S p  *4 p&4 I?K00,0Sp 0pGWp( 0X0C# H *0(!RR R0S0H0 0,01 S8 0@0SzxS P ˘0 ՝ jA0@0S a0@S`t,+,8-5555T-55X-5d-...5+.///0(0S+0C#`Z0SS S0S jq0S0000F&0(:(0S 400cS40 0000oPf/P,: :00s03R0@* R0T* R0S0;S\0S\ǟ^7 P' 0Fq pPPPPllP\0S eeP\0SP]bZppUR ()pPI 0C#jpWUP @ YlQLQ PP:oZZ  Z  0SS0 S00SpfZ / 0Lp0E%0(:,00s03,0ptSZ  ̜aA0@0S a@P<0011`2t2040,5,5,5,5,5044+4,5,55$5,50(P`ZPpW P WW WZp4 I0 0 zpgW g0(:400$&(0S$@ P*p릎pP`U$ppU IP`P0V:U ? =p0Wh(0S c(P`9P 0\`@%F&:* p: * 㧓 ᣓ 㟓0(:(:\P_ PP#0E(C) j zV z j3gPEJ* + *f $\ a \ a0P00CU#J'jH(Z z  Y  Q M  Ig k0AZ>0  CR0>10,0D1 㛛P100 ? 40S H  mh* mmmmmmmmmmmmmdЍ".д9P5BZٳgش9Ocow}µū;gǶ2Op@-@PT` @ P -P@PpYmpu@-@Bț404 000$0rQ 0}aK%_1/!0,! 0/!0,! 0/D00L BQL/ !L R/ / !8@- 0Z P@ ʚ1 0@ 8  QnȚ00H R  R4 5 :~zpTl0 0  P yP@ nP T <l4l0 0@ 8^iup8@-@PP t0 >P:Q00PL%88D, <7n8P 0088t}@-0@0 00p@-@P`5 0PH00S njP00@#n@a1P, pmlUP @a%H 000S000H0  B pܺ8@-P@p88@-P@p008h1p@-@P40`040D00S,00,0:<P, m 10 P00 <: S000  S 00 0  S(00(0  S$00$0 S00000  S  S ` }mD 000S0p8k00D A  pVgy@-$0@ 0S }֖%_-M M%00?᱙+㊛ P Ѝۍ@-`PP @%0@圙+u P @0@p<<0 +m00+ Ѝ@ Ѝ h0p@-PM0 S80`@00P@@D@ `V@ۍp<s@-PP`! 0@> U: R00U:X\k0%0K+ P <  0l00| @-00pP H0`Q^@n@T0S @-00pP H0`^i@n@T0S @-PZ = 0@>0P7D00S380@`0: S SPp S%pW480<0`P N&P{PU0S ]@-QM Mh1@O@AT<14P3LDT1*8`<PHDp0$0!4S` #p$00!4SP `00!4S@  Ѝۍ@-00#pP H0`Q^@n@T0S @-P: 0@>0P4D00S080@p0: S S`P S"PU00pP niPNPU0S @-QM M0m@3@A T0*cP]`LDp900!Q4SP p`' 0 0!>4S@ ] Ѝۍ`0@- N1 0R10100+0㫗+] P \ 8@-@0L R  Q/  4 rkL0000L  L 8l2O-@@800: S D 0S*, k00. y( {'{ `0|p p0PW0U  0jGPP 00G PU 0U80 E#` `XV  0<00.S0S5 j000X V ណP& j00V k00   0j Z *|0 Rx   j0: Si00X: 6gn<` ! l2O-@@800: S D 0S*,cj00. y( {'{ ` 0|p p0PW0U  0BjPP 00G 7PU 0U80 E"```nXV  0<00.S0S5 j000X V P& j00V 00   0i *|0 Rx   i0: Si*00X: 6gn<` ! < E- \M P<@0000(.D["ry A-Mh@  RZ PP`200CSBDp|pppq RP`xp t0x{`|hl 0v`hTr``20\20X20TTT"T2g`@$Hb`@20<2084"420V`(20$ "2O`K`102020!1`  =RpPR`0SK0S` S$ 0P  !`40St 4=Rd`<0SP <4R@`D0S, D+R `P  _X\ __V  _L P0_@TڈЍl3/4(.7*r%1D>JwR  O-EMC/ 4P`@ VP@PPPP 3  @3  3   3   3   1 xP WQph 80;; 0000 00 0 0 00| l_0S (Qc_0S QZ_X P 0PPZ0pS`ذܐ導x $dQ刋 0娋\ 5_UQ@20<208204"42P,'_$ 0P 0`P 0P0 pP0J0ZՈ 0p_P1U:N: P Pp`娈D,0000030\0 0d00`00h00l00(0$ ^D0S $P^L0S LP^T0S TP^P  J  E  ފ'l8Ku|'.F Zn5T[^A-p@ H H@1@!  4 01PeP` 0  0VppXQVX 4P( X<P!X  P5xV^ @ PW \ V < F^ 0009S 0Ѝ д @-@$ 0@@y O-,Mⅇ@@p@P`7 P P- P   # `P $ p ,فP $ @ ˁP$ъ`  0P @00 00 0p@] 0p]t00 U  R \\] ᱠᯠ,Ѝ5x=DNUcq>Cc@-@ 0@@<|E-$M@p@ㆠ`P! 0ScP  ]PcP`` QP J F @d d0KPU  0<@L]MK$Ѝ5xSp@-`@ DP8/pP !pSpppO-PMQ@P8`p`o@ P 0gPP߅pp  P  0bS @@k>@0%5@@`PPl `/-Y Pn 0P@S0S00( 0gPڰ0 RP0 R4P30 S S+$SP=n`P @Ḡ@P  =00p@ :00Z)  0KP8U 0S က$0S -P0 及`VP@=0AS@J n @nT10S 0S00@%R@0 RE`P AP  `P00%S00@ PQ @@a @D 0P@o 00P 0SV@ *nP l +$P2c P ``TP /|oPP 00 /000S]P@P[1P.0崀 0l(P 100S xᒅp1 Q0 RLj,% %T >Q[,V  ݇0 ׇᾢ ἢsp_n ᨞jᤞᢞ[ T  >R,,ᕞYЍjx /9Z^"pjJ=oy@-@`fLp@ZP WP1P#UmP<jG-pMPe@ 6,VP( 8PP$ 0.tƠ ,* #&* 000L$P <#8"82000"2@x1P.+1UX=#`PP >p  㷉PPp00h0@0 S  ~P } pW\!0[YV40Y.V) ‡p`ۆ,p@p[W Pp,p ᰈP  ЈU | LpЍPj*p}oZ<[8@-@P1U8 0 P/0C/@-`@0P0 0p؆ Ѝ@A-`@P p)~!%~0 3!b10@̠p\wpA~O-0CM0:0|:|* <000000 @$0A?H    ( , 0 4 8 < :PȆ+0a: S 90  P 咃P g @P5% ;0`p+QP `90 8 ~00 0V ek!u$)0WVY)0WVZZ80QWVKJA+D R D 1  XX0H |Iχ Uh5i3: TX⩐ J a 0`QP;R2PmHq d 0h H 0dh ` 0S:HP S 0`0X00cl0h Y p PP! H\KPp00lD0wD0Q \2 0QPa0:V eLY00X00p0Hhd HT 0, 0h  P $p(p`0YX@6 D0D0P  #Y6` V: O50h U0XTXd L0535\1 0T0H0(0 0L`帅P 0 p$p)%D ( 0\  P3H3d0` `!D0@ThރPۃw x4ptޅX D0bg 倀|x d 儐P\`0h0 PE1d0h PpH  00008#8U 0 ` 0C 0l0bQbb0iZ?+P  0 H0弐 b0c 0dlhx g dlh U:XP`ကX儐 P# P H0z03 T0S$L<#  ; 00 !t0P Z:P X| ;p| $` 0\0V:p W`3:82T04 \@00 ( 0 `0` 040(0! $00S  0 0xw'x {`p \$` 0d`0 V:0`0-00 G00```\ $  0 `F 01pG 00`q` :j\$ 01-Cߍ` дG, L`kSNA1/!031/!031/p@-@Ph h0 @@D$aP 00`C^P0@S00T:@p<0A-@0(pWWQ>00P0CnPP`PX00U*$aPX00U:4庀(0Q~pp0P(0 <!0@- ?M@P@(P0 {PЍ0T0@-@00 S@0H40R(0㰕 0QW@E6 8%0@-0?@Z+Ѝ@uO-0M 0P( <@0000;0;+ 000 Y;p` , 0S; S ;000000P1}pW }/㖃@ P"Pz04pሀoPZ* યʠ fP p 0HW]ppz0/S 0C50 R <0S t:00Sh:0`:R0QPH )N%(P (04 : S06`3 h 0P h0  C^hP110,S9 1 00 S000P0\)S09P018#80:60Ა0 00 I*[   0 0 pppgX Z(ᶀp  %$ y %y븀$aT0S00X: HX@Q k'U0SU U0U UU 000㎄L_A`7`' 0 0%000`S  QpSpppf 70%0060%z P 6 U00Z000 S5*:a$ 00 00000000 S00R:P ` 4 I`0c$ 00 0`P  >Up`W  00000 0 R0 04 5 050ᴀ 0`Sb @p94 0 5 0```PK XV4+4x 0V<40`i`P)  Y ^48Z|4px u+x0 V,4 ` 0G 0`P 0 Sp WZ [ Z4n`p I0 0p 0R 0p4 5 0t30pZ0 0`S  0 092p 050 ```P pWN|4p+5x 0N<40``P*  Y V4R4 xZ+x0 N,4 ` 0 0`P 0 S Z}X :[ R|}V0$cp(0`W1ta0011p0 0p倀t10,㚀\10+0prD10+㍀ ,10 %ᆀ 10$% Q 0@0P%o00Ѝ4^?д`Hx$h$,e=<s4~ $<TA (O-M0' #'@`  00@@@ @@@@ @$@!60Ql$D z`S%P i}p0: S  S 0Sd, `p00 0  0@` p  6~@ TLrP 1 05 QP|u {e 0!  4P[ \ l%0WVP@BWP@P<U P P@ 6  P?`尽 0dp##SR S-R SZR #S- R SZ R 0@0@P@8P [  0P$q X `\ $ R0 0 0SRXT 4 00m4 fPT| :`U|h P`P`\ @0(0D3D $@P `$ 04R44Z% pe$4 0000000 @ P"0QP4Ǖ8!40Ǖ@ + 8 8 4!08!8"08 $`"<#0&4%0&8&0&<'00,-./00(02B013DC 4D0 8E0   a@Pp @ P) $,4P@$0@%@$@"D@ <@@$8@@$,@$0SP$T | @$$@ 49T8 P |bpWLY @P  PPD0<S8^,Q00^$  ^^ ^Y@  ^ TL@^00X^00V{0X0V  R X``X00S0`SYF000TX  R! 000C S0;叅@P7 0S{0 00` .q02 02Ԣܢ?L <0< pP"08 $0$0jSo,+qP @U00YU@@@0$SP4堂B.0S*T0"R$T0S0DS0SU 00R2S 0P S 40S 04S)n*\2S022SL522bS022Rd2h&hSk S.>020+2 m@P,k000+ .>i@PZW=h9&go$ pUll` ?UP38$0S00 00 0jqPx @-+sP#O- |M0x@0!0 XPP HDoPpW ,<AD8 0 JpLbhO-dMPw0X0T0P0`@\ 0-S0-S\@`Q4$ T00|40tP X0@P@\P0S \4~ \$y 4!P -u$@PsXQ (nP,00 J #3$`P 0S $0 @X0 (0\0,0P\h0 D `P s# 3 0 02$P s @0 mp"@ @` pT""p26$P  PQ z0PU mP mP mP mPXP ]P TP U '+nS0oSPp p,[`@e N\P0S,SW,[P`W 0S @P0S @`z [v F0P  R 0gwP` St0S r ;v0 \~ Q `dЍtдp|` v(pP@- Cp7P"@-r@-1! P10Q@ 㧇%  `'wP prm0#,,!$<4   0 Rhv DPPr :8HЍp(д Jy4U|Vw%_@-P H*O-0M1616& ^~?0?hfh a#\60S@Z% pp|u @ul~1 0!(w0$Q PP  Ƞ Ƞ\ P0R:Qڨv0   RA0S:@ @T[HIr<`DV_X(z/v?P>SP<` %-lP > C<`P" P`XD TPq00X.v?SP t< q1AS?SY tSTS WS wS1#[ *@0K @ T p`~qS 0S ZVGB 0 00G 0@p > @P$@P"CP# @P 0UT:S @PT <0o GkWg qH0`Sb  V @+ (  0  0G    0  pG@< ΍L"`P#cp00`0p4 . 0"΍ R0VLRkG 0`p#>"P#1WV:N ΍ LVY<<XD SP1 #10C!?G  @A `pT  0  0'G `pT  0l | d GD{Dߍ!8?Y ~0@-hM PYT @PP0 G  uP  Yp3Ѝ0u-p@-@(M`P9 00000 0 00000000 0$0T00S H D09r8 4000((0 -r(ЍpQp$@6pBp(@MA-0PMZ0L0<01! D00@00H0L PP1H0 `@ D.`@ @)<<0VSouEPturL%d@HUjP LpPDL 5 p<0S S<s8o00`<0``<`` \f(0@-0S 00ܶj8p@-P80@ VPp@Io@Tpܶ0A-: Sp?$0 >0&":S7 \P3 @%P 0  P 0Sa0S A =o%`a8oPjX o<@0p@0SKop` Prܶp@-PD0@ 0S ePp@n@Tpܶ8@-@Pd TP@ TP@0T8T@8x~@-YX0@LA0S 8A 0S $A m@Tܶ@-@Pe @詄@-@n@7@-@P* "P& 0S#0SP 0SP PU:0 0<003/P 0SP4U`>40S S 0? R 0S0 $0 $/ QZ/O-<M0 0PA@P  vdP R` odP4  idP. 6` bdP' l \dP! X VdP 0S0SS0Z< $ 0S  C0SSP0S 0 `d V V  V V0 0  0! "0#00 $0% &0'00pFtᇂ0+ ` k 2P' 0Ps \<0 0@`Pf T  cP+@ cP  c'M,0- .0 /0 d 0H &1#P7  pP !0|P+ 0HsY p<0 0l@P W  cPG`` cP  C Ѝ]G-+HM0@;P 0PBS;0DS8|0HS)}0+S& 04 8 <#l(l"d~ <$4d"d h$"$(#&h&&+p 00P $ 0BS%t H`p0HS0+SXSh :) (0*P48+P<#\(\"T<@ T"c0#,,!$<$:0 0Pg  04 8 <  $ (,"  ,,$N # (! "<(0H@ "̠̌*Č,Č< "*,/ P * 0P$ 0Sa 0 $ 0S 048<S 0 4$#48 7KHЍA-s@- 00@^`P , aPP |h01PPPl0 Sd0d0ųPPPTPp`0 RPp`Pp`0 X1!0@-0@P 1  $Z0 @". !P #^-b-0  / !$!,@ 0 0@ Pp `@p  !Q01@T$U U M>0100H Tʔ00Dx00 DW0 @ U0 0 @ZP ZP1O-@H1`0SF Pp0j= 0P00p0- 0Z=00<0!0]0 Q f `S,0 ᳀X03^=b=00 !0BT0 Q  `9(00WP1:k ЍO.9@-@ $@@-\00 RڰS R (S  R 0 0!C 5Tz2O-P2M 0 @2  < 92Z~2pT 8*``20M>010S`FV82  ( "  2!0 R ![00\0S# 1  ㋱X%XP P p1 0 (  R nP@DT;P K, (1 +0  @ I~F{0`00`M>01oV x0l     Z 5,0 D0 00 Ѝ48O-@P|M(PPK=0+0~8 pp|(0 t(0  0  0 T>00K=,0088800 (M=$00(Q=  0  0 hPhP007f- PH`DP4 0QDZ010PAdǟ PPU 0Z=/0P0( ^ 1 0@P\0Si-( b10APN\0S 60 .0  Sh6 00 B-0. P SP46p I=K-Z .0 C0SK=K-02 C0SK].Pp pWEP P).JY:0 [% [  [ [ [ [   [ YS : 0 $( c0C 0  0 02#990(90( PP  BR P Pp* 0PS$c R 00pW 0 $ 0SP 0 S$c ; 00 00 00p0C0 0R40S PW < $00SH0<S$c |Ѝ9$8Vdfb~0R0000/0R000 0R0000/@-pQH`$H X`0V01S  @SPp,`c@PVQ@-R0 , @@#@A R#4$p0000/p@-@`P p 0 /p@-@h&d0P\00 cRZP  0uS40   U$0$$ p@дp qqp@-P@ 6S p@t@-@-@ QP f RV%*1@0  0  0`x 0   0`o00 0P0T 00  0 l  0@S 0  L  0@J ;Pf$ЍC@^ _@-NMKO ]R( MG@P MK/ YG <0)@,APn'0% S:"1PfPb 0% S(:)  Y0% S:@P*N?@01D 0@P4(0S0 S)0S0 S)0S0 S)0S 0)0)00CS@ u @ 0T: \|@P$ HL 0?I  Nߍt/p@-P@ O p@H|@-0$#40`@-0c <@-<("4 40  <@-<("4 ! ^OO-$M0000PU`@ aPEU`@ @ FpPUU0 0PU P` 0   @ ` 0  0U @Z PpUc;D0C%QCa 0 ` @ UP%1C 00 10cX0`; 00Z  R 0S 0 00 i[P(S% PU"U 0 R F   i0EZp0  F0000  0   @P0  0   @?U4%1 D00c` 00 10cRX00E SZQ V PUU 0\  iF 0p 0    iU00 0PU 0` D"I `I00 0 R 0` ≕D"I `IY| IXC PVS  ZSP U Q0F00  i0Z  R( U(PU%U# 0 R F   i0Zp0  ]E0 000  @PP0      R@@uPVFPU 0  0U0E 0p@TWP:` 0TV:@k@0 @kV@ #3$ЍG-PN`N(0 Sp S SyN'tOOJTc 0  - 0   J(0S 0 S 0 $P J Q*(0S 0@#  P0S  0  0  R#! !* 0  0   PMcccЍC@ ?c0@-MMK/zDH10  ,    (*J ,  - ! m.B !  $  , RZ   0 0 MP *P   ,-gD@xT \@0uMߍ00 |00 X0p@-0@ .3PP 02DP $pp@_L00c/@-0#0 @0 0hP 0T*x0 0R1#  ("< R@0# R Ѝq@-0#0 @0 0phP 0 T* R R R L 0P`PC`PVPЍpqp@-PP`oRP@c@AXRP  p@0@-@lMh~  P0: S 4K P០ blЍ0 @-P@`[X`L` <K@p5/bzP\^]O-dM`P@"c@P,DuI @Z0S ,0 0$ _FЍ[r@-M P 0p`0BPHFV 00@ 0 00W00PP@U+!@t+H@T \dJV  p8F0  @Ѝ,pO-04MH#P( ,0$0 000@ # `P0@003 3# 00 00$0 00, (0`嘥$ 2R0p R" " "          0   @    , H"@"8" 0"   0  Z Q /pE 0P00 α P 0S0S 10\ 0Sp0h*E0( -R R0@1$0 QaJP(cE|H,P GU [Y0$+ 08/P >P  08P 0|D 00 0 0S4Ѝ\% дl$A#@1p@-(M@ P ` ( d00S>(ЍpJp@-` PP-@ > 0@ T ? p@GQG-PMpSp?`,dp @` > -  ?|  ᜐ g`fkvGk 0qG >  iG܍Y*G-MP, @> d -"d 0{l 0v|0t p0 ~>P ?gǸ pB 幸 J`V 10d 0-1SZ ]  K 0wV0: SGPo 20d 0-1S K 0_]< S 500c0S5 d>/02@. S30  S400o0 Rl0  S600  S #RC0 OH!c0S 0:L  S00 0S L00S808 ^000 0=܍g` * M-@Pp`b0STH00p0/S S 0: S$1  S " 0S 0 Ц[ZР[Z 0SS0 = F 00 &!Q, QP&QP\GG`0/S @P= Z  Z/R/S  2P/ 0S`V+0: SuF`P ` 0P v #G=0@@dKK HB=< F0S p`0@-$0@wHPsHP 4B, 0"TP ^Գ@-BF@_-  ӰP B@E\y7@-0@0 0P 0QP 0 Ѝ0@*G Ѝ0O-@IM$AApP @`>T$ T+ TAoY lY1 nY Y 7qY vY' 1P&P$p`!F<F @t+YG dY xY@YF5dY5@  $%gpX?0-SPaEUP<8@  <+@Tp00 p 0 0(BHEZ DV V 0Z S 4@E JGt4Q l4Qh >GᶮQQ< 4z[E/@)G +-PP &P \% >Ἦ/ ? 8 & {*,Ƞ d 0h0 l @> ~ 媢 0<?/8WX /AP (p0SV# 㧯Px a80: Sr -(p0S' AUa 80: SU \X2pP $P` nQM AQ NQE `rQL yQ [`APDpV>S ?/(0" E?/( 0XP|>/(10R \3A?̍ QP 4EW! ; pP p?\0P "$P]AZD@wt V \ `  zIߍ0>PKPKy"'kAZO- A$M0HpP 0P@@ $ @)!`$i&i Q%:@\#  T Y jj`&Q:@\ Ԓ TY  X X X  R*\ e\ S  C\` L Õ0  L0 B0FR0` `` \ 0 P` V` V` V ` V` V` V  B TPe @DPERAP@0A T`PE@DIDQPP.  R* ` V  TPe !U@D`PE PZ !PE 0ID U`QPEQ PEPECU`0P0$C0@ R+:P 0k0e$Ѝ TS> TPL Q@-p`P@0 00P& PS  0 P S  CP @ Õ0  @0 B0AR0 P`p  P0  @d@O- A$M0HpP 0P@@ $ @)!`$hh Q%:@\#  T Y jj`&Q:@\ Ԓ TY  X X X  R*\ e\ S  C\` L Õ0  L0 B0FR0` `` \ 0 P` V` V` V ` V` V` V  B TPe @DPERAP@0A T`PE@DIDQPP.  R* ` V  TPe !U@D`PE P!PE 0ID U`QPEQ PEPECU`0P0$C0@ R+:P 0k0e$Ѝ TS> TPL@ Q@-p`P@0 00P& PS  0 P S  CP @ Õ0  @0 B0AR0 P`p  P0  @d@E-p`pPU`@ETbX:lZ:@TpPEP*@TFT  Q  Q @PU @@p`PW:plPW: PpPpXP@T{@pG$AGhPUp#p3UZ p#Wp`Wp@pppw?T$qP@ppgPqGWP#P3WP#UBPD`@X"S*TP  Q  Q P@T PPp@@'qspg1TP  Qo  Ql PpW PPp@'qE@spgWyGRpP@q$AEpgPU#3U#XW`XPp@pPPW@#@3W@#TE`@X=:@@@Tp@\@ P`U):plPW : PpTpTP@\*m\: b  b\ 38 b  b  b 0@-|MP@ /E'`P 00 U/000 0: S/ p+200S"$ p200S w=$0P R0Ap`200S X^= : SP Sa0pP0M8 S9  S6  S  S2 > S"  S-  S80 C@!``A7,p'\100S" S 0T p0( <"p0<<0  pP` EPp P EP`  : S 0@0 $0h0p00hl0t02|Ѝ?S&A0!@@-0$!1/@-@<U@Up@-@P`$ 0R *o7PH0000S `cPce000  000$0 00S 0e023 UpA-pq@P`?u00Zpp0P`VY0H@P;@10CS D0D 0 0@?0P<U=@萡aO-zMM  < @H@P P | ` x 0'07VU@ 7'UV@ gP@ aPP0 Zp`$@PU6 O 0Pz0CT!A s `Fpvp $90@S 2P4 0- 00 S , p V` Pz-0 T2S`VFVX5pL54W` $l`pP@ZzP 0 00=0 0PU@H4  \ 0\P R l%l DL!  , <8p0T @( P0[ܴ0哫+ⅽ>  ^(0P(U]PPzQTT ^P@L<啞.*k P  K剐 P eJ\z΍T8A DKnp0`1WXH+40- 00 Sp(@ @`4 [,01X03,< X0 0 00 S/  $0 0Ÿ"L,Pa 032C#<0C8 0  PHŸLL,8  c S~80c "P3aSv8#=>010SWpPWSp6W  R`LzTQX X aPEu``$S0(@ !VF0Cz  T"R0SZCSz΍L% T1R !XpX1`Y,,^ I}H 0 S 0  !z^!XČX0XSV 0Y 1 C4 00, $0 (`@ߍۍP8ErYA1YS&-(0A-Sp@PpT`<V ,0@ `F``.V,00 00B08` #V ,8P@(0CS( $!@P0$B$ S$S0$ 0C00804 0/#4 0 80S 4 p P p(pp080 ,s@-` P< 0@9`P *`P =V v00 40R` @=v0=`$=R|7@-@ Po>0BS0ZS *9>^O-dMT! X<@ <$<(< 4T=P$0Q,L=0\00( 00S* pP` <00@a f0   0 S?[ T+= Y  aP0g1P0H`8 Zڌ0A`,0pW07L  0 07 @8H<0`a1p x1t0 <pr0Ws `$0p@p \ W00Q0S p,48 @H20A`$" p < `a(0B W@ 0! l0Q8   p< @<PV@D D00B4 00 (SB a XD@{eWpW$  2P U X$<P kRp$0k2LZ4 00(0D P0pPQP @H pZ Y8&UX$ <PQ$Q(Q4QdЍA Y8@-P@(<0P700P08s @-R@:0 400 0$ O-DM$ 0P< P0@T a<P  `f @e00 8 ̠40C(040@<"4# $S40 40 4,,40 .$00<8 ̠#.4QP&; <@DsN@;0` 0S D;P@P R:|0  P$U 0 p00  pP{,0 0 R00*0l0  \*b"(  0bY W澋  0`da a"BP  x:y4 0,0h!$0S*0`` 0`,\PQP* '  \* aA` ` Rቐ#Y P`$ PR*00  P*b" "B a a  剐 `YP `8 p400 <P"4U $ ^;400 <"4P   P0%  P* +c20W0 fpp0 b2C bQ0 *!5 0P *b"! S0剐 : c"B0cQ! 0#:$0%  Q * +c204 0W, p p0h!$b2C b 0;0S*d1%  P* +c210 $b2C bQ 1*K1%  Q* +c210 b b2C  10  0W㦞pZ p0S*%0%  P * +c2 00b2C bQ 0* 0%  Q * +c2 010⃐0 2Cb0 b  0 `  ` PP* Š 0 S*`@ll 勰`FV P0 3AW 0`0Y 06` PR*00  P*b" "B a a  勰X*@K[P `Rː [I᫿k0S*r0 0R00c 03 0%0#IY 0`   `P"pP* Q Š 0 S*`@ll 剐`PEU` Pp@ p 4 0,0h!$0S*400 <P"4U  $ 9400 <"4P(00P0[ 84 ̠.$<8 ̠.4QP:84 ̠.$<8 ̠ .4QPt: $ s9PP PWNUN SNDЍ0@0 0D00H0 0TX  08<0/w@- 0 @@$@0!,S:@`p 0 @-@@ NP@-@LP0L0P0@-00$@ .00000O-^MM Qp0  &P@U@D D0.0 ^!0S@T%R00& 0U. !SR  `@@DUTQX(@Q1:T1U QJ0S:^>0Q,J000M4U΍ @TZ00Q ^5 0S:U>0LQ10̴嘵@P 0 p F i4(0epe0\! P 0Pap W:0S00U0#Spe0^  07 Z 0 ^ H 5!A0C0H 31p1a ōpb0  ^ PV@p c X8 c#* 0R*R-0 `D  - c4S!<$ 0 80$ 50##^a0P$< U$:04 @ $ PGQ.@!0pGPS U B I Y `( VD,5QR0yߍۍ@@-C-@`Pp00 40R":"RP $ 7P4ʄ00"RR 4004000000$  0000b000S:??O-QM MQ^ 0P`0%0 @ 0050C5050C 5 P' :Pj Y0Qn c` &1 0 5 0C 50X!%X08#8U? 5 0C|00xtP07 0 Rv @ RA.F  RG.= 0 R0 5T40L00< 00844$0  0xSQ>0 #$ P  3 %Q^P %0 )5 0C50cp5 0C50|p50CW[5`` R, 0$3Q !`V%Q B%:0 SZQ!`V0L 0  Q.5 0 0P%2 `  50 L01 0R b% RQ1%0JR 050C50 0 Sfa Br` Q1R 050C50 0 SMa Br`Q 0~50C5 0 0 S5a B r`S S`1:L5 0 050 P0PQ> p0 PQ>0 #XP  D0P %8GߍۍwHww@-d0@SD`T0@ (80@L0QqUcUI 0@D 1@0PE0cD0 0"P @00@D 1@0U0cD0 H0 0 SH009CU 0 (2 0@ 00\0D00Pe@X0DP <0@P0QqUcU0@D 1@0PE0cD0 0!P @00@D 1@00cD0 0H @00c ! 0b`0D00Pe@DP`0H88\ SP!P1YeUP! e\ cR`0 : *H00H0`0P`P `0H 0 PUH `0H \0 R0S0d00 H0Sd00`V 0S 000C00$ 0#40 00C 0sI pI|@-@f`p30P00b i3 $G`$XI00  RI@-`4P0@PaU$ )$p0p )ey4P4 C44P3#E-`Mfpb3 0P@" )3 `$4 0$ a4 )000PP 00$ )000000SD0 P< 00$ )00徠0 00P- 00 00 P" 00$  0R000 R00 W0 8008 yP 00000/pP00S 3P0S 3PWP $ 00Q  R000| $HHЍ |PJ Y@-0 Dp30p@-P@ `Pp Pp Pp0@-MM@P  /S 0S/Q R :0 Q < S P @TЍڍ08@-@P P @T8@-M@ pPn a3P nP"n 0" `P%010CS.0000000 000000000p 0 P`0 000000 $0 00`2 30/S0/S &" ?"(P "0 04@D0Z00 0: S!l1 a3" 0" 0!0SZ  0: S100000 0000`0PH00H`a L00L`m03/P 03/03/{" 0"hGfG?`G 0H00 ( 0$0000 00000L0 Q 0003/P 03/ 00<00 0800400000,000 00(Q  -hЍpT@-P.@0.$00 0 0000$0s@-P `3.Rp@<R+P%6/%.|s@-@P`  0QP 4000S 0Ѝp@ '+Ѝp/R/7@- @0 D  PP 0*" 0"-P >@-`p@ 0P 0$`p 01/" 0"Ѐ0p3/ @--*p*A-HM `@P< %<P 0 S ; $ 0"G 0""< 0"F0`SG Q ?<`pa 0/S 0 S /S`1`AC- /" 0"C `(   $ " 0/S  00P: *00-Z -`0003/P03/ 03/!@ 0"@!HЍ/@-Ϫ? 9@aN@- eP7@-P 0S }'? !@I 0+VA- MT-P@: $,# #, PPP$0S` Pb00pLL0`+P $`VP UЍFK@-0 0"勉@, tt0 +0Sd S\ ST P SLH  440m+DK&5EYiEKO-R0W#( 00ym2%0S 00xT = 0 Pp W00ET^xpP$  .A` 00>0<"0P`,N@80p0WsZ? 0@ PP  U㨀P h1P0P.1 u<10S.1 ka.00c01 `1  \0S 0T &0 ` ` e  ⨠l0  bX:0K `V0 00c@ T㤁д'V` pC-@`0T@@P`P 'V 5X0P0Spp@-@z0@дG-`n10A1`S00$P pP. uP(( 0~Y  Y뀐I Y Y $% Y00 @P % X`0S'!д\%p%(+p@-`P@0-S $%Qp@_q's@-`@ 0-SP Q Pa00 PU|0| tp0U0- A aPT0T 00`0֝0@PPS|д( Ss@-@P`P0: S 00!“P0"P "|/p@-0M 000 0 @ 墂0 0 Q@t   `` 0T 0000|P@PЍpC@д, # 0@-@ qr 03/P"8@-P@P $L$ 0R@4<00P(00"D"*E WrO-M@{P0PP`p *0  0(,"!S"`  &PZ< p 0(,& !&"'$`p  HR @ 0S 0@S  pox0Qp@-P@p-Qpp0H0S 0 S 3 405:   gL0H0S 0 S 3 405:  Tp@818!E- M@$屁 10QQ@pLP@ @W; ኁW@;ჁPU``T`V pP@ @1 PPU ~: 1^PPЍд1! |1|!E- @`MdY`10 cQBq@ @R4!41 h//`P< C/P7  5!0  `PP`   !$  *P :,! ` x0P`S :`ЍдX< : )0`/4O-$N8@-0@  T#PP 8=@-@ PP`@ P 0 P 8@ P 0 0B`pO-M$@P! !!Ђ 0` 0Z `0=P`pး 05ʻ 0, 0ЍpJv.AO-M( `pL`0 P`=pP 000quPPp!5匣PHP!4僣@?P,Z3P00PuP$p0 Xp( pP!X4a@PPp0 00p0£P廣 P崣Pp Pp`Xh!U p00p0_! D#xsP30 +! P" (p0L A! 0 p0 1#P P0: S  S 200 1#P0 9"P  00(P00_ 1#P0|V "`P[ p0j 00 0C `V! 0! ! 0!p0  f`p0t ` V1 ut00St0  0}P:t`j V 0pP-p0 ㍾P$p0  ! 0SRtQ FP  0 PP@P@aЍp !P 8 A O-M`K 3 # | |@FKP | @X7 0PLS@ Q0 0[Y2" x0t201S`\\j`P p8V PTvPUr zP!  P ,0( 000V0S Q $T"$@##0@$000(c# 0 bd ء हP ᦞP   b0$ 0~#P$ 0~$ 0~ 0` Z& Ѝ #дp[v` }u@-@ 2O-0"2d[@ lM{1 P1pP1W@B P P.  w,:p@ Լp&@& V$ V[H0S 0 S 3 405:  FH0S 0 S`405:6H0S 0 S`405:KPp`W sPoP#  4 4PlЍд(0@-,@0~ @pQA-hM PP 1  h10  1 R !SRZ0@@: S`a 0R /P {00F 0@@S1 010 0S . `P5 f0: S`P0  (\rP p00000C0@4P"P00<00S ,0 0R|@hЍpA-@;P0h5 P<0100 z00q1    & +   !   S`l  ' R 0 PNP~0 S  (5xptд=~A-ppH P@@T= 0-S0S `rP 0`S0nS eS\P0@SU0RP  cR 0R 00C6S k  00P00S X  7@-0 0"$1@ 18z10Q1S -R0SP 7▆70SZ% 7PdP@T =P x0PU @Pw;@00 40R~   Qд  O-$MT3 P0%@OD300eS834# , y` # 3#  y`` 201S20)0 0PNpP0 0 200eSu S S S 00D <XX2 a @0TS82 z3y`P^ @`@0 S S@`@`a;ᘱ1H0S 0 S 3 405:  HX T00 S 8!0<,U !@`0`墛` ۱`0S 23yPp` @pp wP n0 000W0S_d0P 0` w$6д u` 0S 00/0 R/0R/p3/0@-S@ 008@-@P@88@-P0@0A8@-`TR@@P@@WUzj v"p8@-t0  PsPoP 64@-5P8p|8@-p0 lP 000SX 400S@ <D0S (,<8t p̐/`00 Q/QP/Q Q (00SQ/Z0// 0 0ꌲO-2M@ 0Pv -R 0-S R 00C STP0S< u ("9$20P1S 20*w`Pq:#:SWP W@B 0TP@:10D 0*+ s R RI$ H1H0S 0 S 3 405:  :@i    c[:Y 00@rH0S 0 Sp405:5:ppT Z[sP 0Sds#('д\%@-P\u00A1S`Pd ppP V l괶PP 0S7д0G-SP`" -R000C SPEpnP cP qP vP A p1P`p @T!5:PH1H 1Q4Pb#U@`写PP8 10U10T d P00S0IH0S 0 S405:fY H0S 0 S405:y~prP 00S rx-д5\% 40@-S D@\ P@-@ ]00S0S8@-@RP xt0000#T0 XH00S 8T 0 S8S8%_ap@-@Pk p@p@-@Pk p@2O-"@ Et20Yp "k P``PKW Q@Z@ |Z% @Vl V@ L@ @00+ 0 gP z 0 [0S0 W R R W 0@ [ |@T@` o s@ wqAnд|tz0h2h" d2O-`"M 0P`0 0<s8242Pk0    @  ☄  5jꫵ  -jP 0E 0  ! rP(0: S 0U`K0S D oPP = P b,Y P  1P jP#堳p t`    p g`@ 0pppP0壗P Y`pWЍд8  P@-0-Sw @O-|Mx 10"1P@r0Da10Q0Tp`%Z`1P00 KwP@ I@ P, ΆP  EP0: S   t S ᲶP  0S  &, ", ;h0h Y9/P  ,0S|Ѝ.д# 4 0@-S@M  @4 @P \/@Ѝ5: SI / 0 />: SI/ 0 />P0   : S//   SI*/0 "//p>P0@-  @J TQ @.T@T .T R 0Z& !RQ`@-`lM@pL@R@TP  P M00@ ჺP C00x h @Pp* lЍp0P/0p@-@PPp0   \\  `.V `V .V\ \!0 Rph1p@-0@ O P1H0SP 0 S" 3 405:"P&";"S0H0S 0 S\ 3 405:\\'P0H0S 0 TS405:T@0TS`0H0S 0 S" 3 405:""p0Np@“G- @pMPd0 p J T?@@ '@0 %0b @0 ؀@0 x$@0 `30@ (巅H(居,娅  $@0  30@ ((, @ ! 0: S S00 004#&*Ơ0 , p   spgh$c@0 " ` l X l h0ll0w0   N@l0 cF1Y = @0  0S 0 05 Q B  '0S@ p0 , 0 X : S R$ @0 0兹P8p0S P%  0SP @@)0  W 0H0S 0 Sp405:@pЍpBO-qM@E P P 呒UP1 0@S0   P00P0 0?Z3P`P`6PSP2 7@ P0 00 S*T d  0v0 @  @X P:t0 PH0S 0 S 3 405:  n000 R:Ѝpu`  0.\Y0@-@ QdPQXX Qhh Q``a Q     Q PaaB0 `ЀpO-`|q0"  0S 40000 PP0@0b #0.S 0S 1.S0 0  B  AP (0 0@P@ "P mT4 U@@TU) k 0  EP P Z(ZP 0S ((P@T (`0Sp E-CMp30' `? 0 0N00Ka; 00D#0C0<3 434# 0(pnP p ~@00 21S"P D)0P 0S p P 00 0nS0 eP ^^^^^^P 00070022002200&RC>01 0S  pPppt1p01`S\10(0S0900@!  r 3CP0p 0`pZV. aP ppW0 wSOp`VP bU Zv3ЍpZ)  q @ `д=@A-`M 10P@ዒP`<sU |p`P1U p`P2U Vp` P 5U p` P  7/*P`  6/ `,K'X rЍpV U 4 H >O-@m10Q1S10%`|s@H hw @T T AP-8pP (pP P '@00pP P P@ && WmPU t  I`P@ P &0SVд\%\C_0s@-00 @ 6m` |00!.~Ph$ `0`0`Q1S @ #{0P@S|" дp@-PP00A1S` PP@ P0SpдE-@0P eZp)a0iP" 0 0pS Zp h   ={ 0Z  0AƯP _ д4 2 " 2"G- `@Ml1P`e0FQVhpP@e@` @ t h`pPOW 㠬P P @1@ P9bP7 uP2 100S  OPW WP  P P~  cP 㫇P@V %0SЍ<Sд^: s`  A-PZ< p@W`j0-S  0nR 0RP 0Xʤ !.@P P<= -(00 0R ~  @  0 0p@-S@`z :P ~31P u-`P K&P p l-PPLPT?P X |-  AA-`PBep@vQ0 0 P 0S W 7e4et2cx2p p2+e @"0P0S(e,e(2 qPz 0+S `bVt0 C R xSo00 C R 0a0CSg0xS 0 0C Q 0a0CS0S0xS PP00 C R 0a0CS PP000C S P9 0.SR  2R`  `o)0S R bR4;0 BR5 ;000S 0 Vpx0 Vd0    00f# /дp@-P`U@@00PP@S%P@ Ph@- @7 000S?@-0@"S'Sp` @40P006/P#O-@`$M0 0P*Hp1000S@Y gSeSS*XS5 ESN GSL ecS dS `sS, iS oSuS! xS TPT!P 0!Y!X@ X7 1 YX 0  X 0 0 Z?mY!X  X  00$Ѝ0LthttO-M@p 0PS -R -R0S P R 8300pS (i{0P0  @%P \P ``%Q bQ0S \P00 {j h 0000P@p3P``0` `*R 00`P @0`00 0 B R0 .R  0`*S  `P @ 0`00 0 B RB 0lS hQ zQ TqPD  @E:pgW p`   p 0 l000`0S00 0@0 00  " 000cS >{ 00C0 000POT0SPET:0SЍ3V[` @-@ 8@-@ P(000S8 8@-@(00S 0" 0 0 @-㣐@PW"@ 00@- M PMthp00@ `0  r# PЍڍ0(0(/fߘnд(%}%_8@-0SE@P8Q#P (P0@Sfp0 p@- Ph00aQ@@@ @U P0.S 0S .S0SP PуPP0SpVtдz0 A- PNh00A1S`0PpRP  0'S `j  0p.S0S0SдZ* MO-,M@2(P0%@`0-  h22`kPV0 0p V V%葟ԑ  ' 0 000  ' 0 000`F '0S 0@T |L `P. ?0 j U P1S T@1T @TPP!pP ܠ`p   0`/ᥡ 0$ 0  04P !@)!@)P@@TV = L ,ЍZд?` 0G-SM `p@.P+ !0P00,'0S00S 10PE80K 0ᇡ 0ᗠ`p ᅌ: 0አ`p0S! 0 0ĢP  0峢P ¢ " 0h P0Q뷢00P @@b0S ЍDAeA@-000C S \%P@-$@0@0S E-0@SP` 0S  0S0Sd20S EP2 p1X00 "W Z0 Z0 J ZZ J ZZ0Z\:R R  L \\V 0CSr L \\ R  B0S0 R  BQQaa  @  CPP0C P a@P0 0S0 0 B^P ė0 R   aCQ 0C00 0Sn3O-`3LMp`Vl3` @ P;0@SH$Z?$D%@%D0U@0TT 0ᅡP  0~|  0xPx t忠 0oP) 0nP  04寠 0_Pc   0]PZ[ 0坠 0MPM   0ZPHE 0勠 0;P   09P47 0AP- 0%@ 80 $0010S P $0Y c5%1%  P  P0U 0T p0W0Y0S.Y,00  i LЍ?E-0,M03 3# 000$ 0000@9e3 ! R  0S  R P)L#0F,`q;P1p0 .R+00 q$,QXPpp!PᰂP0h>=0SX00U0S0pppQP00S0S$20a1@S2P0&vp10@ ddP  嬌@Pb0S10S00Ta0p pp` PbP@1@ 8;`V61 [#0 00` EPp01`XT@|00   T0`0@p ph `VXb,Ѝ &n7д\%J6LO-0$M0L2L" 0 0@009dP/0  1  0PP 1  1PZ* P1UPpd 2Q1 10Pa `A` pL*PPC  L(a 0WLT@0@ yR 0S@a  pؠQ  ? R  @@ZĿ   P@ 0@f@ PU `$ЍY_lдs fpvAp0@-P d@@"TcPpP0`pD00Q7/`@Pv3(д8@-@P0P08O-0`@P)%pPP#0D{%00 0@ Q@ %Q @% 0;/T ЍOꌲ0@-\M@ PUP L` T404@0,0@ 0\Ѝ0\ p@-` 0hM0@0 P3/P l8T 0L@0D@: S S80@, 0xhЍpX< : "{ep@-@sP`p@ZnQp@-P@`' iU`M4 00 IlU<C8HtU$<ATU0 R 0 !R 1p@bU# "fU!aU!sUSUd cUT"dU8"p@cp@<):7@-0#, 0s:pnQA-P@`p9 NUs0: SAPPXAdU, DU  iU&aU!AUqA;fUZ)FU0: S#|2| Sp  Sh  S`  SX SP L" SHhU8rzuUksUU % gU^fGU  PtU N$0 >0!QTU PB 0$ #0DsU5# BU(.6bU'$A%oU8'xUH XUHyUP YU PzUX_ZUlXcAVYN:\So))mY\P 00ӗ/cp@-@P`P 0 U0  0 0p3T  TU3  TU32 0p T 0U =<, <0 0  T0000p( T&2  0 "P0@2P   00 0   00 00@TpP T U p@ T U00 0 0uH0T0U  00 00 0 K1T !T!|1 U T Rd1UT@@ 0R>00000 0050@00 0@0 000p0 T0U;318 T U++@ T H T0  U<<   0 0 p T 0> 0p(0Tp00|0000 0> 00;0p XP@-WP 0 @-WP 0@-{W0 @P00A-P@`P 0P pW X hP XP ^W?XZ<!pp (0tpp0Pp0=p-p@-M0 0`@~VP @0S  0 R0  0S: 00 @00P0`P0V S00Ѝp@Ѝ/p@-@ qP D000S8T ,$0T  vx&00S/p@-@p`h @@ PP L000S @@Wp͡V$ `͡P TT%_A-@p`PPL@ <0<@VP@W @Z`W Acp@-(M0000$00@ 0PP0000000 0$0`PP $0P  00$0` VP@p3(Ѝp;Mp@-@`y+TP Tpp@@-0kpO-40P0M00P@ 0`Д -R 6 P+ 0o paR gR FR g @ d@\VTh `RZQ 0!1$$0P`I RD tP= yP Q L @ p. t Q pPʂP@PP P !03L g L0P ރp@0p[y 0 SSV `iLp< f Pu`\ X  9/0-S PJP L ;P L `2 `PʃP P P P P P ls YHj{L  Z&L LP@ @`qW& L` @pP P< >P < P 0280< P @Ѝp 4S twt%_7@- 0@04IP$PD U@ Ѝ0@o-`zG-`P0V @T) T10000S|! Sp!M …0C- …\! S^@0~S0•0^00?000 ! }@T @up0 'X  0S0 0 S V pTx V  ZHbTDF0pUW@G=p|EN G-Pᾁp@`pQ `p8*PX P000#YY_ 7Z 0sS@0'("(@@0H S$HZ Z8#8l$H8#8$DPH+4 Cp`  0 V`P 0U0v0S ` PiPv0SS @JZ0 X0000S\%0-S +S0  偁p@-0 PmE-tM@oPP#`pV00 0C#RZ3 0P @PD0 tЍ pO-KM0P$1` 0+S-S000C SH@` @,6,& I?0.G?[P @ @5p g%ĕ$0 0  R(P P0: SP h50` p8P@800 (01pZ`W R  X34 R018$4 P0p `,(0[0$ Y 45`440X.00 0 ጣ 0P! T  R 0R 0 2 #yЄ R 0R 0 "p P Z\ W !*0pd p   B QpW R0BR@b;T9   PPP0d I*0 Q B \0RAYP Z Z d0 SIYPPPa &j:X*_`  eP0 S ,0 X,F:P pAU $#` (@P@, THPF⡣PA+QP<΍ QP65P0T  T( @T$0W X < z*<PY`: P$ Kߍдp 8O-P`TPZP1P@Q0 g@d` b1p0@0`0000-S0S *P 00pZ0Pp0x 0SXX PL00H0000PSWsдp <0@-@P000$ QP0'  ӧ  P@- 0S $b^0⫝̸}h0@-P00 @0S`p40S  Ѝ2@-@M 0P0` V @0DS&@P0SUTYSUTVST0&SP0 SP0T0B0DST05T0/T, P0'hDP! ?P0SP0PSP0P QP& QPЍz"PA-@M3 0%P`p ``P %P3P0 0 `p&P HPHP 00S 00S 0S0` V T ``v`3T` T 6` ThLP J` ạPT 0 CRCT T@@y pᨡP2W`T/0I,0Sc# piW ^W 0S 0 0 0 XP W 0Sa0```= CRTI TJ TJ TJ TIIx`jV``%0CS TK TKLx0`` T)R``T` T`V```` 00S_00``V`pЍzp@-l0`0 Z% @P&0#P0C0   0@ 0@@_pp@-l0`0 @P0$P0C0   0@0@@_p@-@70[S0@DS 1 ]R0S  3P T@(01|0 ⶗@P0P@  0@@0 R  Q $,@@-PW00A1Sp*t0P`0P 0S W B< PoP0SдA-PM`@p \PP,0qC@ U  ܍O-pjP@<SlP 0\Q0 Di@-P  R0C@Q00[Q0 :RxX \FN Y 0K Y   Y[0000:S @0ISYSA000[S@Y00S a000{S@0IS 0Y0@ 00@00@00@00@ 00@0IS 0Y C^Q'B P aAQ RRQQ0@0  S &R$  A00 GS @=R000 R  =R ]R +@000C00  @000S3E- P  )0@l00 S1! _V10p P PP 0SPD 0 0Pއ 0 ė ćR:0  0S0  0S\QR Z%*0P ^  \ UPP P #д) /8@-D0 8UP(0P@@US &_0 p@- PMU001S@ l @PTP@`PbrhdP X0 00S '<@P SSAд` Dc`CcG-0M001 01! 0@00 U10QaU 0-S0S "P 0S 0-S0S ,,!~`@HX 0RQQ0T&  P 0*UpPT Z00 ` \W40S`@дA@-PVzPfA-0 0"D1@@8U41 1!R$! #yp: 8P Pa  0PP` e( w0S  ^P 0S 0P0-S0S Pŕ@6/T@P(2д\% A-`P; Pp0 B?  C R6dX*P"<P& 0!P0 0#12P00 0@3P0  d0 VT@P^&@-p@P'H0S 0 S405 : pCP 0=S V 0U`CS` SVU ` 0H!Pb`CUH0S  0S ""1Z 01405 :"F01 U(H0S 0 Q0#11"1 45 :"#,02 U HPU  0R03104 5:P0s"A-LMP4@1@! <2д@- 1P@P` 0H0S 0 S. 3 405:..!0 0@l0*0pPD0H0S 0 S 3 405:  萲@-P1M 0H1@D@1 P8P"0 0UQ 1 v뮘q`]`PpUVP#P3:0 0 P@0(lP  00`0V 00 `p}ubu P \MPPЍpдxxr@-e 00`S@-@S0 ) C  0S 0C Q aAQ_S -S \00P C B 0C, 00勵HЍ2k @- 040 GG-(0`SP@Ђ  pဆ 0 P0 0pW  RhP  0G4P  G 7QXs @-0p`M`V@\0Pp` 0<00PЍ` 0O- MPd 1@T0P6|Z )`pP `$} P  < P   1p`0W 0S  0 @8.08 P00" PI( P^X P`+j$0T`Pc,0QPÅ 0`Ѝ8@-@PmP8@-@Q 0S @@- , s@-0@0 C R a BR_S=P P00P`F0 0`S0$00D:|p@-P@`)p@@-@`p000`(Ѐ@-@ 0嗄 0@?O-p#G O-4$M 02R`pPဠF X "Q 0R0@=0Z?( ~ P S Q ,% R40Pp0 @ 0 0< SQ040 QP@dW10 SQ@ Z QYP Y8 YD OYK YE JY5 Y DY Y ?'<0@}P;000<. 0 80w ''<0o N@c <0Hd W@ HPP50U $Ѝ%>'%!>>>>@-$@6@-@ 1000 @p@-  t2@ 0 T PpDRPU 4 2@< S{  S`  Sr  S\ x1 S#  S r2 S* 3 S mCP =T00 0`PRT000p@@p (`0@0p,0P 0< S g 00 0 00000pP @T<@0pP0 0 00 0 pp@ P0 L00pp@M%>%>%>%>@G H1G-P0@E 0 C A,,<u,9 Kd0H0d0c`pp @\000084`,`@vx00S `\70   0 0 P%>%?t0A-@hP`LpgP L P<]PL0T0P 0 00LpP`0p@-0P`C 0 P:0P@1: 00S~00  Z@`0 T:P` `0 Rp0S p  @-@ 00 PCR ` p 0aP 0S 8`VpD0 W:O-@PLMP$PD|>`x> 0pF( ,0$0P0 D $8@ $0 0 8e8 0`0 8 *40C'S^       l l T @ 8   l  l @ , @ |  t   D t   ( X ` H D0< SgPI 060D0 _P060<Y8P8 5080  0;0 0000 0  0<l0Z Y:A80 0R Zt@4 @2;0@0 0S 0D 0S|X  夼Pt V00d;wXT l0@0 Z4D0S@8&8@%D/$0 h  B0 0 Oh D0S D0S8$}@D;@8B@,D0 ,' R@    R "0 0S  f8]D0$ T8000L080x00t0@%080T S0 ##80 0S8P 80:&08!Po8D@8 0D0(D 08 ( Y֖!X@0[ 80PW 00< S X8 0P Y 0 R$ 0Dg$G00 0* Z'01 00R*D0S@吀0吐L8 0'LP됀D0S 8D @0S Z 儻00 80SF880@0@0S ,0} 0Hw 6 0S80000PD0SLsPq8} 0 X񟗃  $ d p  Iq>}&6w~luilfncu`8s]D唐P D }ᔀzN֊ID0S8/88p}@88P 0S @53D0S4 8Q 0S D&@#!8D P 0S 固20D Q0Y , >} 0H @7}#AD~0 PX!#!# -X8<3 MX !X$ .mX pX ) 3U|  |3N| `3F| <3=| } P30# #@#0=|~PP08P T0U\0PE 5%8<0007 M@ Z 4l8(  2@.@*86P81P 0%H X:     h L  \  x !{*!&!|# 0~P !I}![n 0}P '؃! 7}~c|!| 0 { Z!@P##8 P 0 P  0{! 0l0S 4^zX pAv ? |Z 00S S S00 0} 000 0}000 0}P00000 SS 00  Z@ Z*t0ST$LЍ0A-<! S`@ᄀ00S @@BP~0`V`` pḞP  i|O-M0p0 YT2`P0 8Q42 0800Q@ `$0 p 8 PU= `0hp 0/\R 0p( &R Q/R!9R&R00B00pG p ∁x tPPb 0 x p00` R P @U 0X  00pS `  0T P p  c p0QᚓЍO-M @ 0`0 0``\`pP ?  T0 T0D0d0pP` 0U  S R(U*DIXGL   | 0 8  D D         $ T'`Xp# 0]i%Ul0<! S 0f4t4Ix D1Xpx0t0P`tP ,UxD`pX 3y&|PU\h~z|x<TPXTT PXTPX TPX5TPX EzDxt aBPX  t00t0t0Sx{HD`pgZWh200SWP`fxZ P 4PPy UuUXj{||Z1U`|QDPp彨 00 10?[D/Sh `40 D`PᩥXP400040804`080$1`Dp4y 0pD40`8cy 0d4y 0^0U$9!\d`HPP{00`0@ \0 0 dH dH\0  0y 06 UЍ& ?d|O-,MP$Pp/`]@0S %S0%S *S@0S a BRf  $[@0000qc[[00$ P z   s[  $$ $0 0 0 0UP`0@T@$$ $0@$,Ѝ0@-$@G-08M,0(0P4$0H4% 0@84ppP9l0 qh0<.@,D*H$<`  00`S  0h$0p *R 0+ $0$0`VP3P(<<y83800<s(3(00<m3003ZP= P p0020\V=00P`V2" (00000,04 {>2P <240,JP+ ,0S(0qS`e! (J1@0P4c!0@}PP001(0S` V\1!0p4 | t0,1@-xP 0@D@!PD!ZRx9l0S`P+ H0SqH0P@E0x0L 0 0t0PLx0S 88P p00TM88P D Zд 2O-04M(0 2 2"@ =10Q bbp1Wp@[bTP4Ѝ!10$0 0,!H0S 0 S`405:NS`H0S 0 S405:?D 0 V" y@ v  G0`0(00$ ,0S $(0 Q V v ! E;댲   д\% 0  0 P0c/P0 /P/8 "#  R$/  / 蟳R j @-D@P  ep` 0000@-à,S \@-`@PWV @@-@\?0H R  R4 5:ᗿp ` p0 0@0SS000+P P [0 A@Q   S     SZ( S_PP   O-@tM`P48 g#`0 p 0叵d@ p;; 0cc 0 S 0`⨀`00202     0  A ! PQP 0p q0RPU``d 0PPUU\0 2ppeW ZeWg0CP ``0X0egh0020S 5`VX0h\ l0 0 `V35:0P S 0 0 S02` b < 0   R` < 0S !0(900  0 R0   R0   D C0`S  gS  !0 Spp s0PpGP:30@ P 3@K# 0 p 0P``LPT@ d0jD \e (0 Q 0A 0PeH@ 㐋.UJH@@➀ P<@ 0<@@T  0㞃#^<@ 0@ 0TDT 㞀 P!0V  $0 s 00 $0 T 0a`p @PU@Y1:YLPP`T@1 !0 㒃# R YW0 0 !DP(NP61S1 8401 C4 8p0!1 C1 4 0   ;;S 00 0  P0 U[ P0UtЍ# O-@BMP8paA 2H0S 0 Sp405:10  1H0S 0 S 3 405: `pL 0H R  R4 5 :p0ЍO, ` p0 P 00  `p0H0S 0 S 3 405: S 㶽Z`p0H0S 0 S405:>ꢽ ` R0V`p`@ XwЍ蘲 5O-0lM`0d05P`m^p@P 00 0 0QP0SHpH  (P,j8P0T l@z`0PU@``dp+0ڽ+0PԽU UP@U |$0 pQ Pp0P@ ST W (40@ XH `(4@0P 0`p8X08080S C! P 0C18 0 B@0< << R\  !8< BPD S9 {   P  S3  80 H@0@Ѡ @T PUTp@SX  @a8 P L<0X YD !ז{i ,20 Wc @`T  0 Q@x 0 Q@qo p @ `@bT@80`X @ !V`Z+-`V  ST `d\LZH崭8 <@` TX0 P 00CH*X-00 H"+00 0L @ P`@X0Y%HLT@`y6dw6lЍ@000  ꈲ F}ppp    i O-TM0P`0&L0P(H5@ 0 4%40%00$L0 Z850QH`D`V``H`V4 p 0@ 0 -RPhA!yhA!mpW`p4 X 0: S 0: S@ 0Zp: Sz WpP LpQ`@0|0#03PR .W 0X 0[P`VP 0S pq 0S$ PQWU `U` =`V@@B>0T 0t S S @B@u8(H$H@0S0S00 00Ń^P%.P 4\40,S.4 P (8S008$8S0,80(8$8(84(S008$8`S08,804hkSK cS' =S -S .S S aS fS! iS dS rSf pSZB DlS; wSS zS sSw 00,0Mu0,q0S S S40SQߨ]qN40a CR R |A,8P1J0, 0,(8S40S (~0 R} B ;PvB40 0ySn %0S S Sd40S] (8S0080&P0S 4,(0X X%P$፼$@ T T T(9% pP3 ``0P`00 gR pR   0 R%0S4 R0 %@W@X@P `p`0k 0400v 0P V  i`@P`d 0R00 `!  ` 0S   h  kU0 00 R`C0S  =@8  0 0 0 0p020  - 0  h   k#0000p 0p0Sp_0S`@ \  @P`p UW38R/0S S Sn(8S0080,840S0484HT] 0, !`PzP[ PPp  (0P a6P`p 0 S-PR 0-SA .S A ((R @ 0ܨ(8S,P  x<ЍۍMp7` $p?Bbt8@-Pp0@ 0 0$0ZP P 0S @000v8@-P @KpPPL`p/PEP `UcPo@-@P` 1pP ǵp &[`FVT4 O- M40404$ P0 lP1- +  V([V1$P@( $P1P U @$(#PPr 0zP /ㅻ@P 00 ?/00i?@0` 0tq` ,  Dg c 徴@nra1 p@}00000 P0 P 0P已Pg +R 0 0 00 0P0U0 0S Pj  @P ,#0 P 000 001@P7 0S@0+S-S S* S 0U$ V 00P 0d0P  w RC 0 Hy   0Y  ɴT[P   V Ṥ 巤0S  V $ X ax,0SY 0S75T$Ѝ0 S \%*/4B=J\m{p@-@ P\U T` `VP PPP PP\00p8@-0P 0c @PR ]\R @ R^\U \\P [\r  \8P @\Js@-`P 0 0d0@ 00k0 |E-`@VPX)pPPf`Z@d@-0p0 C R@P h'$S0000! \S  \S/SR00/wPP` v00  We0PPdpp@-0`  B RR0@@P UUT4a UPPSU\00pG-Te@Q  @M@+@P> P@0\S:0S0  7嵹0pS, #S 0nS000@P  (=P d0@,S@ [PX @0!S$00$0pWYsW&p@Y  0 0p>0 C R 00^S7 ! ppd / C RR  (gS ;S( IS #S wS }S pS  00^S $00$0Ap 0pSp0S 00S  W RჷP# 0S0S cWp0 S\S@ 0C0SS@WpQ00 AI@kZP 0S0S j&0wS@W 0%0Q@P `@ṷpPE D@?yW5 pl  0p 0 p H0  0 R Q @|Plf0P0000S00pr(NRp@-`P ϶P@ 00R r\Q 0 D K0|TPp@8@-(@P$ V0Q008pZ@-(0( ᵤ:@Pp%}8@-D@P0Q@0@000 P008p@-h@|:@-p- A-`P!   B0s3S S0$Q H0S 0 S405:ჴሰp0 ң0 ᩡ000 P0 S0`0pA-pPW W@` H0S 0 S p3p405: δ 1 p0SxpXHP 0 S 3 405:㵴xpX H0S 0 S405:ᢴpᘯPp 0 _  O-@Ѝ/G-hM PkqP0: S `@BP1p0X:0X4pP10e 0`~  @P00Q F T T`dFx 00 0 Y ;hP0Z00   hЍ'@-MP@Pd`0V``"s @.0SS@0S^ ?0 00W0 X@0P S0000 00cvS0S EЍCJ-,0@-@  e0H0@Ѝ/@-$@T0bjdy @-p`#P @0p Rp0 R 0bG-\1@P` WPEUAV00CT;*0T7 @X0p 0G0SS0 W. +X C RR+ S) &X C RR  X X 00G0 S 0a0C0S_W R  0  pA-`p@P @JP  DP0T0 PPP000 3]Pp@-`@dy`AT oPP`@f@ ` ?VoV``p1E-PO40oT@C"80\MV`C"4p0 ⣝V00X0S' | 0d0 S00͕ JJ T xC T d <X08 1! Я (4`p$Wp! p1|@\Ѝ$00@-4 @@@-X 0@2@-P$0@p|0p@-@l0S t0S Pt0UxtPxPp@p0~SP  0p0p80@-0 @P d 㘮 P  @- 000P0P S@@0@-@p@-`X0P@ 0 S SSS@P0T:pZ 0@-@80@-0 @@DP* `  P  @- 0000CP(0 S$0@-0@@DTA-@pPUW`0X0ppG p P @T:wP0X0pup@f P @DT*@0@-@Q@-01@@11D0P`p0@ SPT00CT0@-0P@.Q41@`9 'Q0 ACQ 00a0C0S@: 1 Q4 0/Q`*@f0 /S0@p0`mP $QL0@`@0A Q00 ᯦0@00p@-P@T,@400CT:p@l0p@-@`PVTT@DTTT0 R050Sp@0@-@G-P@1`TPp*J40Tp0CZTT400CZ:W4400CPTT0JYTZ 400CY:0 S S T0SSSZ:D0PD80D  P0c"0 D0%T0 S0D0D0c@- 0 0sP03O-@MP84 8`4p&40 S:4080< S:8040@ pc80`c`` `kO>0T0PD `~p=0X&*p W< .pW00WW WO~p0Kp ` G 0t]0pQ pS@p ^`?pp`0Zt` VO i`0`c c0X*`800V:Z8 Z! O~`jpVp*  fU`Y*  i PF8 0XS A⑥*`0 ` 0P0`V0pq ^0HXDoP0X!V`S f  H0  0BP400CU]:<@ D00Ѝ0p@-@`G^PᲬ0L0 `' P P P h PP   P`F0 t$LV @Q`0tt$<Vp<1A-@MH0S `G $0Rp A0G00 0$0QpӐpdd\0@!08`0P 0V`#R  ^X p_    P00P0S`0? U:H0SVL0S L oJHPU ᑽ80Pe0CPU0H0 0H0<@ ЍA` @-@ /0 0L k@s@-$m P P@$@-TL0@84 40 S:40804 S:808y@، @-%1(00@ceꄍ p@-780P@LP$p@Oe@ @0@-00,@ @~QG-`@^@P1P0  ]Qt1@PP0PLP0VPF SO  0RLJphXQ Q 0VF S=  0R9G/ Q @0PP ժP  iP`(`0 T@@T L`S@P ^ P_PP=Z"p@-P0@` TPU |PV mP P0 $0Cp 6p8@-@0@P0P: S@C<PTP!*78O-0GMS`J :S010 114=`p0PEP`0 S S %S0A1` $``0 S S ,S 0 S S C``0 S S 0 BQQ0` C R00`p W Wpp  ~!PpP~@^P PwXPܻ`PPm6ꌠ!ZP \ ؗ=Z0S 1S,;0  qp ᇪP1S:0P@P 0,:05 kPJt:y3@ 0SYh   0SP0S 0S@ x~ Py0S 1P 0 &01 0S 1P t0 &01 A=PP`ɟ1)09`P ^ 0Ip P1s 1s H 0 )S L05 @PB 1P.  P." P01S80PB@P刕p` .` Vp VVV^7X@`?``1W @T ἩP  ᶩP.Y qZ70, 7 7 0tp7 0S 7qZ qZ 7,0AS xcnZX,00CQP200< ၩP6 0S$% 1S60@S "@6 `P pZ#0P@g@@gTƟ!^ H& 0|41Sx T00sT DP5y30 RY$(%A  \ -Pt 0S @媪P\5P`d0”@5@0MK0FD0p?t=0T8\6`T3埔, 00(5PP i00 5b00 4[00 4pS ѨP = E/1 CR`0@0 SS@0 S 0SsZI`PP ppP p1SH3@  1qS1 1 @  0VP ᯹@  gX@ᢹ Z:$p 1Wڕp ePE \P  VP  PP xZL0SI 0S1 `y30SYD0d0 1pP wW<20 (HN0 0T00CU1W0 $0 xR 0qS nS XR QS NS/1W00*p P!1S00PI@P0` 0aP@ 0~ 0@GߍA71V`  uд);KR(O@L,:?bA- M@ ∸ 0 S #|?0S%p?P0St~ 0 S00 TT  0'?P ?P0StZ$ T 0^S񟗊ꬢ t l T ̢ \ X \ t \ ̢ \ \ < t \ \ \ \ < \ \ \ \ \ \ \ \ \ \ \  \ T \ 8 \ \ \ t l @ 4 4 4 4 4 4 4 4 4 4 t \ @ \ t t \ L \  d \ X \ \ \ p \ \ \ \ \ Ԧ ܬ ̢ \ 4 p \ \ \ p | Ե  ̢ 0 @ 0s04@I04@M04@0 L  00CS0V 00CS0 ;PD@0 Wy 0 L  00CS0:04@`0SPPw;0LP 00CS0 a@P:0 a@P :0 ! QzR 5:u'Pl:Px1 `R  BS t!x!t1`|`] a@P900 1MP01P&  PP PT pT 0 CP0 pTP90#P010S  G`s01` 00CS0?8Pt7`00 P P PPP0U*p W00 SHPd8 00CS0;70d R    @   R* Q d QdP 00CS0,h70d R   B  B  R: Q d Q 00CS0-Z%Pp0S0?>  ℿxt0` 0 `J0S{ 0VS00 R`"Pyh 00CS0N(6 0C ?R00 00CS0n5 0 ?R P0C0P5` 0P0u00 0C00PD @5u<0S,P  0P 0P  ?0T4000Sڤ4 00 0 B 0 P` L 0l pQp <T0 S- S &0 S`0X>T =pGWDF,0  Q  y 00CS0BTP WTP P3000 0C0SS2` 0z 0uWT 2` 0kxp`0P S`PPE0P 82CT02 9D@^cgP g0 0 0 0S100 R 0 1P000CP00T  4 0 BQ0 1 00CS0+k m 00CS0J^,1P  BS*  0 00 0q0 S S P\400 0CR000 00CS0-7P`T00y`400CV:P0P S-b40 PH ` %_!  .5<A 00 x@ 00CS0D0XT0  Q XT B t0 P0&sTl ZP uZ&0P 0S0 `VP P BP p010@ny 0CP`tq 00CS0d1bTP``0P_:00CP[0 0C0SSeT 0?1Pp00A S 0a0CS_Q 0$儢0S6  0YTyP 3P Up`E yTYT-(pP cT2 S  C0S S  0 R R 0 2p0 0 P 0 |830dpP 0 np3p0`P@VppW cT 3 `00CP dT2[U cT FdT 0@yTYT D:<4P01``ᥳ` 0 R`00S0Q啳Pz  0G 00CS00  Q   {Pd;0 d0R0d0p 00CS0wh5P`00A S 0a0CS_Q 0埡0S  0=50AR 2 55P0 0C0SS; 0(m;.P<604PPEP-PX6P04PPEl6`LTuP0AQ 00CS0~M60 aBP BABP  j 7P0P 0047P0P T7@P0|!S:!SP t1x17P`ta|VU0@D T7 00 7P@0`P SP 0S@D@dQ  Ѝ2E-00 00@ 04080804 ̹ 40 S:40 80 S:80Z'084 00000x1t1id<@D$*'0bW`P 00T00 `0`0`0D`xs0x`t`p`l`P n@P 00@@0 S 0S TT1pP`SA81@0QUo?BpPip`0P Y  l0Sx0S0U  S R ~Uʌ&P 0 R0sp0`0Vp0l0?PP0S، @ c@-P0`3(1@0$0,000P 0S RP cP HP 00000S spWpph sp\00(0S,P000$@0S8hoдO-D2P@<`ᣟP pp00Wpa ᐟP ; ሟP9 p0W(WG 0H0SS0 0C0SSt᫟0S \奟0S 00H S aHX00 C R 0a0CS0 S R0C0p  IP p l <P p  O ]pW011p1W` (PpG0 R 0Spv| O-P@@p`V$0  3/0pS @@$ PX$0:S/0+S 0/-S 0P/ P/0PS/ QP/0S/0S/0  0+S!R-S!Z(P/QP//0+S -S 0 P#3/ 0P/P/0-S+S/A-@P `m 0qs  ! @ 0G-PxMp0h0t0吹5`lu 0@ PpTfPg Ppl0p07p 0 h0l1WPWt00#t0Q W\%0 0t0hH"W4%0 0t0h$W5   7 W0t0h W 4  h "W84@ @ht@zPpP@0S0 ;R0S 0P00PD@HA 0H }P@DX W!@0 R5(Q R0)Q R0S0h -pFl30P 0GS hH Wpp@ p Wh @ Wh(  =W"h 0bS: cS: dS9 pS> fS9 lS : sS9 R pl"״0~WhT00p0 0@%PlWhW WhR W h pP00RW hp90 0EWh  p.0S6 ~ WhD  p0S$ _  W h|00pr8:W hm00pc9 PXlxЍp$  ( Q k  ؾ P x / T l п 0 ~O-qM1P` 0@g P P -R !R Z)(R0S P1SUL1P01 00E010 0$> P 0B0 0 Y[00嵷 \P0X00IY P:90 x000 X p0H 0000.pPWЍp=z4 8@-P@ [P0 0c< +R;P8-RS8S8;P88@-P@ZP0d +Q0c PP8-QS8S8P8QQ@-@00 03yP0S 0p3Ѝ@- a]p38@-@P᭲P 0S@Q 0q/S0/S R  E]p38O- M0@100M, p `+0,P眭( ᙭( A 00 ଶ0 e  40 P40 ,( PJ(0|@0P 0@0Y0 1w7PP?@w@Pu3 K0@-: S@VZP&@- W6L@-G-0`X@P(0X'ʠp 7 0S ᦇ0: S0X  R0 рYX 0Sp@-@0T@A-@Q`Pبp0S0S 0S $ 0DR tm00 0$@S X, L00 @ ,0 ,00$ SAQp6L O-p$MC(00)0P30@ {P,00,0 U:0$0(00 $0wP X 0S 0000S0X (3(Z* Q 000  ,  0Z Y00C0I\0 1S, 0lP pP `KPP 0P`pP- F PZ J p P P1p0 * @ X&@00$00(p 0 $ : 0 0 S* 0  0 iwP!$00$0(0p(p : W  - pG0S 0  0 aJ`p007W00S 0Z ``P`0 0  H0 R D,<އ$00  0,E$Ѝp@-M0  #PCP#PL    ,( @< 30   ""B R "00000Pܴ 2B0(`100V w`t20 p`5pf@PP 2 0fS2@10  eR     0( 001R0aPx8`h0S 0S0 0X1P0    0 0D1P,p 0-S0S1,0(p0  YP 0: S0  0 00 0",  0+|0P,咱pPx00,Ұ00'Pl0S 0S0Su3Ѝp%д p@-@Pd`P L00ᤰ80  p$0,@@8ppO-0,M0000`P$ L 0? @ 00S0($(4 0040`V$!`p+@ j5PZ+p 剪PXW5pe *% Rpzᕳ p $!L5 @ 0 R0 YSQ  S ៳0  0R! 00IY A .[ 2H0S 0 S 3 405:  L<2 嚓 0S@2H0S 0 S 3 405: ͖ 0@. 台1yQH0S 0 S405: ; @ H0S 0 S405: * / Pp Ty[Y[3 P媯00PUP~PR|P R/Bݳ}PR{PP 0S{UU P  0aXL P40/0S00/P/@-@M@㭜0000c000000 0000000 00002= 0<000008@Ѝ;A-鬀pP`@)P  P000S0@T @p),I*  AD*K%@@-~-@-@-d@PDQ-N[-p@-M 0P@0~0 0aP`1`#0C d0 #uT us 0 ` 00F0C⹱Ѝp@ Ѝ/%_@-pp @PN ``!|@XP!x@L@!t@0!p4 !l$$!h!d !` \2 0PS! !`P 00S 0S  #PP幬P0f  ;0S Md v T T03PAx` erD }%u8@-0@S Q4PP D00嫗8 0F8@M=M80@-M@p἗-T@@oPP yv T000000 `0h 0S0PbP1>Q T \ N1 1)D0@0\4 0ߍT0@-,M , 0 깦P@ ,,Ѝ0RR 0 PZ-qP( 0 . 㪰' 㼰P'0 Sd LP 0!!T 00)@0@ gL룒0p@-`@0 g 0cP PSxNP 0 0S@Tp@- 0SSldh0  0SH@0@00%PS 73#P0@- \M@ lP+N\Ѝ0&P @3@岕PiO$PP  TPP LLヮ/VT PMP U 徥PṶzQ|xQ hխ ~RP4P,1#R $" "3PU 僥P ~P 01S0S!tPu ᎔n :PU% h+@@`  P+01@0C+@+_+\+  @@@@@ RPP@ P ) 0d'#N! fVa*lx s` D p  ( @-T0`L0LPp宿4@P .㢿p` @-@L#M< <Qt  M @Q&T0@-@0S@ 0@N P )Tͫ#@@-T4@4  T,0,@, @(0  gE#!C#KBP0@-@lMT0 0S Z. @yT nTPPlP  SPT0LH0~ yT\JP X럧lЍ0erm@-@T0 S S @@X00H R  R4 5:ᕐᚌp PyT蔲/@-|qM0PS@`RP1  ᴘ᭘ <<0<<0H0^?p<H0H 0x 0IT )I0`zR 㦤PP P0 R R   R0T Ix)  %4Ѝ,  8@-@PPmPeP88@- @P000S84/8@-|P@-@P@荪@-}P@-@P@耪@-@oP'@-@-@8P@-@-@9P {@- 0X n@-@ pG 勫@聫@- P008@-@PYPE@U8@-@`MpPP   P AP@0SPp@-@`P (P ,P@0SPpQ 0.S0S .S0S /h0p@-P@` P0PL0 03Pp/PPp`ὨpO-uPp%WM5@0p`3/P` }PPx500S = QP & QP< 0: S[ pS P Z 0: S ȬO!KPOOPPdg Z/QPp aP ,  P p QP$QZSHP '` 3崃@8/P@ @ P8/  SZW SV pp P JP$ @ PJP] PV`2* R` GPp|G|WL PB6  0QP pp6P$ṧp.0: SC iZ 1 0  @ P`ڀ : SX`PW ~NpWᒧLI  JPC<X ᄧ> S S  S  S)HJPpɫp$ 000000NP ] GP0t; 0PsGPHH G|G ЍX< : "*Ie# 4 Pp@-@M @0xS*S0S,1K?0B <㶮P,1S@l@0S@ \fPP@   `4@p@3I6 ލpT8@-t0QpPPP@ = T0<T S00 0#Q1  R8 @- : F@P,000S刦զH d @- /@P,000Sq徦H d A-@kP-NpPVPU gO@-P    D @-@ P0S  0Spᚦ0`S0 00@00C Spp00 C R C RR/S)Z0<w00 w`0/Sq`000C Sp00 C R 0C0SS []`0"S`S`0"S`0 R p \R  0 \   \0"  O-Pp:X 0@x'`- 1%S) EP.Z 000C S000C S 0Pk 0` sZ` _Z0cSpS uS`@0S 0v'PU O- M ` 00:0 @SP@0%SSS;0 0S @ PpP.W 000C S000C SpcX003 R R Q0S&XYlX@pD巍PO 00,3P<0 3᪍P᥍P002sX 0[0004[  0 ^_X)0 cS AS aS pS uS  0`000000oSdS xS p0 0@00#00<0pפ0 0I%[[00X00050g<p7@j0@ @ 0S  R D妤000S$0S0  0  S`V@T+ 0S 08S  Q c&= 00 0 0S00S  0@0SS000 PS0@Ѝ  _ 2   ] Xa d   0@-@lM0P L1L y|P0古0<00000@0@0S= @  / S 0 PqLP0: S S  S R R0 #Z1) 0#xPl0 xP k  0#" 0 0 R00 lЍ0舲pO-@Ѝ0( "p@-(M`@ P 00 $0Ⅴ`P 8 =$0 $n(Ѝp."0A-S 01a 0@ E00S  P @7 P  !g`` R R PV  5P ڟ@Pݪ՟@ЖDp0P0`PP(  @-000@0P`᪖P@^pPV P 0 d P 0 YZ50( -7@-P0S   r@P0 L c<00 Þ0   {>@Ѝ/(%_C-l0P@T fX 0=9 SRЁ YXP7@-@ pQ0pH`0P@0P0`T``P`VQ=`6A-Q Pf 8& TP!@⢄0S8\( 0800A` 7@-@RhM @Q ~DDP  PhЍp@-bM C `pD妛P P@,؆Ĺ@TTPbߍpB"=P/ @PP/@-@X @L0A-pKa>@0`P@ }6 Av05G-@`:60 CAX㰀0 . ^ 0P0p C \S0p<0p0S @'P"PS0 P0 S$P  Q A> 0Q0A>0x0Gx  &W&W;W |W  8CW00P >R<R>R|WA>00pW`S0 `P spGPp0pA>00 0S Q   Q{QRpS00A. QA>000)S  R}SPHpG5>000S X  W0 R00 RQ  p8C8 S S<S >SWppW 100cS 100dSp 0Sp 00QCA>00 0R S<S >S|S &S B Aq 0'S"SZ63 A>0@@0 zP@ @> VkX `0` 0S 0S0 `  ``DFB΍$44K0B440?4>d9d㐬d`$P  "JP@ p? p EpT Dpn p p p0 pE pPy P& | P P% P6 P q P P lP  P P dP P P ]<@$P@[<@00 0S^Cn`tK ,0S/<4pP8 Q0 @ s@TK^@4 0S :S0SK^)P:\0P 0SPWpP;@:K0P   0S @4@ fK^ P`@%@&@P\ U@ PL0.S 0S 0 /RB0S?0S<xJj( @{?P  ?P+h: 040R rp 0  8 @* R S/R/   R 9p,0 F00A0,00ѯ#@pPo? YK>U ¯l9@,P! 0P)`X Q ᓐPP᦯,0 `00,pZ8&0CV:11P0P,0S 0 R(,0SW ~0P ,^   R:0P`( 00Ss:@m @U0 S/R    L(P`4``c V!7 `C~0`~ g 0p`4zl [g7/I,0SF 00SC  P `:0p,0`UPVPP-PP..P.QP` 㕒",0 0  ` 6(k 0[  eR, `QjV! 00c50$   kk500c+,p5@0S  $ c  !o0S $ 0CP0S $ 0CP PP 4P0  l4Ptl4@$P0S  P #P00C P P0S~ 3@$P0Pv P P J0P Pk Ph@mc30@]u4S T$PT`3 0@ y4S T 430 R @$P @G" 0Ds2P A0S3` V $A0 0!&p f!Ž$0Agf T B?$0S0 0S pW 0͎P T0WT ۭ0pp W 00p0 ppl Pi ll!<`Pd0 00᧎ 00p Ř֎ YN1p0  <R FZ93000`I0巼  岖 P  j0X g0 8P0   xp8p 8 =` ":"A"%}pG_WHZT40  000  Fih0@넖@Ѝۍ000`0S9=00OQ/S00/0S/0 0S/8@-@PP @T80@-S@  @@-@T 4/0S8@-@P@0S'P88@-@P00P8@-v5@5T,@ᙰ0S ְ"x p@- $@P)w&wp@輬ꌲH#p@-)M@`: :h+@Pk W P0 11!\P%Pb_HH0S 0 S405:yunP hP DP dP -lPP, mPA_) &sP P% oP rP PP tP vPP APQ_P[b_ 0[b_ 0[)^el0vH0S 0 S405:|yupf)ލp"Q#8@-P;@PP 5PX8LO-@aMP!<;P 6;P10``fw1ZZ`p  ZFi w;PT1: SP ;@P 0S?  ;@P 9 L 4`P" 0S ឌ@ P3 1- 40P 040P`  4 P⧌P0 QP `ߌ0SV  @`@ЌV0SZ:0Z⏕`x`3aߍZ#LLL0@-M:PP@ < s4 @P@8 埔@ᨌЍ0Lf#O-0lM.SPp0SPS @` /S/Z Z 0Sv 29`@ -9T (9`4P000S[  :P0: SZ Zw 2PL< 8ґPPT 8lЍm###@-p``:V&Z#: $pF^`P@ 0@-@QP 0nS0oS@P Ppڋ` zP0S,S ,yP@P%000,00(00$0 0 0!00/#EgܺvT2O- 0LMP00 0@S `0؁q "  డ0 `Sy  `0Dp`X   ,  "@   ` bVy"p 0 q aW0 0p0 0#Р000 0cXy3`  p`X   * ` ` jVyp  0 000@  LЍ### #LG- 0  @  b 0!.100`8SP\Pp  )`@V8pU FC  G車A-@!P 0p!@``U`1 ᩊ00@S0$00PfpU 6 00p@-0L0PlP-`P ` PPQ@0Q 0PSPS p8@-P@zP {P {P88A-`PZ;%Ꮣ@ዊ0 r0S@@`p `FᅩO-`Q@P kPXOPDI0S P$@ Pp`W50P a IRPA IRP0 I RPP 0Mx0P [Z0U'p0CWXX T 0S P ,,"f## $$2$N$W$o$8@-@PPP8O-@<M#4`PPp0j 1 0 00 ỉ PZ 0S 0C R  80 y0S R  ˒+0GY 0 SPx x0S {wP0 R00 S00 My0S RY0 Y  ᨓ "Ѝ$@-@Pwb@茨@-1/@P@̪ G-0P00CS@  T000S0 P0#Sg hp`,SP] 0!PPp al!QT P-Z+Z =ZIX,10p 1Q+0a+aP`IIo`II``V 0QXR  R 0b 1`0S QV X55 ` -Zpp0,SS0Sp$$$I@P0@-|M!  7PP 6P00: S00T S0 h@ z 0  d |Ѝ0AE-p`@P0 Z@@  d0Pᦈp@0S` 0 0= Sp@-P@Z<?rPPU{P U@PU?PH0S 0 S^ 3 405:^5u^qH0S 0 SP405p8p@$up@q(00@- xR 0 P0@E T @W@D T:\ R0C A$T R0 R ( \0 \ 00$  000C0 S'0C0"0 S/0 0@0A   Q00/0 SQ/@-$M`@P|pUd E⼒P000P: sR @0S 00ĕP@DZ 0d$Ѝ j@-@6P 6 @@-@000@- @ (p@-@5PP` b`?  pG-@PJMMP/p|`@嗏p000 0C 05p P 6`P C6`6`P@b 㩌0S`Z 0S ` c dh :0(`D F  c` 5P4804<04F0 S`t u  P) v0(J~p0 Pu h 40d0400' , 04@4:#:@04@&00D0 0-S `J~p'$  0300Sxd0ZSW0 0Xe0<0N0 0f0  auF _Pw  uP  ⵌJ>0Pp#Pe  uP  ⤌J>0Tp#TT T ~uP ⓌJ>0Xp#}XC  muP ₌J>0\p#Z=*l\2 -tP, J 00p(LpIpg'uab| DuP `aPwXH00H0 -XL00L0,SP`0p`p  n pP _  tXF ⩏00S N0 0tF o `PX PE  P % Ѝۍ$$.~ $$$%%u!%,%~)A-0@`P "R0S00 @srbP8/P Sp X (  @-@q 0 O- tM@p(KdP ԈKd 0! (dPP1dP# Ṏ|KT 〒倢` !pW00g @Paᬤ(K ʌ(`1`FVږd@# * 00M⨁Pq S01 0ea Р`K0`p&G%0`ptP dL!0X a`Ԁ0V 0cS `0 00`S @ pp`00Vp0S  ԈK@d R 0RTQ |0n! (@d#PV#<`R#<@#0 40Ba K萲` 5%B%~%J%Q%^%k%?./P P./%P5;/p@-@`P$CE`VPZpzP `P;@/ZP@P5@/9P-P.@//p@-@! P`%%@pO-pWM`0$SS X@᷄ P   r$00  H   Q q@T Z>)@DTQ W@Q @TQU Q |(# Q  r#Q  iYQ Q `@ ,TI1 @PT10 0 C@TO < QWߍO-@Mp* 6Q`-0X0n$0 P0  0 rPP 8D2 $RPϠ35:$R !  `Q`P$Ir fP1# ` xr$ 0 00P $46Q00D4$@4@ 00 p2/ 4/ n 4/03/ 4/ 4/ 4/ 0  0@>T*@Cύ*(Q>P0?@(S?(2P  T 0_ ".㻂 㷂 ᳂ ߍɚ;L  H 4 A-pP@`/``p804``FF pWp f_n⋻᮴~⮵~⮶~~⮷ቒ~⎓ᣟ~⎑⎐ p)+p+). z'zpA}+@p兝}p q.v.}p}p p@Q " 0`V"H q# p͎ ""##(0 p̓ pRπ  pρ  p͂ p͉ -!1 p  =̓ 1% )15-1 1 9=01'@[$W T `$ЍO-0@$S0S  $R 1Sh N50CS4PU3'!ꆒß墐 ,   @R@0@S # Ps Q `00d#  B 0@S<3D3P,3U`0P0 `00@S`0_008S( 0"  '000S 0_ꬒ  圲Y I ^ Q $a,  8 Z@$ X X`^BB( ḁ X X @^Q  ` 0S q0!  00 S0pppqQ  R  0S %, a h0Pl 0e0@S $`0P$"0000@@4 hHO-MP`1p00P  .Pg@P  X@]00x0T2 GPD 00  0 0P R7 0=@  \00 R00рȟ)0S2 P   ؉ P0 S @TT@00 Ѝ%/O-ȡ|MRp SW00!1@0`P᠀3/P @R p100SMm-PH 0: S  09/ 0:/@90 0  0:/P* P@, B.P@! P 00 0P @1 .P - 0S  0:/P @@|Ѝ@ X< : A-hM` @-P100SNoJ0: SKCP$PrP t1tp1 0[lPM -pP( P P PPҝ$.Pp-P 00 0ZFP( L(P$iPP G$P0: S rP L0`ZAH0 0Z"P +PPhЍ"%%&*&@-@,0#S e~PZ0Pp@-`QP Hy@@v?QLVP )T Dj3Qp(x8@-, @P~0 ҅0 08<& p$0p@-S@P <],Pp,W,Pp00p@H&Q&[&0@-M⫄@PP"  ~PP 0u @ 0C0SS000@L  lPP  f PPPnWЍ0i&&@@-`P0S RppV lU`000P0X 0P  ! ᖃ -cM *E1ASQ Ԇcߍx@-bM *A0ASA @Ɔbߍx0  R0/R/ BlA-@P`pd#P 喅埇U 嘝PᤠU xៅl0l QhV0S D厅<勅0刅(A脅*&} 0&800400000,0 0(00 0"0h0/#EgܺvT2 @-D@ 0<@@`p@P Q@ 0$$d D A-P"p? 0@@``"(  |h0p@f3/@`T* A|0@-,P @0 "0h00d < !,8,#$ <$<!4 0@-T@0O-@ءM!Ѐأ"#bPP" Z'^F?Pi@آCC ᬮH匡ᨮL娩ጦP嬩ሦTE ؤh`(d + ],à &Ġ̌X"Ġ̌\Pό*@`*ό+ d ؅Цc )#04 C (ZB() P0SiЊ@0@0\2أ &97h0'97l0&79p0'79t0G& 0#[TxP[T|P ا " " 0#آ!  "0 0#B! "0#A  _)QP _(QP(^ RP)^R 0PH " 0#Ш+\SP\SP*I* + 0ФB 0 \C P a`0@С  0 ! 0!!ؠ 0!" 0""آ 0"# 0## 0#ߍ G-Є@ 0pYXP*$ 0$``P {pPf`U* G{O-@ 0@PȀP P` |{UD@0D0L >000H0q~aUPP@U  ЍOJ{A-`  ?0@(`p( @P` B{U$ 0qh03/Uh P0R  0#̠̌X%Č<4Q0:!A{ O-(SM0 @"̠̌X%Č,$ 0@S<0M/,, !4 ! 0S0"`0p0 |!0 %  ,-PS a` Pp P`P0,`0' 0# V g1p  P`pܠ  Pbpᭊ P 0` V`QO p删 " (bpᭊ P 0`V@   00 0 0 PPSߍyZnܼbO-(AM0 "LLX%D,$ 0@S808P@4 @XY%,% CbI$!$  0S 0`P @ppp@pZC csu'|'p*,  p(bqv'b{' T p  P `0 @     p p000`0`PPAߍ 0/@-Pp@` P`@U@- ؔ @9&7@-P Д ᯔ   @&>@-@ܔw 7@-P Ṕ ᘔ  @&>7@-P ᱔  @%> p@-M@P` y`Ѝpp@-M@P` y20`Ѝpp@-MP@ y`PP @`PTЍp0 /Q/Q .Q/\\ .\ /\\S s/R QS /R 0 /8@-0P/SP@ Pᨘ8@-0S  R |0@  P00S/0S/ p@-`@(0PV @TTPp  ACQ 000 0S/p@-0PS`Ry@@iPP@p8@-PCy@0@DT  s B RR0a@ x008P8@-$@P0S S@T8 P 00S / p@- @1~`000SpL iD`PP@UiPpP U`p& @-LM$`@@D  pdPx`0$0h0(0@0,0000040 0 80P@P 80 S40S0S0000)S 02S 0 0$QLЍO-TM|Pp WWx`倐pp @虑5 @ HL  bx, ZD^x0S 0S00000 S 0 S00 0P0 H 4  08 < , ,`0D@07TЍ7@-00P@ @y)2 0@s>t 0A-0MS`  0uP,@Pጝ pH 0 ppP]OPP0P`V Z`0 0C @S@ pp#O@00Ѝ&@-@!Gp@x@-$@0SP!O-M,@ gခpP`' @w,`w0S( Uxe~P0S```P4P-%P 0S徤PUz}0%P@?HL L00#~`F-00P$P 300S W}+00090 90**  $&P@D}0`9 @Pf ( If0P  SXY"3 aR :}"2P0 C: 0f 0l p0|Sp2 @wP $ pSX2$0`8fpP [`!00pScS(0:}e0S :Q uep $p 0BS`"V p@!Y d100aSp, @100dSL  10`YaV`` 0S`  %0 0 ^^ MPc P #` ?PוՕӕЍP#% &,&&%}` 0%_'Q' p@- Br @ r@P%QP`$R`@RAP,CZE? @ R@ RAp@-鏣PR|멒@-P ~ vvv$@PU@Tp`P "v@DT* @-40p@`P #p0S P@- p 0 @ 0<<S @-_~0 0$vP 0l40o00 0i 0S0 0 Ѝ@-@@-@P{,0P 0-S0S ~/ 4 40P0 -R R `|/ p@-P_|p@-P~@Y~p@uO-0M-S+S@P8`< 0C0SS005 p 0呙0S* T' V  uP? P *`pW0SY00Y03S Ѝ0  0z z'4'@-`0@+S-SP10-S11 0-S`P00P0S  ?`zH'0@- 0!1@-0  0@-!01@-0 m@-0  b@-  !@-0  0N@-0 H@-CG-M 0`-S+S@G 0C0SS00@!p 0卙0S@P4 V1 X t0P  QP:@PpW0S#UT00UT030"S Ѝ#  7z 4z'4'@- 0  0 Ѝ0@-MB @Ѝ0ZF0@-MB@Ѝ00 S/S/0 S S//@-pM0Q0@00P 0`P|P `}0 S:mbP   ~|Ѝm' @-@Q`P  ypPP @@ | TPPpv}@PO-  Z ,K⌇P  }0000,0P0>Z   p@-(MP`@4z 000 ыPP qx(Ѝp'l0A-`@P@P{@pP0"S ᧑$XxrZG A{'@-@P%_A-0psG@`P !d{ @E !1P 0 6 0EW 0(  15 0  0- 0$(& 0 @P 0 0 0  0  ?W@Z 6@P(0 00R FЍ,0A.@9B.@u<7~Q0-IB.??1+eG?B.?v?Фri7f>kA>,%jV?lf?>UUUUU?M-@@ş (MQ 0$@Pp` S 0@- 45` 0pW2oF`FGjtv!0!j 4046S@PQ 0P V >4$44@Pp($`p 4i 0y 0^#3W 3i 0 OV  0 t#t3`p@h#t3: 0 J 0F 0 1@ 0 0 0"2"2( 0"2! 0"2 0"2"2 0"2 00  ``2 0g Z; 1 0V  0 0  -!1   0\!`pT1 0 0   0 0.V   0 0 0  0 `p0 0  0 0  0$ 00R (Ѝ0PPCd_ ?B.?v?˖dF?Y"$I?UUUUU?xZI ?xq??Q͟O-= 0\M04T0= QP@P W 0 L aV RPXSQ  0. -[XpXHAAQ4a3qSppg  Sp?aXqXppg!pS5<X160 |<VZ@ PZ@Q<<XZ$ 0IZ 0 <ZP ;4T 00R\ЍO+ 4 R0 V R|+VZ @P\ B@P Raf` WQ꫿K L 0 0(*X\:XA3CV :VZ:VZڰ  0 p: ":@Ph *|:b  0\ D:U @*@:g 0M 0\ 0 C *:@ 0Q  0K !@PE 0 V   9$ 4 `/B BF*H dp)fV\)V@HHH@4 89 0!`" " 0 $ 0!I0Ȁ0Gء0 @P 0 " 0 0  0 0  0 0@P (7 '7 0 '7 0 '7 0 '7 0 '7 0 @P  0 0  0 { 7 " P 0  @m  0h 6u $s 0o Y 0 ZJi  0c "l6P@H `&\6B #Q 0 L (&65 0F !D H " ": 8 05 0 @ 0P- + ") 0% LpG |4 !` 0    0 0  0 p 0 @P 0  0!0ğ Sp ڿ460D$4   0 0( P #3 #3Lğ ^@ğ   0 0  P $ 4 #3T3aV`FjoF6`FSfAAAP1dfafVaW `f  0  @ h3P|  0 0  4#43n 0# 3g 0 w  0q !P@l 0 g 0 L "2G "2X 0 ? "2Q 0 7 t"t2H 0 / \"\2A 0 ' 06  0 1 ) 0  0 0  0  0  0 :C*RPP 0 y 0 @P@LP@P804T 00R p:\Ѝ0??C??AC?u<7~G?D] T>пUUUUUU?+eG@Cy 81NEJ(~?eɓJ?A`t?M&Qo۶m?33333?@ ?[/>:@G<ː@4o?YnC.?9B.?9l a\ Фri7f>kA>,%jV?lf?>UUUUU?G- b 2`0Ÿ0 \0@P0  0 0 Q a Q 0 0 @PVCZ5PE*S 0 a20!PPa_EPEZK466 00  @T0dТO0 pAPXP ZpW0`R0C2 h ᢏ@0 0 q00:56P@$0 00R o0G-XdX4`0q0P 0@4@W0$W  P00S  03QCS@3W o7CW\#3 38 PT J3@WP+ 8CW 0 3 1 0 S pP@5 83 3 0 @ pP@"2W 2 2 2 0 ' pP@  0 pP@p 0y 0u T"T2p H"H2 0 h 0"02z 0 ` "2r 0 X "2j 0 P !1b 0I !1 C !1T 0 ; !1L 0 3 !1D 0 + |!|1< 0 # w 02 0 0'P@#q 0 " 0 0Z@PA(0 00R TЍ0D!!?-DT?u<7~??@?":? v$K{?Q=Рf ?n LE?$I? UUUUU?/lj,DR-ޭ?mt?q#q?똙?h1@-@@ M\ 0`p 0ڬ\ P P P !B!q!900!f 0 00R  ЍЀ0!?<07@-8 00P @  0R  Ѝ00C-hAh1@P0\!0 B*0`p0 10= $1]!` B*p06 BZL R 0d) R UR46z5r0U 0 0 0 046 6zp0 $`p(0 00R ~ Ѝ0PCRO~>>wQlV?LUUUUU?23????ɟO-@)  M d")  !(PDC$ 0pG'`i @ V( Nύ1C@`T@ 0 0f!1/Cs 0 ` Vښ1?C@T`@,P1?CРP` x8 P/\8 H 0 XPEύ1?CT O`U  5, 7( 0 8 0 -W 0D1T` gVbFT`0gVc 1X`k @7^P`V?0P!UTP`TP`TP0SWW W? D!T045 Dύ!T045T0V 0hU  HM 0   0PA 0D T0C SR4/0h1T0S P#?( a 0\F` 0f!1/C 0` Vښ1?CP0U@  0 P,P @D1T0pGS +  g 4P ZN x4 P/\4 H0  X@?Tpύ T p1T凡 0 #뎯J  3pGWpp#0 1!?C  0 ` V0hV0hύ1f?CHX`$`P񏐤p 0!  pQύ1f?C @D TV`p`!f/B  pG0WV ! $" p/1f?C pWV 0 YG?aqfGfoF ! 0 pWpGaqfGfoF ! 0! pW ` ύ1f?C y@D TV 0``0```pa 00010000 1 0 40 0d"0R `~ߍd01p>p ??pAhO-b$M 2`0@0P01SHpPg  0 0!1  !1 0 x!x1 0 `!`1  0 H!H1W  (!(1 0  0$ 0   0 0   0  0  0@P(0 00R $Ѝ\0|Z:=+Z>}W>a*??IUUUUU??7@-@ @ 1P 0@\  Ѝ00G-qAjpj joF`FV 0@P'VH!H1 0P= YP@91P1UP@2X/ ZO 0g 0P% Y6SFP@3V VW 0F8 | |0L 0P YV@ 04`fV U@0P0  00 0R 輹0u<7~ Q/t:Pkl ?o/o0B0s0 P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/PQ @-@A/Q  aB Qp 00`BSoq /oo @ r S?C S?C S>C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# & * Z>>*S 51:3`//// *& *Z>>*SJ51:3//// 2RS"|"!R/.&/* b b<0ZQ&55 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1SRQPM`-=Ѝ /SRQPM`-Ѝ /@-Z@- D0`pE@ (0 0<  Ѐ=C-@P`p9T$ 0`Vp 0`C-@P`p T$ 0`Vp 0`QO-`MSS@P3R??oS c0"C$S hx'x % SI* SI c S  XXWPJ*WJ p\BZR%pV 0 r0ЍR.@oZ d($x  ! % SI* SI c  8#XXXPJ*XJ poW g201;(   e "Ƞ'8P0Kt:@` 0 @O ("Ƞ 8Z0@D[:j *Ƞ" H"(Q:Ppp Wt Jpq r0`0p`* pj57J;$x (" ,8R0K(:b  Ƞ ,8R0I*RI0 Z bM\R!0-Z0@DPK0RK0SO-@ M`pP3R?oS c0"S%h IH$H ( SI* SI c 4p ("TpG*TpG SooV~ f20v4'    0 H #6 RI: b  0 P t 8#(0(T PE:@d )#X  " (,T:RQ? I<RPoY6@e!%x`: (( SI* SI c @ ' Ƞ,Z@D*Z@D SR! Ѝ pi8Y4g%x* ,hHS@K :@cw`H$8HR@`F*R`F@@b hT PEo RIWSK@p@-p@0Q@M`P    `Z080800 0030ZS00 0MЍp` 0@S-0*Z0  douwppP-P@- J,Ơ%F @Zp p p01g0d@-!p p 0Y0 b  蠘@-|p p 0Y0 b  d@-@ M  @@@P0S Ѝ@- p p0 0c Y00ကܗ@-!p p0 0c Y00က蘗@-p p 0Y0 b  X@-=p p0 0c Y00က  0 R  00 \    R//@-p p 0tY0 b  茖@-?p p 0eY0 b  P@-)p p 0VY0 b  @- p p 0GY0 b  ؕ@-0p p< 7Y ap p ,Y aꘕl@-p p 0Y0 b  0@-!^p p0 0c Y00က@-p p 0X0 b  谔@-0 00@S p p l0 b0X @bp0 p 0 bX @0ᘀ_\@-p p0 0c X00ကȓ@-vp p 0X0 b  舓D0D 00p@-S@p@#P@pВ_@-`Q@ PpP P 0X0  @%C PpzsPP p p`0uX0a PVTTv@T@Tw@@-p@-p@-p@-p p 0GX0 b  ؑ0 00PZT* / @-Ap@-@p@-`p p0 0c %X00S`X@-p p0 0c X00က@-Np p 0X0 b  ؐ@-p@- @p p 0W0 b 㐀舐@-,p p 0W0 b  >L@-,p p 0W0 b  = @-Z p 0W0 b  ̏@-O p 0W0 b  萏-@-0$  00`SP @ 6p p |0 b0W @6p0  p 8 bW @߆@ Ѝ/Ȏ_ ؎@-%p p0 0c nW00က|@-gp p0 0c _W00က@@-p p 0QW0 b  @- p p 0BW0 b  č@-@Px1S A rU@-!'p p0 0c W00ကD 0@-p p 0W0 b  @-p p 0V0 b  踌@- @p p 0V0 b 㐀x@-p p 0V0 b  <@-p p 0V0 b  L0L 00p@-S`Pp@@@PpH_@-"p p(0V0aP@t l@-p p 0V0 b  @-*p p 0V0 b  @-p p 0zV0 b  褊@-p p 0kV0 b  hT0T0 0A-Sp`PAم @Pᯅ谉_@-p0 p0 0c @V00ကĉZU?@-Up p 02V0 b  脉@- 44Xp p0 0c V00ကi(@@-&p p0 0c V00က@-(p p 0V0 b  輈@-@P` 0S0  V0 P100 00 0p p 00U0 b Tp 0s00T0T0 0A-Sp`PA? @PH_@-@P 0S0  U0 P100 00 0p p 00U0 b Tp 0s00L0L 00p@-S`Pp@@PЄp,_Q@- p p0, bU 0c0  c}U D@-p p0 0c LU00က@-p p 0>U0 b  贅@-p p 0/U0 b  x@-p p0 0c U00က@O-xA t1 M@00(0 X10S(M `P0  MQPP `၃p p   p R0 p  P R T 0c0 00  R 0T0  0S:  p p L0 b0T  0( 00R : Kx0 X ؃@-p p0 0c T00ကh@-p p 0T0 b  (@- @p p 0T0 b 㐀lE-h` P\p(@ ЍE` 0@@ʃ Ѝ,_@-p p 0]T0 b  0@-p p 0NT0 b  @-Jp p 0?T0 b ZV<踁@-hp p 00T0 b  |@-9p p0 0c T00ကD@-ap p 0T0 b  @-p p 0T0 b  輀@-p p 0S0 b  耀@-Bp p 0S0 b  D@-Op p 0S0 b  @-p p 0S0 b  @-0p p0 0c S00က@-0 00@S p pp0a0S@p0 p0 a S@ᘀ~_4~@-(M 0(0!P ` $P@ S`@ `PP60PS 7TSp p/TS )Td $TT !D 0p !Á}rrvvv@-P00.S0  0 0Ft}@-sp p 0S0 b  }@-Wp p 0 S0 b  |@-Sp p 0R0 b  |@-$p p က0R0 b 瀀l|@-p p 0R0 b  4|@-tp p 0R0 b  {@-@ T@-+p@- @-lM0p  p@40@d0Q@@P lЍ␀$u-@-00 p p0 0c P00@ Ѝ/t@-@0t0MP0P0  @  l@ep @f >p=0@0 0;'>QC00: @1A0 010 1!M_[_00.00 ;'> R 00; F?$>[ @00000 S>000S@;00`V0Y0D0q 0PЍh$$~)r-O-0lM \0 0`WRP@ 0R @7 0 p00# 0r"700S2 ǟ& Vl1` Ⲑ0i)  0 6M0 # A! B# !!" +@  0+H+  0+<00P000+,  X 0+,  T  D(0+ ?JP Xp :  1:ppW 1 0 0;00 JP :0w P E/P}  :P`tEWq UhePP GES$0$!00R JߍLY0Yvww s$Rr @-@ MQ0 0 0 00 0@ !PdQP P < A@) R ЍP@- &#$ m9@-@ `$PPPP0<0 00000 00%Ѝp\UwE-DAPQ@P`pF RD #X X  2P6Pp'P h9P+  a9P$  Z9P  S9P l00 0\ I90P 1m8 ?90P 'm`TsHo@-@P0@P ` _yYy0S @-0`0pP0@ R3 R5 @0D0Z2 P1  00 R  @ D   RR00D0S  0P@PDP 0@@ 00  QP 0S:0 00 /N4R 00 0/   /8@-@PfPPPf0P00fP8P@-@Pghp]ppGU` V EG@00D G`V,XG$0.  t.  `VT>$ c  0SP e b0S 00rfjP 4,p`(0l0\ .Z )Z $ZY (Z Z*Z +Z\Z ?Z [Z{Z |Z ^Z`|0 S1 . CR  R\R  0S (S 9 |S 8/R^p S 0S080dP  Z jW pV `X P 0 j R 0E S= : 0\RS0#  )RSQ )Q   S  R |R  R$& S 0S080PdP Z jW pV `X P 0 j R 0; 0SV ( 0 lZ]% 0+Z?ZQ# 0Rl0 *Z (+Z?Z (\Z\Z S 0Rl0 ?Z+Z (l(V2 PH Sf 0S080cPZ Z jW pV `X P 0 j Rl0P0S S (.0.0RQ l0 S* \  0 0R @ e  B e BP S 0S080cP Z jW pV `X P 0 j R \ f0(Q S 0S080ucP U PeWpV`P0 e R 0 S 0S080ScP Z jW pV `X P 0 j R00w SS 0S080.cP V `fWpXP`0" f R`S 0S080cP Z jW pV `X P 0 j Rl00^S000l0P ^R0l0l0(PD0S` 0S080bPT U PeWpV`XP0 e R ( E0ZS 000HpLp P` @Pl RI 0Vl0\PQ S P0l0VP1 ! ]PDS-PYQ ]Q d P-P0C Q:S[Q 0C Q:S[QS^Q ]Q l  -R]Q S   ! 0PP c,[PQ2 :RS 0Sl0 l0S  Vl :Q0]S R  0C >0 :Q08@L ]RI$Z^&p 0D$ p3@ yDp3< P80cPl R  Rl  #8P 0 1  ! V <0@ 0 1$ 00 0 1  ! Y% l  Bl 0IY0 0:P0 0000=RTS= 0Sl0W lQ5 0 Vl0 =R]Q S Y 00(C p0ͅ΍ =RA ]Rp R YZS 0l01 "  l  Bl 0IY0 0=P0 00 00M0'w-w .RSS 0Sl00bPlP Vl .Q]P R  0B0p ΍.Q@]QpP U S bPR  l !00x l  Bl 0IY0 0.P0 00@00e1 !P \I `@(0LHpY  RR > H   0  <  SZ ScbP_0?Zl0 9Z 1ZT*(Z 'Z*)Zq +Z<Zm >ZbZ WZ? `Z BZwZ :{Z& |Z ({0 0040R (`P 4 W0 , b bp Pb b ,p  S 0S080`P V `fXP`0 f R00,00 p  `0 !\-W$S 0S080M`P Z jW pV `X P 0 j R A00 gPaP Z_3 B  p0WpG `pZ `N, j S 0S080`Pt X hWpVP`0 h R0  %! |  SV 0S080_PJ Z jW pV `X P 0 j R k0  'WP  g BpS) 0S080_P X hWpVP`0 h R` <  SV lP{00Ql 00 C \  Yy ))l R,S 0\l 00 C Q  Zz **l RX(z Y  é/   \Sl 0R 0l \0}SV 80 S` P  ` Z` PZ #S 0S080%_P Z jW pV `X P 0 j R  f0sEZ  0Ry R ( 0 ^P0 i Z jW pV `X P  j QS 00f   0PJ00 0 CZ J  i 0&  f 0203`lP U P P+l yqw` sS 0S080^P Z jW pV `X P 0 j R0I W` MS 0S080x^P Z jW pV `X P 0 j R0#0 )S 0S080T^P Z jW pV `X P 0 j R0>S 0S080/^P Z jW pV `Z`0X P 0 j R0 S 0S080 ^P| Z jW pV `X P 0 j R0 Sd 0S080]PX Z jW pV `X P 0 j R0 `S? 0S080]P3 Z jW pV `X P 0 j R 0m0 sS 0S080]P Z jW pV `X P 0 j R 0I P0J, Y^P4 0`h0d `0T\0 " R5 0CS`S 0S080[]P Z jW pV `X P 0 j R0  } ){P ){X 0  RS`3l0*S ^S   \S +R?R+S?S  B  \S>0{S;S 0S080]Ps Y iW pV `X P 0 i R0000PS[ 0S080\PO Y iW pV `X P 0 i R000 Pl RW  E gQ -^P) S 0S080\P V `fXP`0 f R00 ^0PcPP PPP(0$t(00R |Ѝۍ0p@-@`P@PP1S,(P1SYP 01 YPx@p`PP 10 1>P00 A?0P (@0]?ppT*3ws4@-0 T@   @    0  P0@Za%]L)4sO- 4M0@0p(0 0`0 M,80 D>    P   80@T Q U  PEA@Q񏐿"\$/cbxw_^]Z4'000I\Q*Q\Q*  PQړ PQڇ  Q @ @} x VQ@qQQm@UD@f EPPa0 @ ā \%#%*U   U)! M  !80 4 r=P804 P0Q9 @P@A .@,@*h]  0( 00R K(0E-410a@ `pXQ0P0  }X P P3 0 0 0 0Z00000刀0@`lC= 0PPP U 0S p@\PP|$O-T_ MT?P0D 0 (0 0p0x0 0 MS@P H ` dp t ` h0 0 0 0 0 0 L0 T0 t100MT ML M M M M M M Mh 0S{PDp0\0s@P@pILPTp0t S:HP0p03U0S DppD H D0HQDHpPl8 P8p X ŀP DPp X Q00U0SX0HpDp<0 4=@@ap<  @4p |p Zb&p p 04 P x QX0TV HP|DU00Q0S 8PP00<pP0#S | T00  @< XT 8< T   JT8  P@  R84Q  - R$T  @< XT 8< T   JT8  Q@  R 4Q   R 4 @AU pP`lWS pG1pGSQpG@1pG pGpGLpGT B R*U xU%* B R   , R0 4 04, 4  RR 8HT  T 3<pR < 4 吐R%?@P( 00R K7@-00 0 0 ,ЍO-Mp@ D@ T  ä/`H0~ 0dBJ R 0d RS R R Tj0X  0p0^ X T3 0S$TPgT gY PP  PEU Q  PEUQ @@e WT g ۧ ڷY  R PU TX 0 @0L 0P0 0  0@P p 0S 0C@0@Dҥ@@Ѝ@-0 00$0 0 0 \ЍG-p8M@`4  XPd4(0 02(0(0剒@0@ ((0%RZf?P%TPP00U(00 ,@OP 04,00 0U` P0 0!40S:0rS8Ѝ7@-P[40@00@@ 0A0>8p@-@MP ZiP `0 00@000 0 @00@00@ 00$@(000$0,@80@, 3@ЍpE-X@X`@PM DpD0p  GdAd  PBdЍL,@ h8@-l@l0@0Pp 64L0 @U8,P(  8,@ $80@-H0HP0D MP  dd  @dЍ0L@ hE-AP@p000p?0!0 00Pu`` L0p0P hh+h`0ST MKp003 0V0`8@ ,tO-C3@0BM0M4?0S` X330PsPL3p cc03 01 0S0S 2020 !200ap&r0 2`63 P* l|D2`00 TaD p`p:00 00A2p 02 gP 0 P030# U1#Z  I2 2UA^" P"*PA> 0U*0SL100  0 h0 d300100S`1 0 f9yKP 0x200S `V000 3`P > 00 00 a-32b$0$00R $Ѝۍ0$@ h,Rw8 ]wZg*t#-@-    @ Ѝ/A-T0TP0`L Pp  bb  @b@ h@-,p p 0 20 b  + -@- 00,0K p0 0c 100@Ѝ/@-,p p 010 b  *D@-,p p 010 b  1@-M p0 0c 100က@-,p p 010 b  2@-,p p 010 b  3D@-~ p0 0c 100က@-,p p 010 b  /0@-4M@P, 1l4Ѝ0 0@-@0@  [ 0@-@0@ [A-t@t0@Ph0p  aaL0 `P4   aЍdh NEZP0 H000R:040 Rv(0 PPR//tm'O-$Ɵp 6 0TM0 @L05PP` V` 0S U P fX PEP1,%S@%Q9OQEQ?OQ@ a0BS0 0A0S>QZID0?0[U P!@,@ RPt00ؗ0 k [sZ`p  00 00K?\ zR' 0SZZ([  +00$dP00̵ ` <<< w`Fn | 0I1P1PXUZWZ@P 84WZiWZY@8@40 cZh*IA T<I<  d=Q 7q3[O@@8@ P  d)QP #PqP3j[_]Pe0E0T<0@e08@<0@VZPk gZ 7 dcB 0PA倐 d@ c0   q00 100S[  1 00n0 jʐ @  0k 6@0[@00S  @ 0I`FVY 0S40L 00R  TЍ\0NEt&O-\t\M@0pX!0 SLP`0SV $0S$`0X!L R!0S`FX 1P%S0%S OSES?0OS00PQ a BRx# AQ0 >S00 0SV X1PP0 S`Z0P0җP  OjPSP2  0̌J @jTk/   P R T @T R[ 0 00,SX⋱ L Z S -[z2T@0.201 0 0 T SPTZj 1.0@Td10PuX 1!@TL  @Nꋰ: 0Q`1`Q0s0 #SB@0@ \ S80Cv>C 0CIR, S0QXP BRL04 RDSd080d?2#v>C 0C 0p0 0 @000  R@P\ЍpudTn'00@-@00 0@00@DP U @0PD U P0 B @R:0,, :R  TZi?0uE-pUp5P0M000D0P54H5@ ^^4N@PK$.`PHpD /PP0P S@@@3 @1.`PHpD .DP@ PL0SC bP .@P@D0 S@DH0 R@@ Tc.T 0S c:S@`.P D `1,`0 <S06#@>0P 0@ R  dß Q  +R -R P Q 0S@0+S-S V 00C SD0>CD0 DD!Pu 0@-SD00cD0 "D0V000`Sp0SL2X@&@@`0,SV MQ@2 0 0 2JQ0@0""00pMQN pP0A@ 0pN WP' T% n^ 0S R@l 0R<1D00/SD@P 0#D `V  0S @0@0 $-0 -0 00( ( Qt 0 04k] 0 00R XЍ0h uvw~ww` m Z`@-0P@NEO-Aر@p` P ఐY   벀! 0`0$`V`@@BY0 HV `F  <X``Q pQ` PB`` `  JAA0`vn ` dxQsQ t000d000  Q a 0C0R00 $00 @(@ 0vvmPvA-d@d0@Zj<pX0`  \\h8   @ \ PЍh ZO-DM@, 2,(0bS000P`U 0000P$p (  > g?Cⓠ*pZpi$ppG $p $v   dQ Q 1`1` `0,0$ 0 ,0C , R `F`SaZӑ$0!CZ 00C1:# c`C` `>(`,08`؀`p!`$0Ɵ!`Ɵ`!0` ?p`! 00SR0<0@`  0<0s Y 00S  0e 00c`[ , +<DЍhTvm:O-@S,M@p`P0 :cR*=0c0(0  `00c$02 +P Y P㘂FP20  `V((Y  v 0 dQ00q03 㒩*$ Ⓔ+X c B Q B0v r0 0 @JQ[;T@D,MQ*,ȠL`P``:V ^`L[l Q  0 T@dAR @ T@D 0@Z aQ\!PZ@ `@ Y 7,ЍdvQ@-@`@0M`P  [ZU x0t00P IRT0PL   D0Pp  ZЍ, hhtvd@-X@XP@T0P  ZZ80Pp 0  Zk)Z뿀` hd0 0@-P) p p a "*| Qp p p\ a *4 Q瀀$  @{_ @^dhL@-x@xP@0S0ST0-L0p@ p00 ) 0c0 P ᰀd Dp@-`P`F&a V 0RV(( P @Pp@-@`@0`P :Zp`3Z h^PP  ^80-u* PP #ZЍp hd@-P0PP0L P` ZZP Z @ЍpX h0@-0@0| @MP YY 00C8S P `@P YЍ0 h0@-L0LP0H MP  YYGP Y @Ѝ0X h0@-D0DP0@ MP  YY  @YЍ0 h@- Pp p@Tx0)0@d@簀_P㰀-p p 40)0 b  _pﰀp@- 0 0  0PЍp@-S M@P`00UP`P@ PT#!V P )R T@0 0EP e 0  0PT00ЍpD @-p@p0@0(M0 $00P0  0 (0$ 0P0R (Ѝ0,S @-0 0r L G-(`PPPPQ[ \p @dqT SpI QL10SC @0CT8>;X@10 10E(T  8Y?0CZl3 CP@   @\ T:DHX6D X:S,0SW ?\PE @PT@P  pW000PPgpA-P( hR @\! X Q  0zpDPP`P0 `SP1Q 0/Q pApp<@y塁Q Q   0CS P c0S0  SL0'0T   AQ 0P aЍT E-A`!@ M  !P )R 0(cMPPpP0pS`1R 8 R R & R*00H9D""  0204S 0@P0\`0S|0N'0T  0S0  BR0\b 0 00R Ѝ0@-0#@-B2@0M0 9PS Rs0S* !R S 00  0ep_ VS06B,B B QR#S0S* !RS CS R:D Sp#$#4``aV 00S`` /0 SG SD BS S S*Cc/BRS (Ch` BS_R8CS PEU 0SЍvf@-L0LP0p@P`&P0PP@|y1!0p@- ) R P R7 Q)P*P)LcMBFP @ "" (@@ BP_R (@R*| P  L X 00p Q 00@ Sp a@PpZm&p yO-H<Z`,&T0I@ S LP @0S:?C:0S wTTP00P0尰@ 40S $3/P002&PI@0 S  @0S:?C:0S MT,20 2 0 R 1P@ 0S:?C:0SS 0p0Z:000P00CSP0TLPL@ 0S:?C:0SS 0p0  E0P0 S  @0S:?C:0S S0000 R h0P@ 0S:?C:0SS 0p^  xp@-P@Zpp 0p@- 0*@-  ?-D P 0S000$000  45wE-<10Q C 0ƒAP@0V@0Zr@4S80S0( ?Y=Sb8@Q TW`( W`,`@`S@dS7` SP PQ,ݵ SV?!   X 0P80`S 0-S(00(0`P PPp(0WN@p@f 80SPS PWS00Spp00S 80U PSc@`@ W@= Wpd~9S 003 000 XeSpp0 0S0%  /0BWp@[` p@ p PQS)0`V / @ PpA0SbSbp` P@4` Pp@.0p0p` P@%ST2k0  `42 0$P 0b1  3/Pib0 S:b` P U U00 0 S00`00X 0( p  o P> , q 0 aP10S00T  UWP$PT 1 #0V`P  CWP@`T  9 0P PP~@ @$0T!00R ]Wߍ<0yw,]wh`[@-@` 0P0C00P0`0 9S `! 08p0PP ( 00S0 %P  %R 0P00P`ЍpDz8@-P@UL80P000P80@-S0?SL0 0L P000PSL0 0L P00' 0!R" L0R R R  R @R00 L 00 L  L 000\ S$0 0100S%0Zs 0100S0c00000 00@0@ 0  rQ $R0 c0/Ș4zO-@e@5`0TM0 L00  0$0Pp  C !P@$ D R+R 0S0K0-  0*SP@0C#@L@@@0| S S7X 00C01@D 爐ẠR%Z.S$XZ W (0Wpp@ WmX Tp0W p# 0Z@ 0S㈀ T%X*XW $RS P✂"@00 R1\ .R0@ " $ X@ \Ÿ $l\ X @ X Ġ " Zt hR  BT 7 R8" 8j$   " Z 0 00000 00S mR  0 0 01 0P 0b1 3/PD0 S:?W*XP (0100S0C 0$0S S/pCP 01LZ P P [P 1L0 100S 0&0( !0,0@c0@Ap@ 0L 00R ETЍt0 z4zz8[-,0@-(00  X@Ѝ/-@-   @ Ѝ/-@-   X @ Ѝ/@-P\M 0 $0 0 @`H (0,000400@0L0P0T0 0   p@X\ЍA-Hp`WlT0I@S LP @0S:?C:0S FTP00P00W 00P00CSP0TpLPL@ 0S:?C:0Zt SS 0pA-Hp`W*T0I@S LP @0S:?C:0S uFTP00P0W㰀P00CSP0TpLPL@ 0S:?C:0SS 0pA-Hp`WT0I@S LP @0S:?C:0S 4FTP00P0W㰀P00CSP0TpLPL@ 0S:?C:0SS 0p01A-`P0C !0V? HpWT0I@S LP @0S:?C:0S ETP00P02W P00CSP0TpLPL@ 0S:?C:0SS  0pAЎtA-H@`T 0 SP405@:APT0I~@S LP 0S:?C:0S ETpP0 0P00SP405:PP00CSP0T0LpL@ 0S:?C:0SS 0pG-HpW`T0I@S LP @0S:?C:0S SETP00P0  WP00CSP0TpLPL@ 0S:?C:0SS 0pA-Hp`WT0I@S LP @0S:?C:0S ETP00P0WP00CSP0TpLPL@ 0S:?C:0SS 0pA-H@pT` 0 SP2P405B:AvT0I@S LP 0S:?C:0S DTP0 0P00SP2P405:gPP00CSP0T0LpL@ 0S:?C:0SSZu 0pE-HpW`-T0I@S LP @0S:?C:0S xDTP00P0 aWP00CSP0TpLPL@ 0S:?C:0SS 0pO-HpW`T0I@S LP @0S:?C:0S 1DTP00P0  0%WP00CSP0TpLPL@ 0S:?C:0SS 0pO-HpW`T0I@S LP @0S:?C:0S CTP00P0  09WP00CSP0TpLPL@ 0S:?C:0SS 0pT1T!00A-`pH@T 0 SP2P405C:A\HT0I@S LP 0S:?C:0S CTP0 0P00SP2P405:9PP00CSP0T0LpL@ 0S:?C:0SS 0p萅@-R2P`0I~@S  @0S:?C:0S JC<20p020   20Q\200SW2`0S  @0S:?C:0S $C10p1`0   10 1 p00S`V p\10p0  4P010  BR 1`@ 0S:?C:0SS 0p0 0 00  B 00  BR  `0`@ 0S:?C:0SS 0p( xt0O-鐃30PP Ph3DPI@0 S  @0ZvS:?C:0S B 3030 R 2P@ 0S:?C:0SS 0p|2P0 S  @0S:?C:0S TB(202 0 `R 1P@ 0S:?C:0SS 0pP0@L 100S T0 S LP @0S:?C:0S BTP00P000=# RP000@00000S P00CSP0T0LPL@ 0S:?C:0SS 0p `Vu 갠@ P000@00 dt 7@-0 PSP@:00SP00  0C 00<0& Q 00 r00   `00 R 0OP000 !OP>}t@-pQ@P`0 S*  R0 p0  P pWV00ƅ$ 0R-P00  |7@-0 @S24P051:00S xOP'0s" 0 S  SxP0  00  RkP 00C0@a NP >p@-P`@ 0_PpG-`0TQ0SP@PGYTD ᐰY p 2  !0C pW00<0# 0Z W1 0 pW 00 0  x0pW  UNPp gY0R00 0 0 zty@-p0P0S@` ZwNPVT 5V pN-0&000 0 Dy0@-0S0 BR 0H $ P% P SCP 0PSU0PU0\0 BR R0 R0B0~8@-P@80@-0sP'  BR H3 $ P% P \0\0\0P  BR sR0 RB0~0 R0C R /0@-0S0S. $0H  P % P  %|  R S CP P  R0R  P0P \0\0~0@-0S0S0$0H  P % P  %  R S CP P  R0R0 P P \0\000~00 R /p@-P`@xPP@Qpp@-0SRL""A0`S0p0PS0p0QPp0S0p@T 0S0p BRS pR0@-="A0PsP3 SPU0p`s3SQ 0s3SQP `0PsP3 SPU l@T  0@|@3\@T c BR cR0@-0@"@T@ PQ @Q @T@ \ Bc 0 0 R0\ R0Q@-#0 RS``00p  l00S 0\ LS0 @\0T @Zx0T 0 R 0\:S``p@-P0@p@0@Pp8@-@PT 0S  R  R R pP008@-0\  @T0\ A-\@0S0 S`Q0  R#  R R  R R pP@CWRp @TR@P pR@-pPp`@0PSPP P00!U00/R R/0P0@-  /\\ @/T T R /Q 0 /R Q  00Dnz@-@0 \0/@-L0 0R <@@\P Tmh0A-0@PU U @`P`炀pPW@Rlp@-`jP*@P  *p 0@-@0@2 Hl+0@-\00R \ D@P@P@T0P B0l\/ \0S/ 7@-PPP p@0@Q0C@SQD 00 00?$@@ >lk+z 0 0 j+0P0@-#(| ~0t 0 B0Q@+5Ġ`PpPPD<` 00000 09K0 00>0000000/0p@- @P0`UTUK0p R0 0  p_z_@-@0@ 0@@M0 <0< 0p3R %@Ѝ^00/0S0/:0S- :A0CS00 0  0:000^:0S- :A0CS X0r 0  Q0100100:0^@-0 00@S 6p px0a0H @:6p0H  p4 a 6 @:ᘀ]_ T]] w T@-P0P0,M0@ $0j`P p000 000 0 000* * $0$ 00R },Ѝ\0T@- EPTQ@-(@ cdn @2 T%TE-XQX1P0,M0Qp@$0 Q Q(  1000100 000 0 ` 000  0XP0 0 P00 00" 0 0 `00   0$ 00R ,Ѝ[0TTT[p[TL[[@- "ȲTO-A1@0M0`P0>P\1e 00GP>  P"00 @P.PPPY0@   0 0 00R ЍY0PZ{,Y(0@-$@0@ PDX+/@-$ 0 0!3/p@-$P@S)P O)$M)P I)p@F)@-$pM` .0s  hPPP @  PD0 03/00S 3/ЍpWwO-a1`0wM0( 1r%@%TPP 4140c((@6 1$0 01  0 <r<04$008pD p00. 0(,$P)003/00p$P  { y$0!00R ҵwߍV0wE-@0@0EM0 14`PP $PP p=p 0 1ذҰڰ0PT)S0 Pi`($0 !00R EߍDU0A-$@ 08MRP`2 0`00`,` 0 OP p 000`000 3/ >`P `08@80$ 000S 3/8ЍA- MR@0$P 0a P '(00 `  P p0 0 Ѝs@-P@ `P`  P  P   P 0000` 0` P|R@-LAL1@0M0PQp0P  0S 1k0`  0/`0S6jn0[0b  `00 `" ("( (BQ/  0 0jV  / P Z|:  bR  0 00R Ѝ R0hRL>(RQD0 0<\!0/ R /P|w@-9@o'@-@0@0@00Z}P >000 =00 0Lp 00 0  P0 S P003/P0H0S 3/p000d0h00l 0 L0@``K\%Z% DЍJxI`O-DM `t p0Q 0h |BR@PLp00S X0L0$000C#,,0!$<40P00 0H 3/P P00 3/P  003/P 03/P$0S0$0< \8 P XT 0S 0S$K0L0,1 00,01000 P:  lP$P 10 S $$0S  003/P0$00(0 lh03/P$0S0$0 0S 0L0^Y 0 03/PIq$DЍG@-@p`P p04 +  `(  $ P`pUhE@-@` Pᝣ0U'2 0000  ᣮp0 P0   R  $ t P  (  pP P h0(00$0P$000(00$0DDHD 0, /@-083//A0Q   *,5?//  5$0$00-0)0%0"X00 X0 B" ,$ X00 X0" ,$ X0 0#,,!$<40/ X0" ,$ /@-Q1P0MM02`0- 0@ 00 p᤬P=0`@b͍,-, ␬P "7Z~ 1S `F @V(00"0R ߍڍA0t`"MO-TM|000  0p눐匠Pd ubUP`@ =62p0 000g`0 0X00S  0 PZ 8# 1@``000` 00\00$0(0T0$0 0(0` 8X 0^xP/ <003/P0S`!  LCP 5 000 000L P0 #  00zI T "U " TЍOЍ/8@x X?!TM@-$0  MЍЍ/`"p@-@P0S <00S 83/"p@"O-pş M0 d5 0 0  (0 @p ȡ0/#0 (0 `s0 P$` `P  P  8R> 080<0P03/X0 K <003/P  003/P 03/P<003/0X00 00N P 40000,\Q0 3 0K  0`T0 05KTK rp P gPP ` 0` 0P=YE` ]E@3U VU300S4[O yO-4M000  # Ao,pr @`0>0 0000 PP) 00 00$p0 0.00`0|  0p@7p@-P@P  P 0S Sp03/pP p@pE- P@p` 8/P p`V:O-Pp`04AP@> X ᙛX0S3W0S S-X+ Pp00D @ ;/ p@YT0#03: R000 &Wy@-0  3/Ѝ/@-0S00 S003/S7@-@PT :T  !003/ 003/P00>7@-@PT :T003/P00003/>s@-P@U`0000003/P! 00 3/PU003/P 00 3/P  U|s@-P@U`0000003/P! 00 3/PU003/P 00 3/P  U|7@-@PT :T  !003/ 003/P00>@-0@0!YP00@-0@0!iP007@-@PT :T  R  !003/ 003/P 00S00>p@-`R`@# 0PPeSZ :S003/P U 00P 0 03/P U 0, 0 3/ppp,!4,A-`P@pP0  R 0SW 0S @ 8pZ@0<0S8 0 z08 <0 000QD01pD@ pR0 S SK0 % 1000v )Y0 Y0  r P@1 00S00c0! S" W  0 S  0:/P 0S p  D]j X0Sp@Z 0S DP   [R [kLЍDx$@- @P8@- A Qt\0 L“#0T \ 88@-(0 0bP@ 00P8L00@-@M P n0  02 P P  00" n P00Ѝ00@-@,MPP^00000 0P>0100 00 0a p  0 00S ,Ѝ0O-< 83LM 0@0h (0 P3PU*00M `T `P  00` S0 0,P `0 <0KX0 0T0 00KP0 0L0 0H0 D0 @0 XK pt200S P80S@ 0R uy`0pP`0pW*00M R 0P  ZP\ PP`1P0h000` ,P ZPJ p Wp W\0 \#R(1u0  30!n 0c0,  b0Q RR0Pd0   pP 00 m0 0 0S0 pppd0Sf Z  Z Z 0( 00R K0tO-  9DM0L 0d  <K(0 >d <@KR00P@& P40040 P0@P@ p40 S(. 8 ^ ^\# \  @겠FZ `` f\`V Vp\P `0RPP@TP@p  0e P @p!00M P 00P\P H0 `@ H HXX  80RxH 0Rs0S S[@@0 `F@ P D` P㐕%00C00C`FS5!10/'V, !( '`0 0020 0V %` _`0X005T000S p u00\  p g\p 0D00cD D R`VVSp`0@PP @0@ 넠㚐 $U0PEš0`0 `F0 @D T` `0 DPE0`0CS񏐤-b 0ST 000S SU~U  d40`$S 0S00S{00xUud 0S TT00 0 0010S SU XGUU $ 30#S 0SH00SD040AU>-0S T T00050S SUX)U& \ 20"S 0S00S0l0UV 0Sp 00D T000c T D T RD0PUU@0 S @0@ P 0㐓#00 0S$ Q! Q 80Q0 <0 Q0 @0 SZ R Q Q:  b" 0X00cX X R`VVsH00H0 HQe`  R0P@!rC "0 S:@0s03Q0S ᒁ!d R@@0Z@-,p p 010 b  T0T0 0A-Sp`PA @Pt_@-,p p 00 b  @-,p p 00 b  T0T0 0A-Sp`PAe @P;_@-,p p 00 b  @-,p p 00 b  @- @,p p 00 b 㐀't@-G p 00 b  4@-,p p 00 b  #\A-X` P\@pA` 0@8_@-@PI p 0b0 b 㰀DtG-p` p\(P,@ЍG` 0@P@Ѝ_@-,p p 020 b  )T0T0 0A-Sp`PA @Pu_@-,p p 0 0 b  !\A-X` P\@pAu` 0@J _@-J p 00 b  4T0T0 0A-Sp`PAL @P"|_@-@P,p p 00 b 㰀"tG-p` p\(P,@ЍG` 0@P@Ѝ_@- @,p p 00 b 㐀&@-,p p 0r0 b  %@-,p p 0b0 b  D@-  P @@-@P@0 SS S@0S S SZ @p@-P#@P P 00p@A-@0@0p0BM1PP` P `P ` P`ɿ$0!00R uBߍ0ozXk8@-PP@P@ 8#S 4  00S8E-@0@0p0EM 1vPP `P  P ` Ps$0 !0 0R Eߍl0ozXkp@-0 @T, @0D aDP \%9TWD@ P:TR0TRP @0Da`DV P9TW@D €R  :P0 Rp 0 01@-@ 00  Ѝp{z0 0041P- 090  `不0Q-@S0)0  _`0Q-@S00  Y$000/000/Q@-@ A/AP0 01p@-PqPP(M@00@Px00  `  0$0HP ᣊP(Ѝph,\A21 1/A2!/A2!/ 4S@-_#(LC$H@$B,Ƞ ,B!! @dl7 a"'0!00 O-X8P8,M`@  !t80  @|8 @T`@@ăV0T10C!R@ !T(夡  , 0S` @   @R 7 NpT pR00V0WZ 0pd0 0@00  @p W p000@W10C0h10C0S W01p#1*0 W: " ! 0 ``p4 `VT)J 0# P: QQ dQ 0    @@0 ` `0 @d0S%0 !40 3ኡS  S R P4X5014Q J 00 R% !400 0dQ 00T0 0` `00@@40, P:d,00@\c &DL#FT3:P#T3R/ `` `V* "0p" 00c0@@0c000030P#X RX#P#x30d#`p#dcVpcX30h#`t#Vtc83 0,Hcp`3``p`g ` `0V 0Wp 0" `# `` `Vf3V "0Dp 20`# `#{ d20[ph# ``h#`_ `#W\ [ 3`#520`# % Wh# ah  b0   a 0 0p 0 0 P!*! `` p  0 0k`fh `hcp 1kh#W,h pGp00 0W  Dc0D3Dc00h#lRl#00d tRt#00,  R:0 d,0  @0i0  @,Ѝ`hd`@-PPP0` QV 0I0  @'0 0P Z@P    B"1 SR SS  S  ЍpxhO-<@PMyQl33P !z20  ZPPʃ0D`kV !O*"p, W    R:0,0 eE  R :  \ ^ ) E0+P0n  JQ    F"1 S_ S     X S   R S   00 0 0HeQ0   A0 PP    4 p\# B j V( j  0p d3`fp3 Y0p0dhct#Yt0V *EP  Fk ЍlhdO-@[0G 4䫱K 0S8   0h` P Z0 S P`,PQ PP ` P XX 2 P`P0 0P   ,00W P!4 B0 _S  0H38T38L3D3`3,0`300H00< \@-0 0@,0\cP0FP0`~@V,0p0Pfp pW h30gh3pg,0pphd 0 0@-@`@괲d@-APP@t 1 1` ! 0EQA1XL  P0e `V0S $ ,R   PUPU  |  4  0 0   ,0Q:00Z0 h00, D#Q :HY PÒLPÂdÒ adÂ`T 耲hd@-A1@P0M`p 0pW&!!PUUP PUPPŃ00  PP d00DST00HSD00LS@000TS@ eЍ脰hd-@@$MQ 0  0! 0 R   PP@^<0 RP   0 00sR00(0 R  Td1@-l0l 00pPU `  P0=S`P@T\X@--@PO-@s@3p0MM0PP 03Y0  P R2O0P2P2D0$  GN` @`U   P0/S h吆P, y@0T/S/00@n@0`/S0f .S 0R/R_ .R 0R/R TU @D T/R T10$  ]PT0`0/SS Xt10( 9\1008! 0坈 P(100S 0 Q1$ 0 00/S@ 0t/Sk  b `0 0 /000`0S0T  T0D/R 0 ,00 0R Ѝڍ踭0 ̭dHp@-T@T`MP0@P` ,gЍp(h@-`@`P@\0P ` <PP@@E ЍphE-pPpPl0M p`  Z%@00P yPE  @ЍDh@-T@T`@P0M` p ,*  PЍ踨hp@-0S `0:901000 P`@PPSPP 0!*R !0 pmNAG-0PS&P`@@@S݀ph|d TY|T@p␔$TAD@W0 @1H@TZAR@- @`RPPR RP 00  00 ?RPPh0p10! 010p P U0pgGq0W%P\LA- 0R@PcA!" |`Q`0Q`1paP p`  {10h|PQP0P0  ܥO-M=AQ@1P ph  d10PU``  SP0=S[!=`PZPPP00 000Q !&0Q00@010Y@ O` d@Pl00   =00  @ k Ѝ 1hX @-@PP@M 0S =p0=S00  (`0` pe B < 00@T P 0=S0 R  0@`V $ Ѝpԣ1hX@-=@P  @=@@-`@`P@\0MP   40p0 pp `Ѝ$1hXp@-@P`zPf!p 8@-@P;*P0ԡ ԡ7008@80(0( 00! 0000Z&/3m/s@-X001 P`@P"4yP (000S00`|舡1T@T@O-@ @ $M 0  P` UpP  00 ?pý ` Y|05"307:p LX00H00 0 00R [$Ѝx00T8dP(0@-$@0@ P` 2-A 00G- @Pp``t!0 ᲀ +S -S`00 P0S0PE 0xSP`UP0E"S) zy00 A  R `RW B( RP` RPQ d j "TX!!WP(0Z0"X`d$O-RQ@P`%pDFypW: 0 g  5/P0 0S Y*Z:f'ypPO-S@P`(p hઠZ) 7/P `X:00,ŸO- @@R`P熀P P+V -VP@  0\ B xP @R B"\`pB0H \ `\WL( \7? WV@ȟ  ` p ` p,& 'j*hp,  [Z&Ѐ `p``"P`p`pQU WV  S00S @00"  ` pU `vp Ѝ$0Ě@-0 0 0Ѝ@-0#00 000! /ᘙ8@- @P 08O-$$4 0`098A>59=07.-:;8:'2583('&#*#"!!Z?mlkjihgedcba`_^][ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  gfa`d@y10  XPS@TH3$A!iHgB.@cF{*I_O]A[IYx܂`P@!\1R !P1RH1 0 0@ Pl|@T@7w@4J2}O0@.@,A*@(@&@$@" @  B p@@@|@A@ @ c@ K@H@KL@Ѝ|0i{cpu 8@-@ @0 R  00nP  0S P0P000@]0008t|X2E-@@ 0P` `0@@0 pp000 `040P,0, 0 P00{{X26@-8@80@00S0@0P00{X2@-0@p$q? 0{@BO-c 3 M`00(0 1_L@T+  0S:?C:0S0S 3/MPP U P p@ 0S:?C:0S "P0U2UpI@0 S  @0S:?C:0S `20T2Z*0INH D  $ 0j$4h@0xp pY.2i0"&10S   (4$4100 L P T 0S! 0000 0S 3/0 P Ud1PED1$0  BR ; 1@ 0S:?C:0SS( 0p!00S 3/p@ D0S:?C:0SS  Q  p0PU$0( 0 0R )~ Kpz0_ Ly_td2@-P @0S:?C:0S ~ 0p @0S:?C:0Sp0p @-0 t  $$R(PpR(  0 0R }대v01@-!0 P R (D$Tp(@P!R` C p  b6 r`p/&Q p pD `` 0 0R }u0uxuHup@-0a0!` P (MP0$ ! $I^@F RP00 2`@ 0S:?C:0S8 0 Pv0S }  zPP (P UPP ( }$0$ 00R C}(Ѝp\t0dH-d0` M0  L0S 0Q KH0Q $}K s0NA- DI@P` 0S:?C:0S @ 0pP 0S A-| TIn@pW$  @0S:?C:0SPDp W0 2@ 0S:?C:0S000 0@   0/\q7\P0P 0Z* 4  ,  $ $ 000/qp@T\@--0 0O-Q1P0 R0X\ Z `!`1ZI 0P ‚ S:C0J @ m$1 0I &p}0fpp0 P>0303 0 01. p p0(E45$ 0s0T,D@  m딠 V!3 ЍOs @@`0dpp7$0$ 0  0, /n@-@0(, 0, 1   塽 0 c@///Q@-03/8@-`0`P`@Pc@EQD0PE013/U400S 3/ 0@0S83/8m<p@-`P$@p@pPpj@m@-@0@0PU.*  PP  #`V |0 0 wp 0" 0" 0P 0 0D  0<00S ,0@T m0 <0$T@-ßP 3M  0! 2!0  !2R0 ! Jx 2 0@@0S@SJ @0SJ%\1<"S :01s v@]vT^v@TvT 1s !S1!R SPM1 @ 1! 13/@|1 t!0cCT:U 5/@13/@H1D!0cCT:410S c0010S b00HtPeI>@ !$! 00 03/0 @D0S:?C:0SS p p L0Z?:0 b 'l,<Xi-0 0 00h\i=@-  0P0 @ R @@0S000T00@PP,0,0000ilh=@-Kp p 00 b  0[@-cp p 00 b  Z-@-00 0AS p pH0 0 7p p $00 bn @ Ѝ/ZZ-@-0$  00`SP @ UU  p p|0a0J@p0  p8 Z)a 8@@ Ѝ/Y_YY8@-h P@H && 0 000000000""##8080$$H0H P P0X@XP88@-X P@ `0 000000000""00H ,08000@04080P @0H@XP88@-X @P 0  0 $0 0    ,00 000 4080( @0H@0P8O-X P$ML0( M@ ` p pp10pgpK)!  Y 00 #KwT0|0  K!  ! B<0 8 !8<0 @` V:e 0( 00R u KV0 WV0@-0 0PM@  0R  PP 000 P0S Ѝ0\Uh@-`@P  ?000HU" 01b P0S @T l00 000 00400   ЍpTxT [S *S ?S \S ]S QR0S///8@-@P 0 P@0U:0008@-@PE-P p` P@P@0 00pV RyO-(ğ M2 4 00 @ " (0 M@0P/2 ζ⪡`Pqp <h01`0/S "r3l 0/S0SPS82 w$30;Z3ZX X0SKwP 0: S 0Pd >-d  >d 嘱 > d>d>dh0   X 0S>d, 00X R&(P000S0#  \tnP0| $  h00 RT0`VcH00 0ЍJITPJ0| B!lH HGGO-`PP@p <#400S0SQ000S 1000P 000 0 0 h vP    P 0H0C0\S0"H0S 0:0N0 0H R  R4 5: PpxO  !j8 0 D0S R .0 0JY0Sɳ R X⇳HP0 0 R00 S00 0S R Y0YS @-@P從0S S@P8080@-@P P@CXkT0@Q0D   P*=000/ /|C0z 0 0C=@-(Q(qPp`@ 9Q q!0 S P S#p0v~ pWP P c0 c0up?S 0U@EpcW?00E  c0E c0T00DPD0U0S 00S 00@Bķ'@-0 0œO-TT MPPpPpP5@T@(lD`FV``o6kD V*0>0T  Z%&`@b@``V? ≜ᨀᩜကd*T@刀T `W0CPfUSWe 0 00R pЍA0A8@-0@P(0RQS $ 3/Pʰ00080008P88@-@`pPU$ ,0! S $3/PP``0 000 R R ! Q  R0` 00cPpeA-鰀`P@>0s p p`Qp1 0pp4p`Q$ 0000 (   ựP" ;P Pp1p!0g`  iP `p``Pf`f` 0P "PP A@- @ a`0000@-0@" 000  0T0  000   Q    P0000000@  00 >R; S   P   P("(0 S   P   P(B(?/ Q / Q 0/ Q  /O-KP;@0M 0p00 0$ `e0aV<@( 0X 008X 08 8000 0+0 0000x00 2dP0x0>  0)dP"  0oc 0$dP  p `0p4  -000 p `004p : !0 dP-0Q0 L:b 0cP 00P0p00t00`Sx0|p0x09x 00x0 aV9 00$0 0 094 !`0 90`0 $09 !l9`04 $$c̠P 0\T0 @TLQ1 $Z0 Qb!cP`d $ b$cP`Q@ p P !cP@\ $p  b`p$ `  cPa 0 )a!b 40  0h 0k`00 _4PX`V  $`R0ݕP 0C0͕0` PPgU00X0SHfU   r 0` 0pR000 000S3#0q000S0 p/ S 00aS0 9P݅IL Å0CP0Qa0Q0`0gUVvQfqfUoVf0 f c p  t x  Z c|p Q . % p R' QZD! b 0_ɗ  0PhypPD,p0E`, X (ppb(p0 p Z| 0 iZ【dpڰ $匠  0pZdpp 0 j$p !"Y aUgU Xp     #  # d) p j #   pYp  0 pgU 0 8Q  jZ00P3j000 p fR$ aU V0+`f- P 0_0h :_P U`0PP HHB0Bp0( p( t0 S a:0d0 P0P0S0( aU h0l pQ 0 0h0(0cS  01 00 0  0Rt h 00t0h0 dP|0 [ U R8 , p`咋(X@$D@KT" V < 0@_xH$@00 R/ R/  /P@00 R/0 / R#R/G-_XkW|_b| ^__eq"i|p@-l@l0@d00P L 00H 0 `F`,0,P`V`p____G-@p0@0PM0RPpx|L0 RQQ`  .0Lt00 0 d 0L 00R k_PЍ0@-0 00$0 0(0 0 0GЍO-LM`p P0@tP0 "Ȳ "p 0p0 0 0PPx20 0S S sY8200S  2垲000 pXv  ᭲ 0bH0pgc\jp`   P 000 0p0`p@Q R  0L<00 @0D 08pP00< 0S000@0,  \"C'J J f 0 ^ @0YZ)0 1Y ᇲ[  `0p 00 0@p@D" LЍT40C-St 0!@ 00@`@ H`0@ᜄc& P@P$@Ppmp@-PP@`p-P0P@ `0pp@-@P@A2"S S 0S 3/0S 3/ 0Qp@#8>@-@0@0 P ;50` RPP|0墱0  0P00X X0  @ 0 R Ѝph8>DP,2@0@-0 -p,P#(0s0   D>A-Pp p@l0@d0`@@p` 0 0pS姱 o0 p`0V:D@-DM0jp  p@40@d09@@P WDЍ␀@-0` 0@MPp  @ 0R  fP00P 0 0P000 @!0 P TЍh8#8S@000@00@0@/00/8@-$@$P@0S08hH>8@-d @ 0PL    ( R8!2/8//O-@M00F?0 p0 P` /0 03/P O 0#,,!$<400#("<XX  台 00 !*!*  ( Q / * 0S:01S0Z) ዧP0 0儧,@0T @0(@ $ 0( $ 0(@@@00S 3/ЍXr| R0@-00000@  TP0@@\R  P0S010 000 0R  000!00 00%00$00)00(0 0-0 0,0 00 0400?001000#10 000000000?0000 04 0 04$0 04(0 04,0/p@-@P`Pp``Vp 0      p 0 0x|O-M@ṕH0W0P`8@0"pb0P 0 PPD |1P0tpT<00pGp0p000p> RE R  婯P0P Q&00< V0  0<0  PD 0` 0@ V P0 0D0`@pH0 @ 0rP R $ЍpD6E-@`.upPPdZPU 0H0jU* P  W  @T 0SX0 0QRS00 /Q// /QRS00 /Q//  /D//@-0S3/O-L@⇠ Q0 P 0 Q00 PP Q000!XAV8 `W|`!0-pk8P 0 E0a^0 0 R  P 0  P  0180;RmpBfP0R X pq= 8 !WPfni` H S488-! /! / / / / /!1AQaq/!1AQaq///--0 -*@HЍ/--0 -U@HЍ/--0 -D@HЍ/--0 -0@HЍZ*/--0 - c@HЍ/@-[@-Y-M 0; L 1Ѝ-M 0, 0HЍO-M`@ p R+ 0S  0C 00 0#\4X0  RH R, R7 Rd R 0SP'0P ЍB00 p @h  0p  RR 0p [ .)0P  R 0SP P C 0(#\40T U R 0P BXV X Xg PU    ''Y @  0@  0@ X X PU X Xz R 0S#m 0C 00@# &_ R 0SL# 0C 00#̠   &~ Rp 0SI 0C 000#Ġ = j : R} 0S" 0C 00@# Ġ&S 0p\g 0Sk  C 0 0# 40 0"  0#P 0 QA  !  @ / 0 pB R+ 0S  0C 00 0#Ġ  0P  (BBEL0BSB R 0ST   0C 00 0#̠  Ġ&B  L-M  0 0 FЍ -L"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} UZ0o{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlB.?B.v@?Oag?-DT!? s?-DT!?e/"+z<\3&F<`Qx;9@ %z8"6i5infINFnanNAN.,$@Y@@חA7yACnF?O8M20HwZBKOWbjv ")5:AIMRV^eipx}GG$+18?HQY\bjou~[[[acpidaddgroupadduseradjtimexararparpingashawkbasenamebeepblkidbrctlbunzip2bzcatbzip2calcatcatvchatchgrpchmodchownchpasswdchpstchrootchrtchvtcksumclearcmpcommcpcpiocrondcrontabcryptpwcttyhackcutdatedcdddeallocvtdelgroupdeluserdepmoddevmemdfdhcprelaydiffdirnamedmesgdnsddnsdomainnamedos2unixdudumpkmapdumpleasesechoedegrepejectenvenvdirenvuidgidether-wakeZ%expandexprfakeidentdfalsefbsetfbsplashfdflushfdformatfdiskfgrepfindfindfsflash_eraseallflash_lockflash_unlockflashcpfoldfreefreeramdiskfsck.minixfsyncftpdftpgetftpputfusergetoptgettygrepgunzipgziphalthdhdparmheadhexdumphostidhostnamehttpdhushhwclockidifconfigifdownifenslaveifplugdifupinetdinitinotifydinsmodinstallioniceipipaddripcalcipcrmipcsiplinkiprouteipruleiptunnelkbd_modekillkillallkillall5klogdlastlengthlesslinux32linux64linuxrclnloadfontloadkmaploggerloginlognamelogreadlosetuplpdlpqlprlslsmodlspcilsusblzmacatlzoplzopcatmakedevsmakemimemanmd5summdevmesgmicrocommkdirmkdosfsmke2fsmkfifomkfs.ext2mkfs.minixmkfs.vfatmknodmkpasswdmkswapmktempmodprobemoremountmountpointmshmtmvnameifncnetstatnicenmeternohupnslookupntpdodopenvtpasswdpatchpgreppidofpingping6pipe_progresspivot_rootpkillpopmaildirpoweroffprintenvprintfpspscanpwdraidautorunrdaterdevreadaheadreadlinkreadprofilerealpathrebootreformimereniceresetresizermrmdirrmmodrouterpmrpm2cpiortcwakerun-partsrunlevelrunsvrunsvdirrxscriptscriptreplaysedsendmailseqsetarchsetconsolesetfontsetkeycodessetlogconssetsidsetuidgidshsha1sumsha256sumsha512sumshowkeyslattachsleepsoftlimitsortsplitstart-stop-daemonstatstringssttysusuloginsumsvsvlogdswapoffswaponswitch_rootsyncsysctlsyslogdtactailtartasksettcpsvdteetelnettelnetdtesttftptftpdtimetimeouttoptouchtrtraceroutetraceroute6truettyttysizetunctltune2fsudhcpcudhcpdudpsvdumountunameuncompressunexpanduniqunix2dosunlzmaunlzopunzipuptimeusleepuudecodeuuencodevconfigvivlockvolnamewallwatchwatchdogwcwgetwhichwhowhoamixargsyeszcatzcip3!#3#431AC3334!4311333$1#DD3"A3223A!#"#$"111#3A21"4"2122"#"1!134332$11!D343!3!334!44333#12C""313C333131#"413331#13!333пl|Ot dttH#  Z& <  p4Sp0! X>hl\ 4t"$6 \($Tx(,D.O 8 $d/4S4S0 ??(6*8 l6-l0l02,@ 6A>>B<><<ÑߜIFS= ߡM PHi,X%*0&.83 <(C@HOV]dkry @fbdba i gtaccelhsyncvsynclaceddouble show s all xresdyresevxresfvyresgdepthhmatchigeometrypixclockjleftkrightluppermlowernhslenovslenptimingscsyncqgsyncrextsyncsbcasttrgbaustepvmovewF *7J]p~ŷٷ -2DObnuȸи "-;DMaubkm/M 1Q}Wqa 5  =AL-1 SeyHWkGgAאÅQJ:I۳FEsHu/etc/filesystems/proc/filesystems ?BEFGloopdefaultsnoautoswswap_netdevnosuidsuiddevnodevexecnoexecsyncdirsyncasyncatimenoatimediratimenodiratimeZmandnomandrelatimenorelatimeloudunionbindmovesharedslaveprivateunbindablersharedrslaverprivaterunbindablerorwremount @@@  @@@@  $'ztBHD,<4XLUKS$ (ylE q&TsY ) }$LZO  0000000000000000000000000000000000000000000.zip.ZIPcwbkDkKMD@BMGDʚ;G@bkm @` 0@!`P`  `M;_vYsm<hdQbkmg@}QSJFS1BSFXI`@@h$x$DM@LV#ii8{Q*/./4/:/@TDm/HNTFSLsIeRQE=(ZuraXahsqsgreebpmevenpparityoddpnleksanecookedrawpass8litoutcbreakcrtdecdecctlqtabslcaseLCASEparenbparoddcs5cs6cs7cs8hupclhupcstopbcreadclocalcrtsctsignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixofftandemiuclcixanyimaxbelopostolcucocrnlonlcronocronlretofillofdelnl1nl0cr3cr2cr1cr0tab3tab2tab1tab0bs1bs0vt1vt0ff1ff0isigicanoniextenechoechoecrteraseechokechonlnoflshxcasetostopechoprtprteraseechoctlctlechoechokecrtkillintrquiterasekilleofeoleol2swtchstartstopsusprprntweraselnextflushmintimebkB             000 00 @Z @   @  @@@  @         bkm     !"#$%&A!a w | p& m& P& M& 'J+"J-"J*"J/"J%"J&"J+-&"J&/%&*'''''!-~-7;?%@:C1P %+&-&!&012  # 3  A      $   IIcCdDJoOpPrRxX<>~cwbk#!CgE# ;!\%xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ?pc?d?b?-?l?s???rwxSTst/proc/mounts 8$II }A/jƼY0(M{_9 e?H~+lZЎ:M!h| Sp 6Co!\˴ hpKJ/y–X`5I>/ŒXza ~O6.&@80( 91)! ;3+# =5-% ?7/'    )4%/7(3-!0,1'8"5.*2$       91)! :2*" ;3+# <4,$?7/'>6.&=5-%  @ rounds=%u$@ @ Z@ @ ɼ;ʄ+6_тl>+kAy!~g jgrn<:ORQhك[2Kn,X   `  %KEXITHUPINTQUITILLTRAPABRTBUSFPEKILLUSR1SEGVUSR2PIPEALRMTERMSTKFLTCHLDCONTSTOPTSTPTTINTTOUURGXCPUXFSZVTALRMPROFWINCHPOLLPWRSYSΔ`!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/= !?! @|@!@zj@|"@%@!)@:F,@zj/@\G1@|2@k4@5@ۏ7@!9@:@:F<@Z=@zj?@L~@@\GA@lB@|B@C@kD@4E@E@F@ۏG@XH@!I@DNn)W'4b<ACcQޫa:n$MBI .)>5D.&pA~_֑9S99_(;/ Zmm~6 'FOf?-_'u={9Rk_]0V{Fk 6^ae_@h'sM1Vɨs{`k terminatedstack smashing detected: UTF-8``   ASCIIPOSIX SuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_/dev/log[truncated] J㋌zO????xąy <; "2BB&& %m/%d/%y%Y-%m-%d%H:%M%H:%M:%S()*+Hφ͌zJ&xy ;# 0;<I PcXc,1`5a5`c` %m/%d/%y%Y-%m-%d%H:%M%H:%M:%S()*+TZUTC<<..,M4.1.0,M10.5.0,M3.2.0,M11.1.0<<mUTC""##$$$%%&&/var/run/utmp '00G^qZ P`pKVpq0K<=AIMNQUbd<=ACGIKNpr<=?@ADMNVW>AFIJNUWADMN124;GO56789:q-123689:XZ`25RTrt  */`djp)+*0?@ $0paalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit@  +- 0x0XInvalid multibyte format string.hlLjztqZnpxXoudifFeEgGaACScs +0-#'I.Unknown signal Unknown error 2Kn,X   `  % K @B `  %& - g5 =/dev/vc/ /dev/tts/ /dev/pty/ /dev/pts//dev/ )BVm|  - FXnRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Unknown protocolRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error),G_xAuthentication OKInvalid client credentialServer rejected ZcredentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)/etc/rpc<<Resolver error: tcpudpraw0123456789abcdef?/dev/pts/nan infinityinf:/bin:/usr/binafffffff$$$$$$$$$$D&fffdDDbfff`b""FBFfddfFf$"fbbB"DDDD""""&ffa``ffff`ff&ff`ffffa`&ffadnffffbNfaff""""bDDDdDDD$FDDdDDdD&""b""b""""bbf&Fb$dd$dF$$$F"BB"fffdbaffff$fba$dFBfdbddBf$df"b$$FFFdFDdD&&&&"b"FfdFDd@&f&b&"b DDD@DDd""" ""bFAFdFDdd&"B"FDDD&"""f``afffffff`f`DddDADDDD@DDDD""!""""""ffffff`f&fffFff"Fff`b$dfff`` $&f`ffF@f```f&b"fFdDffFfa`f{}{@tL )( .],-& \[^1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUVZ S & ! 0 9   R    "   "!Y: Z\[_^VQ!TXUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO   & ! 0 9     "   "!: Z     & ! 0 `9 R    "   "!a: Sx"*(6;`f}jJ#+)7<ag~ kK. ELhr/ FMis8  V W. y"6*;`CELrAZj{}/ z#7+<aDFMsB[k|~     x !@AVW`atjvukw `a}~RSxA `a yz{ B} ~ RSx|CPZpDQ[qA=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqc&$0^4{'%1_5|  l\  !m]8V(;`"f}W)<a#gJ~K *EL6rhj +FM7sik    !QRSTUVWXYZ[\^_ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQR   Z  0^1_%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QS%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*  & ! 0 9     "   "!: Q!P%Q%R%QTT%VWW%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%l%      !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[  !"#$%&'()*+,-./01!234,-56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnocpqrestuvwxyz{|}~t;- &(,-й-Zůר㡢㡱ZXZTKw]YUMf7l?   ah444444444444444444444444444444444444444444444444444444444444444444444444444444444444444#44&.'449o3_*2bi!A[ C`44444410Z~u|x{,44$DG444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444-4444{\T```^``>7>>>>>>B;5GGGGGG'&u&|||m|z||||1%%u >>>>>>>>>8>>``>8`[>>``>>``>8`[66PP>>``>>>8>>``>>``>>``= `ow `p;`g;4`p `nGG"GGGGGD!?GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG,GGGG#VS]GG!)6(=!44GGGGGGGGGQ````````\|2>>>>>>>GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGmsg|GGGGGGGGGGGGGGSYYY*GGGGGGGGGGG_WLsxGGGGGGGGGGGGG_YYWGGGGGGGGGGGGXIZ+_IE_GIUIZYDFOCYYYY?GGGGRIGG``````````>>>>>>>>>>```````````\>>>>>>>>>>>9IHYZ3W<````````````>>>>>>>>>>>>GGGGGGGGgq|||||||g||||||||fs|sg|||||||g|||&|b`````a|M>>>>>@||ume|s||||m|||||||&||||| g|||s|||||||||||||m||u||||vm|szvu0.&|l# &|.&}|||````>>>>| ||||%||||s&u.|.||||.&||||||||||||g||||||||||||||s|||s |||||q|||||||||||tZ|||yj||||||s|||||||||||g||s||s|||||||||||||||||vxGGG?GGGGGGGGGGGGGGG7>YX||||||q|s||||||||s||||s| ||||||y|||||||||||||||||||||||||||||#``````>>>>>>A||||||||||||q||||||||||||||||s||||||||||||||||||||||||||||||s||s|||||||||||||||||sg||||||||||||||||||||||||||||||||||||||||||||||||||N||||||||||Gx:|||||||||||||||||q|||||||||||||||||||||||||||||||||||||||||q||||||||||||||||||||||||s||||q|||||||||||||||||||||||q|||||||||||||||||||||||||||||||||||||||||||||||||||||||q|||||||||||||||||||||||||||||||s||||||||||||||||||||||||||||||||.||||||.&|.&m|||||||||||||||||||~||-||v|||ccd|b`````a|M>>>>>@||z||Nz|`````a`]>>>>>@>>!$`fw`fDff!AD`af!"$D$af " $!!!!!"""""""!"""$"b"f"r#4$$$!$$$B$D$F$a$f&"&f4B@@@DA#ABADBBB"B$BBBDDDD$D@DBDDDdFDUUUf````faaaaadafddbdfffff fff!f$f`fafdfffrffifvawwwgwwif   aabb "" &&$ccceeedRRRRQ"" &&$""!!&&%'//////<43/////=>8?109:+ @46/////////////////////. ////////////WYVXWYWYVXWY]^WYWYZWYUZ _S[T\ `////A/,/BCDEF- G"#&)(H///I;KK""""&&&&JJ////*//////L5//////////,NNNMPPPONNNNNMPPPPPO27////////////,ggggfhhhhhiiiii@mqtt9?Y Z[d%&'>nop()* "#01678VVVVVVVWWWWWWW\\\\]]]]DEEEGHHFvwxyzU!{|}R$$$     $+,-.///23454:::;<<=AAABCCIJKLMNOPQNNNNNNNNSSSSSSSSTVVVVVVVVVVVVVVVWWWWWWWWWWWWWWWXXXXXXXXXXXXXX\\\\O\\d\\\\\\\\\\\\\\]]]]]]]]]]]]]]]]eefg]]ii]]jjR^^____``aabbcchhhhfkkllfrrrrrrrrssssssssttttttttuuuuuuuuuu~~~~~~~~~~~~~~ y9Oa8~+*](*=EG**.23651/-))+*)&'%T&%@?P0`AJVdp~ A ՠ(0123456789.,-AUD $.,-$BWP Pu-PuCAD DKK kr-krGBP £-£HKD HK$-HK$EUR €-€INR ₨-₨NZD PHP Php-PhpSGD USD ZAR R-RZWD Z$-Z$SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPMZ%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%a %d %b %Y %T %Z%d/%m/%y%T%d/%m/%Y%a %d %b %Y %r %Z%y-%m-%d%r%Y-%m-%dT%T %Z%Y-%m-%d%l:%M:%S %P %Z%A, %B %d, %Y %p%I:%M:%S %Z%A, %B %d, %Y%I:%M:%S %Z%p%I:%M:%S %Z%A %d %B %Y %I:%M:%S %p %Z%A %d %B %Y%I:%M:%S %Z%I:%M:%S %p %Z%A, %d %B, %Y %I:%M:%S %p %Z%A, %d %B, %Y%A %d,%B,%Y %I:%M:%S %p %Z%A %d,%B,%Y%m/%d/%Y^[yY]^[nN]^[yY].*^[nN].*^[yYoO].*^[1JjYy].*^[0Nn].*YesNo    !"#$%&'()*+,-./0    !123456'789:;<=>?  "#!  56'7@ABCD=>?$%&'#(  EFGHIJKLMNOP )"#!!  QRSTUVWXYZ[\*+,-#  ]^_`@AabD=cd./01"#!  efgh@ABCD=>?2345# !  ijklmAnop=qr !"6789"#!!"#"#  stuvwxyz{|}~#$%:;<=>?#@A!$%$&' (' (A=&'(BC8D"#!!")"*  IM)*+E%F'+, +, ,-.GHIJKLM/0NO.PQRSTU-./ 01/ 23123VWX&'-./0456"#! 4 556'7@AD=Z<78YZ66777777779:;<=[\]^_`ab89:;<77777777˼>?cde=>=>77777777ϼ9@;<AJfghfiB           #$&(*,0269=?CEILP%*8DR`qv /=IWe{  i2222!4@M[l   !"#$%&(*2<AFGHIJK $+3=FMVZ^bfjnrvz~f8V}/#/Je!JV,Sn  '2;?4 %0&@_XWNQ  ^]^Z)  X @||%@`PP&0q3p3q3x( CoC+W5 (r7N\t,,K#NNk3b{4N,O @ ) ( 6(@ !66#L6666666666#L666666(6::p3C (,-2346789:;<=>?@ABCDEFGHIx}~      !"#$%&'()*defghijklmnopqrstuvwxyz{|}~   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]Z*^_`abcdefghijklmnopqrstuvwxyz{  %&(*+,02345:;<>?@AHKL[\^_m{}    TUWXYZ[\]^_`abcdefghijklmnstuvw{  &'DEFGLMNOXY[\]^abcdghijklmnorstuvwx{|}~   !#*0139<>ABEGHIJMPQSTWXY[]^)01+,-.01346789:;=>?@ACDEFHIKLMNOPQSUVXY[\]^_`abc'./17IJQRSTXYZ]fghijz|<=>?@ABCDEFGHIJKLMNOPQRSVqrxyz    !"#$%BCHIJKPQRSTUVW  ')./278;@DKLOVZ\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPTUVWXYZ[]^_`abcefghijklmnopqrstuvwxyz{|}~Z?      !"#$%&'()*+,-./0123456789:;<=>?@BCEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrtuvwxyz{|}~$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./012389<=>?@ABCHIJSTUVWXYZ[\]`adefgjklqrstuvwx{|}~     !"#$%&'()*+,-0126789:;<=>?DEFGHIJOPQRSTUVWXY\]`abcfghijkrstwxyz{|}~      !"#&'()*+,-0123456789:;>?@ABCDEFGHIJKLMNOPYpqrstuvw|}~      !"#$%&Z%'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLZ0MNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLZ3MNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Z&  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Z&      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Z3      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNKOKPKQKRSTKUKVWXKYKZ[\]^_K`KaKbKcKdKefgKhKiKjkKlKmnopqrKsKtKuKvwxyzy{y|y}y~yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy     +++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++,,,,,,,,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg+hijklm-nopqrst+-uvwxyz{|}~+-+-+-+-+-+--            +  -   +-          ! " +# -$ Z0% & ' ( ) * + , - . / 0 1 2 3 4 5 6 +-7 8 9 : ; < = +-> ? @ A B C D E F G H I J K L M N O +P Q -R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  + - +- +-  +-  + - + -             +-     +-         ! " # +-$ % & ' ( +-) * + , - . / 0 1 2 3 4 5 6 7 8 9 +-: ; < = > ? @ A B C D E F +G H I I I I I I I I H H H H H H H H H J K L M N O P Q R ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,S ,T ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,U ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,V W X Y Z W [ W \ W ] W ^ _ ` W a W b c d W e W f g h i j k W l W m W n W o W p W q r Z%s W t W u W v w W x W y z { | } ~ W  W W W ,,,,H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H I J K L M N O P Q R H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H      H  H  H  H  H  H    H    H H H H H H  H    H  H  H  H                                     !  "  #  $  %  &  '  (  )  *  +  ,  -  .                                                                                                                                            / / / / / / / / /  +++++V 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 2 3 2 4 2 5 2 6 2 7 2 8 2 9 2 : 2 ; 2 < = > = ? = @ = A = B = C = D = E = F = G = H = I = J = K = L = M = N = O = P = Q = R = S = T = U = V = W 2 X Y Z [ \ 2 ] ^ _ ` a 2 b c d e f 2 g h i j k 2 l m n o p 2 q r s t u 2 v w x y z 2 { | } ~  2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 Z? 2 2 2  2      2 2   2 2    2      2      2      2 ! " # $ 2 % & ' ( ) 2 * + , - . 2 / 0 1 2 3 2 2 2 2 4 2 2 2 2 2 2 2 2 2 2 2 2 &(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnp  $1F8:&(*,.02468:<>@BDFHJLNPRTVXZ\^chpuz|~  $(%(%+%1F8:&(*,1357<>@BDFHJLNSUWY^`bdfhjlnprtvxz|  $1F8:&(*,.02:<>@BDFHJLNPRT\^`bdfhjlnprtvxz|  $1F8:&(0246>FHJLNPRTV^`bdltvxz|~  $1F8:&(*,4<>@BDFHJLNPRT\dfhjlnprtvxz|~&%*)  $#$'(1F8:&(*,.02:<>@BDLNPRTVXZbdfhjltvxz|~  0/$-.1F8:Z*&>*B.02468:<>@$$$$$$$$$           $$$   $$$$$$$$$$$$         $$$   $$1F8:&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhpuz  $1F8:&.6>@BJRT\dfnprz76;:?>CBGF KJ ON$4589<=@ADEHILM1F8:&68:<>@BDFHJLNP`bdfhjlnprtvxz|~76UT  $45RSZ)1F8:  "$&(\[^] &(*2:XWtstsXWtsts  "*,4EDED '&(}|wvqpkjed_^YXRQKJED?>9832-,'&!  ~~|xvrpljfd`^ZXSQLJFD@>:842.,(&"  ~|yvspmjgda^[XTQMJGDA>;852/,)&#  ~|zvtpnjhdb^\XUQNJHDB><8620,*&$  ~|{vupojidc^]XVQOJIDC>=8721,+&%  ~SX_epyZSXSX2(SXZ<|M   y/5BGJTWZ `    )"+=CF NRU SX!"#$SX SX%%%%%%%%%%%%_X/<BRWZ"&4'(=) *N+,R-.U/SX01234U567 8 95:6;-<=SX>?`@ABCDnEFGHIJKLMNOPQBRSSXy |TUVWMXYZ[\]`^_ ` ak ` bcdnefghghijkl1m34Un6o 8 9ypqr-<=SX.y|stMuv   wwwxyzSX#{$|%}&~'()* !"`= SX8-./0+,SXL`123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|SX}~ `Zn n B    SX z|{   }~*                      # "!$#&%('*),+.1-/079o43|5268:<=BC !;">#?$@%A&T'U() *J+K,L-M.F/G0H1I2(N3O4P5Q6D7E8R9S:";#<$=%>V?W@XAYBZC[D\E]F^G_H`IaJbKcL!MSX&'()*+`NOPQRS TUVWX)YSX,-./4Z5[`6\7]8^9_n:`;a<b=c>d?efghi@jAkBlCm DnEoFpGq HrIsJtKuLvMwNxOy0123SX>?`@ABCDnEFGHIJKLMNOPQBRSSXPQ4z5{R|S}`6~7TUSX.JephZ fgrxjq$tw+uv4iydmklo ns"z:}={?|CN~USXV/5BJTWZ ` ~    )"+=F NRU SX4:DK !"#$^%&b'(m)y*+,-./0123456789:;. < =@ > ?@AZBC^DEdFGlHIuJKLMNOPQ R!S"T#U$%V&W'X(Y)Z*[+\,]-^./_0`1a2b3c.4d5e<6f7gQ89h:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 3D^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKLM"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c.4d5e<6f7gZ:;<=>?@ABCDEFGHIJKLMxNOZ{P|Q}R89ST~UVWXYZ$%V !Q\dAD 34:DK !"#$^%&hm6y*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\./,-60`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVYZWX6Q\dAD 34:DK !"#$b'(hmy*+,-012389 :;. < =@@AK  ^DEdFGlHI$%LMNOPQ R!S"T#U&W'X(Y)Z,]-^./Z*+0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~WXUVYZQ\dAD 3D^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKNO"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q} R8945ST~UVWXYZ !$%[\]^Q\dAD 34:DK !"#$^%&hmy*+,-./89 NO{P|Q}R3   @ > ?KZBC^DElHIuJK$%LMNOPQ R!S"#&W'X()*[+\./,-0`1a2bZ3c$89.4d5eQ67:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzST~UVYZWXQ\dAD4:DK !"#$^%&b'(hy*+,-./012389 :;NO{. < =@ > ?@AZBC^DEdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxP|Q}RST~UVWXYZQ\dAD 3QD^%&b'(hy*+_`,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKNO"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q} R8945ZST~UVWXYZ !$%[\]^AD defghijklmnovwyz~4:DK6!"#$^%&b'(hy*+`6_./01623 :;6. < =@ > ?@AZBC^DEdFGlLMNO R!S"T#U6(Y)Z*[+\,]-^./$89.4d5e<6f7gQ362:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{RQ6PST~UVWXYZ 1606'&%6$Q\dDasbcpqrstux{|} 34:DK !"#$hm,-./012389 :;. < =@ > ?@AKZBC^DEdFGlHIuJK$%LMNOPQ R!ZS"T#U&W'X(Y)Z*[+\./,-0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVYZWXQ\dAD 34:DK !"#$^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBCdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 34:DK !"#$^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+Z\,]-^./0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 34DK !"#$^%&b'(hy*+,-./012389 :;. < =@ > ?@AZBC^DEdFGlHIuJKLMPQ R!S"T#U&W'X(Y)Z*[+\./ ,-S T U V Y ZWX0`1a2b3c.4d5e<6f7gQ:;i<j=k>l?mZ@ABCDEFGLMJKHI !"$!%#8!9$xNO{P|Q}Q\dAD 3R4:DK !"#$^%&b'(hm%&'y*+,-./012389 :;. < =@ > ?@AK()*ZBCdFGlHIuJK$%LMNOPQ R!S"T#U&W'X(Y)Z*[+\,]-^./Z0`1a2b3c$89.4d5e<6f7gQ:;i<j=k>l?mZ@AnBoCpDqErFsGtHuIvJwKxLyMzxNO{P|Q}RST~UVWXYZQ\dAD 3@@@@@@@@@@ @@!@@"@@#@@$@@%@@&@@'@@(@@)@@*@@+@@@@,@@-@@@@.@@@@@@@@/@@0@@1@@2@@3@@@@4@@5@@6@@7@@8@@9@@@@:@@;@yC@yC @yC!@yC"@yC#@yC$@yC%@yC&@yC'@yC(@yC@yC@yC@yC@yC@yC@yC@yC@@ @@!@@"@@#@@$@@%@@&@@'@@(@@)@yC)@@)@yC)@yC*@yC+@yCCyCCyC,@yC,@yC,@yC,@yC,@yC,@yC,@yC,@yC,@yC-@yCCyCCyC.@yCCyCCyCCyCCyCCyCCyCYF\_FCyCCyCCyCCyC/@yC/@yC/@yC/@yC/@yC/@yC0@yC1@yC1@yC1@yC1@yC1@yC2@yC2@@2@yC2@yC2@yC2@yC2@yCbF\_F3@yCCyC4@yC4@yC4@yC4@yC5@yC5@yC6@yC6@yC6@yC7@yC7@yC7@yC7@yC7@yC7@yC7@yC7@yC8@yC9@yCCyC:@yC:@yC:@yC:@yC;@yC;@yC<@yC)@ @)@ @)@ @*@ @+@ @C @C @,@ @,@ @,@ @,@ @,@ @,@ @,@ @,@ @,@ @-@ @C @C @.@ @C @C @C @C @C @C @YF\eFC @C @C @/@ @/@ @/@ @/@ @/@ @/@ @0@ @1@ @1@ @1@ @1@ @2@ @2@ @2@ @2@ @2@ @2@ @bF\eF3@ @C @4@ @4@ @4@ @4@ @5@ @5@ @6@ @6@ @6@ @7@ @7@ @7@ @7@ @7@ @7@ @7@Z @7@ @8@ @9@ @C @:@ @:@ @:@ @:@ @;@ @;@ @<@ @=@@yC>@@yC@@@yCA@@yCB@@yCC@@yCD@@yCE@@yCF@@yCG@@yCH@@yCI@@yCJ@@yCK@@yCL@@yCM@@yCN@@yCO@@yCP@@yCQ@@yCR@@yCS@@yCT@@yCU@@yCV@@yCW@@yCZ@@yC[@@yC\@@yC]@@yC^@@yC`@@yCb@~CyCb@@yC====>>>>@@@@AAAABBBBCCCCDDDDEEEEFFFFGGHHIIJJKKLLMMNNNNOOOOPPPPQQQQRRRRSSSSTTTTUUUUVVVVWWWWZZZZ[[[[\\\\]]]]^^``hknhkqhkthkwb~b~bbc@@@d@@@e@@@f@@@g@@@h@@@i@@@j@@@k@@@l@@@m@@@n@@@o@@@p@@@q@@@r@@@s@@@t@@@u@@@v@@@w@@@x@@@y@@@z@@@{@@@|@@@}@@@~@ @~@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @~@ @~@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@Z @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @@ @C@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @)@yC)@yC)@yC)@yC)@yC)@yC)@yCzF\_F+@yC+@yC+@yC+@yC+@yCCyCCyCCyCCyCCyC.@yC.@yCCyCCyCCyCCyC1@yC}F\_F2@yC2@yC2@yC5@yC5@yC5@yCF\_F6@yC7@yC7@yC7@yC9@yC;@yC;@yC)@ @)@ @)@ @)@ @)@ @)@ @)@ @zF\eF+@ @+@ @+@ @+@ @+@ @C @C @C @C @C @.@ @.@ @C @C @C @C @1@ @}F\eF2@ @2@ @2@ @5@ @5@ @5@ @6@ @7@ @7@ @7@ @9@ @;@ @;@ @@@yC@@yC @@yC @@yC!@@yC!@@yC"@@yC"@@yC#@@yC#@@yC$@@yC$@@yC%@@yC%@@yC&@@yC&@@yC'@@yC'@@yC(@@yC(@@yCC@yCC @yCCzCyCC|CyCC@yC?@@yCX@@yCY@@yCC@yC_@@yC`@{CyCa@@yCFF_Fa@}CyC  zz||??XXXXYYYY__`{`{aaa}a}a}a}kkC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@yCC@ZyCC@yCC@yCC@yCC@yCC@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @C@ @@@FF@FF@FF@D@yCD@yCD@yCD@yCD@yCD@yCD@yCD@ @D@yCD@ @D@yCD@ @D@yCD@yCD@ @D@ @C@yCD@yCC@ @D@ @D@yCD@yCD@ @D@ @D@yCD@ @D@yCD@ @DCyCDC @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@DD@ @D@D@@@D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@ @D@yCD@yCDCyCD@yCD@yCD@ @D@ @DC @D@ @D@ @8@@ @98@@yC9:@@yC:@@ @D@yCD@yCD@ @D@ @D@yCD@DD@yCD@ @D@DD@ @D@yCD@DD@ @D@DD@yCD@DD@ @D@DD@yCD@ @D@yCD@ @D@yCD@yCDCyCD@yCD@ @D@ @DC @D@ @D@yCD@yCD@ @D@ @D@yCE@yCE@ @E@yCE@yCE@ @E@ @E@yCE@yCEF_FD@yCD@ @ E@yCECyC E@ @EC @E@yCE@yCE@ @ECyCECyCEC @EC @E@yCE@ @ECyCEC @E@yCE@DE@ @E@D!E@yC!E@D!E@ @!E@DE@yCE@ @E@yCE@ @ E@yC E@ @"E@yC"E@ @+E@yC+E@D+E@ @+E@D,E@yC,E@D,E@ @,E@D@yC@ @E@yCE@yCE@ @E@ @E@yCE@yCE@ @E@ @E@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@EE@EE@EE@EFFFFFFFFFFFFE@EE@EE@~EE@}EFFFFFFFFFFFFE@ @E@DFFeFFFFFFFFFFE@yCE@DFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFZFE@yCE@DFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@yCE@DFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_FE@ @E@DFFeFFFFFFFFFFE@DE@yCFFFFFFFFFFF_F@@@F@yCCFyCCzCyCC|CyCC{CyCC FyCC F FC F FX@@yCC FyCCzCyCF@yCF FyCF}CyCF@@F@@C@@C@@CF@CF@C@@CzC@CzC@C|C@C|C@C{C@C{C@C F@C F@X@@@X@@@X@@@X@@@X@@@X@@@X@@@X@@@C@@C@@C@@C@@C F@C F@CzC@CzC@F@@F@@F@@F@@F F@F F@F}C@F}C@F}C@F}C@FFFFFFFFFFFFFFFFFFFFFFFFGG G&FC @&FCyC'FC @'FCyC(FC @(FCyC)FC @)FCyC*FC @*FCyC+FC @+FCyC,F@yC,F@D,F@ @,F@D-F@yC-F@D-F@ @-F@D.F@yC.F@D.F@ @.F@D/F@yC/F@D/F@ @/F@D0F@yC0F@D0F@ @0F@D1F@yC1F@D1F@ @1F@D2F@yC2F@D2F@ @2F@D3F@yC3F@D3F@ @3F@DPF@yCPF@DQF@yCQF@DPF@ @PF@DQF@ @QF@DGF_FGG_FGF_FCCyCCCyCCCyCCCyCCCyCCCyCGFeFGGeFGFeFCC @CC @CC @CC @CC @CC @CCyCCCyCGF_FGF_FCCyCCCyCCC @CC @CC @GFeFGFeFCC @CC @VF@yCVF@ @??@@@BFBB@BFB@BFB@BFB@BFB @B FB @B FB @B FB @B FB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB"@B"FB#@B#FB(@B(FB7@B7FBFB'Z@B'FB(@B(FB:@B:FBFB@BFB"@B"FB'@B'FB-@B-FBFB@BFB'@B'FB(@B(FB,@B,FB9@B9FB:@B:FBFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB@BFB"@B"FB#@B#FB&@B&FB'@B'FB(@B(FB/@B/FB3@B3FB4@B4FB9@B9F)CF)C"@)C"F)C'@)C'FcHfiHlHfoHrHfuHxH|HH|H5CF5C@5CF5C@5CF5C@5CF5C'@5C'F5C*@5C*F5C2@5C2FDCFDC@DCFDC@DCFDC@DCFDC'@DC'FDC(@DC(FDC*@DC*FDC,@DC,FGFG@GFG@GFG@GFG@GFG@GFG@GFG@GFG@GFG"@G"FG#@G#FG&@G&FG(@G(FG0@G0FHHHHsCFsC@sCFxCFxC@xCFxC@xCFxC"@xC"FxC(@xC(FxC:@xC:FCFC@CFC@CFC'@C'FC(@C(FC8@C8FC9@C9FC:@C:FCFC@CFC'@C'FC(@C(FCFC@CFC'@C'FC(@C(FC9@C9FC:@C:FCAFCFCC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC@CFC"@C"FC$@C$FC%@C%FC(@C(FC0@C0FC1@C1FC3@C3FC4@C4FC;@C;FC<@C<FC=@C=FC>@C>FC?@C?FC@@C@FCFC@CFC'@C'FCFCFC@CFC@CFC@CFC@CFC'@C'FC(@C(Z FC8@C8FC:@C:FDFHfHD@DFD@DFD@DFD'@D'FD(@D(FD)@D)FD?FHfHHfHDFD@DFD'@D'FD(@D(FD*@D*FD,@D,FD9@D9FD:@D:F$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D@$DF$D @$D F$D"@$D"F$D#@$D#F$D$@$D$F$D&@$D&F$D(@$D(F$D0@$D0F$D5@$D5F$D6@$D6F$D9@$D9F$D;@$D;F$D<@$D<F$D=@$D=F$D>@$D>F$D?@$D?F$D@@$D@F]DF]D@]DF]D'@]D'FNG@NGFNG@NGFNG@NGFNG"@NG"FNG#@NG#FNG'@NG'FNG(@NG(FSG@SGFSG(@SG(FSG*@SG*FSG:@SG:FB@{DC@{DB@{DC@DB@DB@DB@DC@DB@DC@DB@DC@DB@DC@DB@DC@DD@DB@DC@DD@DE@DB@DB@DB@DB@DB@DC@DB@DC@DB@DB@DB@DDB@DC@DD@DB@DC@DD@DE@DB@DB@DB@DC@DB@DC@F@DFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFDFFEFFEFFEFFEFFEFF EFF EFFEFFEFFFFEF@EFFEF@EFFEFFEFFEFF EFF"EFF$EFF&EFF@?@HE?@GE?@QE?@UE?@\E?@dE?@iE?@nE?@sE?@xE?@{E?@~E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@E?@@F?@F?@F?@F?@F?@F?Z@F?@F?@F?@F?@HHHHHHHHHHHHHHHHE?@E?@E?@F?@F?@ F?@F?@F?@F?@F?@ F?@$F?@(F?@,F?@0F?@4F?@8F?@@@@@>@@@@@@@@@@@@<@@@@<@@@@7@@@@7@@@@A@@@@A@@@@@@@@@@@@#@@@@#@@@@$@@@@$@@@@%@@@@%@@@@@@@@@@@@@@@@@@@@@@@HHHHHHHHHHHHHHHHHHHHA@@AA@@AA@@AA @@AA @@AA @@AA @@AA @@AA @Z@AA@@AA@@AAD@@AAD@@AA@@@AA@@@AA@@AA@@AA@@AA?@@AA?@@AA @@AA @@AA@@AA@@AA@@AA@@AA<@@AA<@@AAD@@AAD@@AA@@@AA@@@A&A@@&A&A@@&A)A@@)A)A@@)A)A@@)A)A @@)A)A @@)A)A@@)A)A@@)A)A @@)A)A @@)A)A@@)A)A@@)A)A @@)A)A @@)A)A @@)A)A @@)A)A@@)A)A@@)A)A+@@)A)A+@@)A)A@@)A)A@@)A)A @@)A)A @@)A)A>@@)A)A>@@)A)A@@)A)A@@)A)A<@@)A)A<@@)A)AA@@)A)AA@@)A)A@@)A)A@@)AHHUHHHHGHNA@@NANA @@NANA @@NASA@@SASA@@SASA@@SASA @@SASA @@SASA@@SASA@@SASA<@@SASA<@@SASA@@@SASA@@@SASA=@@SASA=@@SASA@SAcA@@cAcA@@cAcA@@cAcA @@cAcA @@cAcA@@cAcA@@cAcA<@@cAcA<@@cAcAD@@cAcAD@@cAcA@@@cAcA@@@cAcA2@@cAcA2@@cAcA%@@cAcA%@@cAcA=@@cAcA=@@cAxA@@xAxA@@xAxA@@xAxA@@xAxA@@xAxA<@@xAxA<@@xAA@@AA@@AA@@AA @@AA @@AA @@AA @@AA@@AA@@AA<@@AA<@@AA@@@AA@@@AA%@@AA%@@AA=@@AA=@@AAC@@AHIUHHHIGHA@@AA@AA@@AA@@AA @@AA @@AA@@AA@@AA @@AA @@AA@@AA@@AA @@AA @@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA4@@AA4@@AA @@AA @@AA@@AA@@AA@@AA@@AA@@AA@@AA @@AA @@AA@@AA@@AA/@@AA/@@AA<@@AA<@@AAD@@AAD@@AA;@@AA;@@AAA@@AAA@@AA8@@AA8@@AA@@AA@@AA#@@AA#@@AA$@@AA$@@AA@@AA@@AA&@@AA&@@AA'@@AA'@@AA)@@AA)@@AA(@@AA(@@AA9@@AA9@@AIIUHIIIGIA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA@@AA<@@AA<@@AA@@@AA@@@AA2@@AA2@@AA=@@AA=@@AA @@AA@@A IHI IA@@AA@@AA@@AA@@AA @@AA @@AA@@AA@@AA<@@AA<@@AA1@@AA1@@AA@@@AA@@@A B @@ B B @@ B B @@ BA@AIHII IHI@B@@BB @@BB @@BB@@BB@@BB<@@BB<@@BBD@@BBD@@BB@@@BB@@@BB%@@BB%@@BB=@@BB=@@BIIUHIIIGI(B@@(B(B@Z @(B(B@@(B(B @@(B(B @@(B(B@@(B(B@@(B(B @@(B(B @@(B(B@@(B(B@@(B(B @@(B(B @@(B(B @@(B(B @@(B(B@@(B(B@@(B(B@@(B(B@@(B(B*@@(B(B*@@(B(B+@@(B(B+@@(B(B,@@(B(B,@@(B(B-@@(B(B-@@(B(B@@(B(B@@(B(B@@(B(B@@(B(B @@(B(B @@(B(B@@(B(B@@(B(B>@@(B(B>@@(B(B<@@(B(B<@@(B(BA@@(B(BA@@(B(B@@(B(B@@(B(B.@@(B(B.@@(B(B:@@(B(B:@@(B(B%@@(B(B%@@(B(B@@(B(B@@(B(B&@@(B(B&@@(B(B'@@(B(B'@@(B(B)@@(B(B)@@(B(B(@@(B(B(@@(B(B9@@(B(B9@@(BgB@@gBgB @@gBgB @@gBgB<@@gBgB<@@gBnB@@nBnB@@nBnB@@nBnB @@nBnB @@nBnB @@nBnB @@nBnB@@nBnB@@nBnB@@nBnB@@nBnB<@@nBnB<@@nB}B@@}B}B@@}B}B@@}B}B@@}B}B@@}BB@@BB@@BB@@BB @@BB @@BB @@BB @@BB@@BB@@BB@@BB@@BB @@BB @@BB@@BB@@BB<@@BB<@@BB@@BB@@BB@@BB @@BB @@BB@@BB@@BB<@@BB<@@BBD@@BBD@@BB=@@BB=@@BB @@B@B@BB@BB@BB@BB@BB@BB@BB@BB@BB@B@@@B@@@B@@@-C@@@@@E@;E@F@;E;E@E@;E;E@F@;E?E@E@?EAE@E@AECE@E@CEEE@F@EEEE@E@EEEE@F@EEIE@E@IEKE@F@KEKE@E@KEKE@F@KEOE@E@OEQE@F@QEQE@G@QEQE@E@QEQE@F@QEQE@G@QEQE@H@QEXE@E@XEZE@E@ZE\E@E@\E^E@E@^E`E@E@`EbE@F@bEbE@E@bEbE@F@bEfE@E@fEhE@E@hEjE@E@jEjE@jEmE@E@mEoE@F@oEoE@G@oEoE@E@oEoE@F@oEoE@G@oEoE@H@oEvE@E@vExE@E@xEzE@E@zE|E@F@|E|E@E@|E|E@F@|EI@@EI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EI@@EI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@EEI@@E@@F@FF@FF@FF@FF@F$F@$F)F@)F.F@.F3F@3F8F@8F;F@;F>F@>FAF@AFDF@DFIF@IFNF@NFSF@SFXF@XF]F@]FbF@bFgF@gFlF@lFqF@qFvF@vF{F@{FF@FFZ@FF@FF@FF@FF@F@@ I I#I I I&I)I I,I,I/I,I,I2I5I,I8I8I;I8I8I>IAI8IDIGIJIDIDIMIPIDIF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FF@FG@GG@G G@ G G@ GG@GG@GG@GG@GG@G G@ G&G@&G,G@,G2G@2G4G@4G6G@6G8G@8G:G@:G@@@@@@@@@@@@@@@6@@@@8@@@@:@@@@<@@@@>@@@@@@@@@B@@@@D@@@@F@@@@H@@@@@@@J@@@@L@@@@N@@@@P@@@@R@@@@T@@@@V@@@@X@@@@Z@@@@\@@@@^@@@@`@@@@b@@@@d@@@@f@@@@h@@@@j@@@@l@@@@n@@@@p@@@@r@@@@t@@@@v@@@@x@@@@z@@@@|@@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@C@@@D@@@D@@@D@@@ D@@@ D@@@D@@@D@@@D@@@D@@@D@@@D@@@!D@@@$D@@@'D@@@*D@@@-D@@@0D@@@3D@@@6D@@@9D@@@E@@@AE@@@DE@@@GE@@@JE@@@ME@@@PE@@@SE@@@VE@@@YE@@@\E@@@_E@@@bE@@@eE@@@hE@@@kE@@@nE@@@qE@@@tE@@@wE@@@zE@@@}E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@E@@@F@@@F@@@F@@@ F@@@ F@@@F@@@F@@@F@@@F@@@F@@@F@@@A@@@@@@CCyCyC2@,@ @ @a)@,@1@C5@5@a@C@@[ z|h@h@CCh@l@l@l@EE @D @D @yCyC @yCDyCDEEEE @E @E @E @EyCEyCEyCEyCEEEEEEEEEEEEE[@F@@@@[@C@zC@|C[@CJ@FC[@CCCC@@@@CCCCCCCCCC)C)C0C0C)CG1C1C)CC2C2C)C)CG3C3C3C)C)CC4C4C4CGsCqq@@FFDDDDDDFDDDEHEHEEIEEEJEJEEKEEEMEMEENEEEQEREESEEBBC5CCB&&DDC00V@@@@@@@@@@@@@@@)A@@@cA@@@@)A@@@AAA@@cAAAA)ANALALAAAAAA@AAABAAAA@BBBBA&B&B{FFFF{F FFF{F FFF{F FFF{F FFF{FFFF{FF{FFFF{FFFF~@A~@A~@A~@A~@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@AZ@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@A@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA AA AA AA AA&AA&AA&AA&AA&AA,AA,AA,AA,AA,AA2AA2AA2AA2AA2AA8AA8AA8AA8AA8AA>AA>AA>AA>AA>AADAADAADAADAADAAJAAJAAJAAJAAJAAQAAQAAQAAQAAQAAXAAXAAXAAXAAXAA^AA^AA^AA^AA^AAdAAdAAdAAdAAdAAjAAjAAjAAjAAjAApAApAApAApAApAAvAAvAAvAAvAAvAA|AA|AA|AA|AA|AAAAAAAAAAAA    dint}x|Rrw o$%&'(7{4chmsMUY#=ZP: /) 3W]fFLZH1\5`6aO[ -! Q@^KXbB.?T2_ej~SpuzC9ygkqv8l+",*;0<>AEDGNJVI -UV !"#$%RS} xz{|   EHGabcd *(-./0123-./709y123456744AWXYZ[\]gedfhijvtsuwxy96    5( !&  ?@3BCD5  "!"#$%!#%' ! "$&(MN e)-"#$%&'(#%'2)Z+,./0'+*.047)*+,)+*,1 235789:;3  456789:;668:2&1;89:;<=>?;<=>?TU@<=>?@ABC<=><=>?@ABC@ABCDEFGABCIDEFGHIJKDEGHIJKLFklnmopHIJKLMNOJKLDEQRSLMMNOPQRSTMNOPQRSTOPPQRSTUVTYZ[\]^_UVWXYZ[\UVWqXrYZWXWXYZ[\]^[\]^_`ab]^_`abcd^_`abcde_`abc`efghijk` abcdcdefghijefghijklfghijklmklmnopqrlmnqrstwmnopqrstunopqrstunopqropyzuvJKstuvwxvwvwxyz{|x{|}~z{|~}z{|jklmFGHIy}~NOPQV XYZ[tuvsLwxfghi ,/\]^_      ZQ*bmz#lnx}pu9/<=' \+ 3w]` BC K.$%&?F0IJ4freoy^ghY>|GPS1_j78()MOVLRX;EUct:DTasN2W!"{,-ik~6 5Zv@H[qAdP[`  CEDEWX"R   YZ78 !CDEFGH[|"#ZIJKLMf !"#$%IKNRSVQSTUV\]^_` !+,~0123456789GHJLMOQU\_dinsxTUVWXYZ[KNLOM\]T       qruv             !"    fglm ! "$&(*,.024!#%')+-/135&'()*+./ JKBCLM@AHI<=>?#$%&$%&'()*+,-./012&''()*+,-./()*+,-./01234567,->?67*+23012343456789:;45FGFGfghUVYZWX68:<>@BDFHJLNPRT79;=?ACEGIKMOQSU89:;<=>?@AB:;<=>?@AB<=>HIPQhiZ[noABLMNOJKRSFGjkdeDEBCHIJKLMab_`noFGHIJKLMNOFJWxzw{r^thRuQOvwPZVXZZ\^`bdfhjlnprtWXY]^`abcefghjklWY[]_acegikmoqsuXYdepqjklm\*6EUty^_`abcdefghijklm_$&2.8P0`%'3/9Q1iabcaa014567:;89deghijklmnmopqrtuvwyz|}opqrstuvwxyz{|}~opqrstuvwxyz{|}~qrstuvrstuxyv)5Dsxvxz|~wy{}wxyz{|z{{~NOPQR  "#[s`aiY ABCD{=>?@Vey~bjl|SZ~bcdefV^bW_cXY\] }cdfgghijklmnopUTXkm}~Z?@;<|}NDE<=PQRSTUVW$:@]NSn}o]P%;A^OTpq_n(),-$%"#&' !-. 9:     &LT^hu~$BJ QV12pR`3vx{(6) . /ZCG "'bdn% A!z978,-=c?IaSj4l5D]tF_>kYPUm0grys[}He|@Owoq\:#N*+E<MXi;KWf?JZEFGHIyz7"0+32 5/m}~789:;<<=FLRcp}#$%&"(l)nopqrstu  OPQRSTUKL   $).38%DEGIJLMOPQTUWXY\]_`aop,*4:&-+5;'OYZ       #$     lqv{  Z !"?@IJ12GH   HIRS0189 #$AB;< ! ! "$&(*,.024 !"#%&'(*+,!#%')+-/135!"VWLMXYJKTUijkl"#$&!'()*+,-./0#%'()*+,-./$&01245689:<=>@C'.61-/01245679:<=?@B12345678937;?AB68:<>@BDFHJLNPRT79;=?ACEGIKMOQSU867<=>?BC@A;>ADINSX]bg>@ABCDCDLMPQ]^befopghiCEFGHJKLMOPQRTUVDEPQtuFHKNRSVZ[^benM*4X ,MNPQNRSTUVWXYZ[-UV[\_`klqruvstz{VXZ\W;?ACEIKOQXZ\^`bWYZ[\^_`acdefhijWY[][Ym{-+59[\Zn|.,6:]^kl/034]^_`abcdefghijkcdefghijcdfghijklmdefhjmovxz|Sq>HNUgilknrwy{~Vtesjmnkmnoprstuwxyz|}~qrstrspqvwxyz{uvwxu=@BDGJMPTY[]_advwxyz{|}~yz{|}~|}~opqrstuvwxab_Z`  WX \   ZW`*OTdy=>EFNOFG\]^_`abc(gn}  )ho~./23     V_)NScxabcdefghijklmnopqrstuvwxyzZ@ABCDEFGHIJKLMN OPQRSTU  "$&(*,.02468:<>VWXYZ[ !#%')+-/13579;=?\]^_`{|}~~ &,2 ' (&$) 68:<>@BDFH *+,KMOQSUWY[]_acegikmoqsuwy{}-JLNPRTVXZ\^`bdfhjlnprtvxz|%8>DJPQWX^djpv|/123450.!79;=?ACEGI"# -% !, (  &*1$+# /"')02. uS^g$<&>:b6M_%2? p~_D TK^#>=NiQcs#sbUxeEy&K`3&'e(kVhz*  0Q n h?NH9'lT!igtI;dZ?j}RWYv-=a J ?W !(BIgf0x4I\F|LH]z}%<",8[a%6EZM6+qZY{;iNnr-W,QlvdJCXwv|re1"SzP1)Fk\R$5`b7AmpV8D,19f4CSD5+lq[P_{Byww Hx3G[j:<fckc @F24G Rj(  * PE+|m~5BXp2h!/La*UAo.YCO3/:}VOt^8d{Xo$#tLU/A]`M)yKZ->m 0;Gn7ors="7.@\uq'.@)Tu~9]JOc 00g.^hZ 000 ----J*I*K*L*M*x111{|33 3}`UV[_FGEHu+hiv+fw+x+Z*p  /x  J d3e3f3g3h3i3j3k3!w=Oajgih_ ` a b c o) d e f %%% %%%f%g%|h%i%j%k%l%lkj  iB,&>O-&.&/&0&1&2&@3&?=X'Y'Z'['\']'^'_'b`'a'n p1q1r1s1t1u1v1w1x1y1,^,_,`,a,b,c,111111111111!!!SYQ !!VT !!P!U4*!++ L++++++++    """""" " e "" """""<;8:9q"r" 7 s" t"u"( v"- w"x"     Z 76Z\ 2D IEF2 U - 22dF+G+B7 H+; NI+LJAf K%L%M%sVO%P%Q%R%KS% T%""   """""&"E l """+++ ++ ++++; +++N+1! 111Z) H 11111  ****\ *g~*3 33333333^  . &&'&9 <7(&)&;*&+&: "3$$8<$$3$$$$$$:$4&8 5&BC%D%E% F%G%H%I% J%  V) W)X)Y)Z) 8 [)\)])`1a1b1 >?c1d1e1f1g1h1i1 -y&d z&fe{&gh|&Z }&~&} ij] Uk3 3!3"3l #3$$ R$$$$VS$$$$Z $$$ $ !$"$#$ $$%$ XYZ[\]^_`abcdef&0'0(0F )0*0+0x ,0-0.0/0 00../.50.1.} b 2.  = M\ L  K O N    & & &&&&&3&&D &&&!'!(!*!)!+!,! ( * * ****** *000(0,+0000.-/ 000000+.#/#M0#PI 1#2#3#ON Q2SR4#4&&&& &&&6&7&8&9&:&A;&<&=&D C>&7 8 _p9 ]V ( : ; < = > ? B$D(XE(YF(G(H(ZI([H \J(K(N*O*P*Q*R*S*T*U*V*OM^Lc222222z22VUU/V/W/0  4 X/Y/Z/[/\/]/Y())) *)+),)J-)Z# $ % & ' ( [Z<) *  + , a$`b$$ c$e$$df$ge(f(eg(h(i(j(k(l(8m(!# !!!!a !!!!!F) K! ) *+7 (- {,%% % % % % %%0 q%% %/////////8///////"")"""&%""m "" ";   l'm'n'o' &5&&&&&&&&' $$$$$$$$$ $ $222a`222222222e--f-'----%%%%< %%%%%% %2 %%%Z )qk,e-sf-g-h-i-j-k-l-m-n-!!!!! !!!! "#""""" """""** * * *RX * **t *\*' X]_,,,,,,,,, ,,,,,,,&#ED'#(#$F:)#,*#GHJIK+#M,#-# /30313 2333435363738393:3;3<3<*9q? ******? @A c B| @$A$B$ C$m  D$F E$NOLMVP***T&OW[bg *w Q**Y*N S[ ^%_%0 `%a%b%c%d%e%+  fa bcdefgg5hh$i$' -+j$k$l$&Z&m$n$%q l o$#j1k1l1m1n1o1mW X O Y niZ [ \ ] ^ L o ' p ####z1{1|1}1 t1p 11 i111111114 P %% % %%%|o''} ''q'U  -- -------k-V --2JK HG22SR22222PV(W(X(`Y(Z([(a\(&&&&&&&&&&e & Z f$$ T$$$$$$$WX$$\$Z H.K.....e..JIL&&&&9 h &&&& &&&7)=8) 9)h1111111111 '''''''' '!'"'#'#T $'. . .  . . .... ?  _B!!]}4 !!!!!!ry!!!!!!y"  z" {"|"K }"$  m       N R0 g0 0g: Y0  # $% &'[ ;  1f#Z3 n 2222233333xy33z$$$%%%4%B %%% R.S.T.U.TV.X.Y.X Z.0 [.          6 ,2-2.2   /202122232|0}0~0000 0001l1ijkm11 1 1 1 1 11n 0 0000 00 0 0 yz {|{ }~  3.4.W 5.6.7.8.9. :.;. * -%.%/%} T/  ) w    ^!DX`!_!a!b!c!*d!e!f!g!7 ; ** *ef2**  $ $ $$$S$$$c$d$Ti k  e$f$g$  +++%i& 4+(+ ', +'''''''  + !!!! !!!!!!!001 %p%%%%^m %%%%"""O" I "&&&R6 &!&"&#&$&5%&"#g$%&'0(K)*+,-./012#-RW$-x YX%-&-'-O Z(-)-*-+-,---f\$h w(kfx( Wy(}z(j|(}(~(&#"$i2j2k2l2m2*)(n2o2p2q2r2s2t2( 9$;$$$5$7$C(.). *.+.,.-.,+0,,,,-,,./,1,- . / \0 #1 "2 3 Z0`a^4 5 6 0IH$$$$$NQ$$$Qx$$MO01112131415161718191:1;1<1=1>1B1?1@13"/#/$/%/&/p /e//'/(/)/*/+/,/-/3..654.87 .:.9;.<....40%1% 2%3%4%5%6%7% 8%9%:%4000050670 00000R 00425262728292:2;2<2=2P>2?2@2A2B2C25*6*7*nv~}8*- 9*:*;*<*|=*8 ./ u f/  ,/ /9228722222@ 5<:2<222R'^2>:#VW;# <#C  =#># ?#Y@#Z=g0h0i0k0l0j0m0n0o0>...=?..j@B....C>*?*@*A*B* C*D*E*F*G*H*@,A,B, 6C,D,E,F,G,D"E"H"F"G"I"J"K"I F&G&H&I&HJ&K&J" L&M&FKN&O&P&Q&J---......6 ..K)) A )) M o ) K3L3M3N3O3P3Q3R3S3T3U3V3W3X3M0N0O0P0Q0W0R0d S0T0U0V0P""+ """"J """1R_##W###### .#-#T22Q2W2X2]\22^TYZ2V\ b `   _   ! @ W" Xvq(((wr(( p((s((z((X%Y%aZ%W] Y [%\% ]%X0Y0Z0[0\0]0^0_0`0a0 b0c0d0e0f0\.].^._. `. a.b.c.^/_/`/ a/b/qc/d/e/_I#]`^J#K#$ aL# M#bN#O#P#dcQ#`+a+b:Yb+c+d+Xe+SRZ%f+PO& g+ Uh+i+j+d,} e,f,g,h,i,j,k,l,m,n,o,p,f/g/h/i/j/ k/(l/m/n/o/ p/q/j!mo!!n!u k!!s!!qr!np!! jp2in222or2222q222j*k*l*) m*n*o*p*Pq*l  ~     p0q0r0s0t0u0v0w0x0y0z0O {0r!s!t!u! v!(w!x!)y!/z!{!F |!,*}!" ~! !r/Ls/t/u/v/w/x/y/z/{/|/g}/~///x)~ L O 8 7`y#,$,%,&, ',),*,+,{(l( ( n((o((((m1(u(t(~111111F_ D11G kdef. [ } l  """""""""  2222=; 22222# 222'2?22222./k 1/72/3/4/ 0/< 5/6/'' I H '''''',,,,,,,,,,,, #%$%%%a &%6 ~'%(%)%*%+%,%""""" """""" ^ ""c +r +w+t z)++n++ [ wK1L1N1O1  9 P1Q1M1R1S1####  ##` # / Z102436+8++++++Z+e+z ++++++v +++G++++ + +&5{}|&&&~ Z%&&f&G &* *V i *@! **? j!!Yk!l!m!" %n!aR &E C'{ Go! p!q! 1 kl16 m111111 1#-.### #g # # #, ##0+----------b-_ -++B++]+i > + // y////////////  I!J!K!L!M!N!O!t j Cu   qy rP-sQ-R-tS-T->| u3U-V-W-\  ]l^_`abcz## #### # ## #1./5T(o !%ss t u lrv yvw x 1111111 11(((((d ((((V" %%%% M z ,%%0H A C0IBe 0 < 00 00- -- --------7 --,,,,,,"&!,(,,,*),,,,,,,0000v0 D09F0GE0P00 G) )D)E) C@  )))L)2fg2b22N2h 2l2mk22###/ # w###" $ r-*.*m/*( 0*1*2*p= x3*z{wy4*1-023qrstuvwxyz ! -U-- -VET!-"- QS j 75![ 96 | ;:<=>Z0   ))))))I)))K)H)) Mu ))Z'- ' u'~''.'0'/ ']1R $$$$$$$$$%%%%%%% ! %%F;$<$+ =$>$?$y a U%D V%W%"" '""(f #   #,/*###E  D  N EF  kG   HI 011cI 1de1U1fgh-l7*-4 -8-?<2 --=:[* **> *  *  z , ,,  ,,,T , ,,,,z j ,,,, , , ,22222 2 2 2 2 2 2 22"d """%" ""|""@" tuN vw:x&&8 &02&& & &1(7:(98 ((( ( ( ( ( (@(= , !000 0 0 0 0{ 0 0= 5 00t0 0. r W7G1/V   32-9@ FB A-D- - -; - Xs 1 ' '''' '' '''' '++ :4! "| +# + +$  + ++ +h  %%%%%%%%%%%%% ! ! ! ! !!!!!!! j) k) l) m)n)o)p)q)r)s) 3~ 3 3 33333g3<333( S!T!U! V!W!X! Y!Z! F [!\!]! 0 00000000Z3 $$B$$$$@"?$E$$$$      r     X -EG -- CHJ > ---I ;# ****** ***** '8 49652)d)))2)))r)% &TGHIJ KLMUNVOWPX e.QRS " """8 """" z"22222222222222222 2 )) ))))))))))''' ' ''''+~"Jl""""*I c*jdk**g *!* "*#*{i00000000000-CKL| ----- ---M NO- P- %Y% X%%%%% YZ[a\]bS>^  e_d`'GIHQP SUTVWY,,,,,',,,,,, N%%%% %% %!%"%)* ) ))))))% r ))}///> / ///// /!/,,,- , (, ,,,,, ,!,",  A $)  **$\****+= ++++X++S2T2U2! V26 W2X2Y2Z2[2\2]2^2_2d@  !]" + 1yVw{1|}~111Q1 1!1"1X$Y$Z$[$\$]$ ^$) Z&_$`$a$b$`2a2b2*c2d2 !%e2f2 g2h2%$)-,/.:9<;JLKNRM]\_^l "0 x" "!"""#" $"^"#`aY, e -3z456789 '  ' [!"''#%'$&'''''! !!!"!0#!$!%!3+0 +/!+123"+5r#+67$+%+8&+ h!i! q X ,,,,,,,,$%, ,#, 08u 0"!000#00&0%$0'0 )!)") #)$)%)U&)')!"#$%&'()*+,-./0123456789:;<=>?@!"#$%&'()*+,-./0123456789:;<=>?@!2"2#2$2Y %2&2'2(2)2*2.+2"$$|$}$  $ ~ $ $d "x v#y&|'}*(~+ 213045#$%&'()*+, -2 $*fle%*&* '*(*)*ht**p+*squoU,*%@ &] ' ( )A*+s, -BkD ./C %"&" '"(")"*" F+","-"."/"0"1"%'&'''(')'*'+','-'.'#t/''&'))())) )? )+))) )*)),) s '(((! )(H *(E+(F,(-(.(/(0(K1(2(JI'+(+)+*+++,+-+;9.+/+:0+1+2+^ 3+4+x<( (((C((( (!("(#(DG$(%(&()0'1'2'3'4'5'6'7'8')++++ ++++++*-+,., !!H!!!!!!!{J!!k !I!G!M,|.}..+~......10...2,, -,., /,Z<0,1,{ 2,3,-!j .!@A/!7 ~ B0!1!m O.-]/-0-1-^_2-3-4-5-cd6-7-b8-1  %%% Y2!'R 3!4!5!6!7!B 8! 9!2" 3" 4"5"6"7"8"9"y3(4(M5(6(LN7(8(9(:(P;(4{|}~  4,5,6,P 7,8,9,:,;,UF<,=,>,?,5= h/ SRK VQ\ T56 8##3###9#2=<#;#>#@^#5#{ 5 6#7#T V U8#9#5+6+7+8+ 9+:+;+<+;> =+>+?+ @+A+YB+=C+D+E+768A?@>BCDFE7/8/9/:/;//?/@/A/B/C/D/9':' ;'<'='>'?'@'A'B'C'D'E'F'G'9-`:-[a;-<-=-eU>-?-@-A-B-C-h\:; <=>?@ABCD E :!!\ ?!:";"<"=">"?"@"A"B"C";y T < LM=>?OQP@AR BSCD` EF;%  <%0 =%>%?%@% A%rB%< .)/) 0)1) 2)3)" d4)5)6)<.=.>.?.@.A. B.C.D. E.W. >=@?BA?##C##### #!#A"###B$#%#?&F 4@&A&B&C&D&: E&3@2A22222222B2C2@ A fB C D dE F M geG c@0A0B0C0D0E0\F0G0H0I0 J0k K0L0ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWAP QRSTUWXVZ)YZA:)[ ;)<)=)>) ?)@)A)B)C)D)E)F)ACD$P$L$$$K$JG$$$A#B#QC#W [ D#.E#F#G#\ /H#A1C1D1^ E1F1G1H1I1J1K>B!!!Cs !!D !!! H ! EC (<>?(;((((((AB(P ((D2E2F2G2H2I2J2K2L2M2N2 O2P2Q2R2E/G/H/F/I/J/ K/L/M/N/O/P/Q/R/S/T/F{, &z FyG& HI -  JKLF. G.H.I.J.K.L.M.N.O.P.Q.G0DM1El234567H8I9:JK4o G)H)% I) WJ) ! K)H'I'J'K'L'M'N'O'P'Q'R'S'T'U'V'VW'H,I,J,K,L,M,N,O,P,Q,pJ&000I0H00LJK0MN9OP0 J+?K+@L+i: M+N+. O+P+xDCQ+R+IEHS+T+L G F$G$H$I$J$K$ L$EM$N$O$ HP$Q$[=R$L( ]M( N( hO(P( ^7Q(R(S(T(U(_L)M)N)O)P)Q)R)S)T)U)M jj MNOPY QR ST U/VW.XYZ[N ))):~ );,)<>?)))=O!ce !]hg0 I!^!!O<( =(>(?(@(QA( B(RSWUVC(TP!D D Q!R! ES Q P RT  S      U   <R&I EH5S& LT&# R,S,T,U,V,W,1 X,Y,Z,[,\,W ],S"T"U" V"W"X" Y"r Z" S$ T$U$\V$W$T =3>3?3@3A3B3C3Z*D3E3F3G3 H3I3J3Tk+l+m+Wn+w o+p+hVq+j+[+r+s+t+x T1U1^1V1W1 X1Y1Z1[1\1w]1H _1U&OV&W&GX&MY& PZ&[&U+V+a G`KW+X+MY+Z+QZ[\+]+^+_+W\X]JKbd$X[Z fc`ebdknmoqpX-vY-x wyzZ-{[-\-]-^-|_-}~YRSQPfg%ecYT [Z] VU^ %K W X `Y#NjZ#'[#\#i(]#Q ^#_# `#a#pb#c#Zn \[os]n&_N^o&`\&]&QR^&_&i `&a&Tb&Uc&^-)))/01)283 ^)_) `)& a)b) c)d)e) f)g)h)i)` n.F  < t  ..  abcdefghijklmnopqrstuvwxyz{|}~a /////4 //T /Y /a*  b*c* d*e*f*g*h*i*c](^(_( `(a(b( c(d( scdefghij klmno pd&e&n f& Wg&h&Y"Vi&Xj&Sk&l&m&d.e.f.g.h.i.-"j.k.#!l.m.n.o.p.efY 0h R#gS#T#U#V#kW#X#efghijklmn opqrsghijklmnopqrstuvwxyz{|}~gD-E-F-jilG-kH-mI-J-nK-oL-M-N-O-pg h i j k l m n o p q ptqr h  N Q   { 1h000P0< 0!0Nj"0#0$0%0hijji`klkmlnopmqrs thWO P Q R jS T U V j`++l+^ ++ Z?g}++l$nm$ oqn$p$r$l&&&&m n &&&N &&&o& &W &G mni)*Cnd#e#f#g#h# i#j#k#l#)m#n#o#p#omnr#q#. n(o(p(q(r(s( \t( gu(iv(o] 1pq1r:1t1u1111vz1x11p$q$!r$(. 4s$t$/2,u$7 / v$"w$*-p& q&r&s&abt&u&v&cw&x&p'q' r's' t'u' v' Zw' Nx'O y'z'{'qrstuvwxyv sq,r,s,t, %u,v,w,x,"y,z,q.r.  %)&$s.'t.u.v.(w./*x.y.z.{. r*s*t* u*v*w*x*s#######sru{tz s#tQOrt#u#sv#w#y#qx#z#{#|#}#~#vuzt++++++ 3 ]++u# t)u)av)w)x)y)z){)|)})unv'  W wxyz{ |}qu2v2401-3w2/Ex2wy22.,+z2{2|2}26~22v% w%x%y%Ez%{%|%z }% ~%x 5 00 000c000xv!a !l !b !!""x+ +o ym+v+++qx$` >1y$z$B{$|$}$.6~$=U$ $$x-y-z-{- |-}- ~- Q --3 G--y ' uz wx{ | } ~ z{ y+z+{+\|+dke}+c~+F++a++]+++_z--A-@x. nI--------zO  : {!3$4$5$K mh 6$7$8$9$:$T{,|, },~,? Z< ,,,|H I bJ K L M N kl|{ +a~+ |'}'~''L '#' ' '  ''~jX 6du (vt iMS}w4`-a-b-c-d-##{wxy ###X |##*### ####%%L1% }|~ !+!!!,--!.!0 !12!3!$#c %% ! %  %)%%%%)&% 6&& &&` &(((6((( ((K (((------- -H5 -----?e :(3 ((( (((("" """"" " " " " "o""w  % = M -> c  )) )))v) ) ) ) ) ) yM~..... ....8& .!4!! !. G B 5!!m!6!!7! ! !!:)))) )))))  )) I J 22[2222 c2_22d222  m&_& & &&&&p&& &&q&+u++Zp++++As+ ####GoPi ##rE D #D}~##### #####******[**~ **** * * A #  n  +0%  Z)  N  ^ qf ? r+  s$3%3&3'3(3)3*3+3,3-3.3L      /r / //// ///// %%% %_%%%%%O U((((y (x4((|(((({(/////////< &/////// !v!!t!u !! Lz~v !w! |!#K #># ## ###S / // / / /2 1 /- b*^** **\ *'*aJ****`....DA.EF...G.M ,,, d, u, ,--- -Bb --- -- -%-'''9 '6'''W' l ''(9(}(J (~((((W*X*Y*Z*[*\* ]*  ^*_*`*** 11111111?111111''''' ' ' ' ' ' '''&&& &&b &&&'''((((((9(()))] .a .r. .!.".#.$.%.o&.'.%7%%%%%  %%*v ***K*Q *qcUh< (( v ((((((((###; ###### #_n  ##Q#  hl## #+ 98 ><!; !!= ! A@!!?'' ''p '''' '%%%X %%%S%%%MZ*  u  +Cz;++++++p ++++,((b((d((((Y(6(( q  C  wQ  ]  - C----- -=Y3Z3[3\3]3^3_3`3a3b3c3..6N..MV..PR O...QUS.T00Z0[\0;W^`_]ab00 01 / : P it s}'''''''''''''''''' 08d ;9v:00000 =?>@ , ,,,,,,,,B ,,)b)> $)#"!))%)))&)1111111111111+i  ++++y +g ++++o ++y*z*{*|*}*~*** *** G%%%2 s %%%%%9 %%8 9@ nH....W.. %...X.... Z.Y] l3m3n3o3 f ~    A N ##k 5 )  # #7((((((: (( (((L  , ---]-///   _/// //[/*F***** *8**x *,,,,,,,, ,,/// ///////////@   N!XRW!.TZ?!!Z013020## u ##` Z# #L  o Y $2 b'ec'd'e'f'g'J h'i'j'k' v %%%%%"%[{ RR$$$$$ $$\[^$S$ bd***Z*** ***c*h ***..\.P[`._^ a......b.c.. '$   '$'cJ '''''' ####J#}####$ """"""""" ~ . .t.}.z # w x|. m .{ L"M"N"O" P"Q"R"// /M//////r//////// /,3,2,,,,,k,,4,,,5,y,D6,A |<=2V? !3"#>$((((( ((> (  (( S0RFTQ0X0p0V0005) _4)))8w w )* )))7)`9 6))sr&t&&&u&v&~  L  ***** y *R ** y _  3   !\fda!!!`E!b/!H! !!i[!_---X--------'''''''' ' ''++" ++ ++= ++*&Z%  g (&&&&&&&&&0&&&..i...;:jk v{ ..l. u . m%n%o%!p%q%r% s%t%u% o IP e/vu"""""" """""$h2g $ o$$H$?$ij3$$k11111 11 1111p r @  Ub)z  ********S w * {|}~  g"h" i"j"U k"l""$,$$C! $$$ $D$ # ## ###  |# #t # ## m"n"o"p"  J  1111111111@1..Q+ .....^.. .mwx&&& &z&by&&&&&& I&&&&g&&&&&DI  ./(012345678 ). -'*,))O 9?)):)BF))A)))J))a   cj "!@t 9:;<=>?@ABC  B  9 <  $$$s$$tu$$$v$xwy z$$/{$$ //////3 /////////(( ($ (((;((%(.o..n.S p .q.Z0s..S uv.j .#1$1 %1&1'1(1)1*1+1,1-1.1/1%%%%%%%% %%%&-- & -- --- --U '''''''''' ()*+,'102030405060708090:0;0<0=0>0N?0"""  "!"""_ "" DEFGJKHIL MNO1111111111y22&&&&&&&5&&&&&& .A* _ A ///////////// ///00000Sc p..D. ./ .U G ...E.K&$'$($)$*$+$,$-$.$/$~0$1$2$22t222u2v2t22s w2 ,,,,,,,,, ,; ,,[\ ]^_`abcd => ! 0Y L X + ----C -m---  " "LC """p f " q   o-p-q- r-s-t-u-v- w-F["\"]"^"  _"`"a"b" c"| d" e"f"'2 3'4'5'm '(f _ (q (7()))))))) )))s  {|~ }y~))))))))))o))t B!@! A!C! D!E!F!G!H!%'%&&#$&(&E &.+*-1 /?  Z3V}******h***] *  *x kXu_aglSVY8Mj)|JDqCUF~`#={&6WK^L bB4e,?PA[r3Ot\@2ndc$]H!/wI9N-v1sE5y7mRZzh<;+}f>%G(T Qo.i  '"0 :*pT % = R  l  H3 n^i$  c  & 6 J ] t $ F o& Z; {  [  d ttZ O   ;(bY: u ]    Z&gx<WX <Q *C  MO  @ 5e a+ V. B `4 w e  z Z  $ a s 5 T  J" r , C W h %:Nht)H-Al p M -   y! w   T h 8 [3  #  a8i  Wi X  *  G Q X e qK~+N4 2 #Kn R   f 6 l g rw"r < = M HX44 # B }5OxM  > R I $ S x  lGr8  D y( < Og     aaH   v? 9 _ RP 6 uY  BOH j . 1A,  B[ + d}^ L "[ .@P Z& DTQS WCm\ZE Jcm2 s nFZ ^)j^$pR  /  eqq4  V `f9x '6 ~ ` \ t@0 !H C ID\ Z < C ]   '&  @ j 3 _] 1Un U E   Y   )D e  ` %?9;LN ][`]` A" r zPcd pe -5 % { N |Q  W j0Y  FS VY1 x rb : (5Mu k A 1 375   Di5 1  :   2!u++ '4 u8w3<[ N=c d? < kI    %  . E T >U @ Dxj H  GN 2 IDi  Ba l 2_X , 8  Z \Gd89 D \q -   bRRZ T K c _^ q $ v]  _ M  .hb _ '    on|A R   =@ s s  4 T2+ sP  L9BZ 3kE fGR u p p$R >, Jj0yD= ) 1 6K 6 | n}tC|$8 ! r J 0p  }A ( WC 5Y} ' gEvW j  / J_ >| KT + O l l I "`k +  ~1 `K^ J -v 2 u >t s^l A  o CE 8 , ?  $  9 :g K 2O -  &6= e v[ Ko=7a>y i : lG v;y}~: p R6n> ec )E  O  |. SQ {  V  xg | >J?  B V[~ ) m N &= # d ( a 7 Tf "1 \  ~ t7-K v ZL. Ay~* . *   z e1 U +* m1u  /}{ > jpNB=WJ  w: k3v A  ; n S .z^ m  *) :N  L  g j [ Xr y h x "! (=DqU2 ib+, C |R `3  q  $_PV6~ 7  mz  B  U #p;& ' {X xzIXLU  d8D'<  m s  I,m%] Z 07 / " | Ub   6 Y  w  * w  Q `! `  G > t  7 8 L > J ?&:!,9  M |9 N %'S i  ? 2 ^ Z(O-: c/ + |l'S@:X' <C 5`n711 D #: V l A 4 vUW SEzFIa _PZ#7Ha} * ; T h } ~  ) ? P k US 5 $U L + 4{ Y     c G EYuH e ACd ^ [ ! JBZ xo,\X#n tz  ?n cLM^v /g o~{ *8M f wqS ^ i wQQw 6bA  ] !Ybn$( ( F E h z fF FJi gL}? Hf 0 G a @  B h {Dm z ui I  6 O c y $m0P ] ;/rFX#  t p o   y  w> *0 P O dE F w  ' ,  x \b%eRM X . y  } g b Q <! z/\ i -/- V AC {r B pSV%>  @  ~ q Z %W96 S0 P P  4 I _ s   0 B S m  MX#} 9 o ~ hCT    , A Z r  & > S 0 "y@O; n)m 8N f  F I |5 = 9o   2%    c  g F?]Xo  - u G  q<G/ o8 tY1h\ I ; qf* /. 4 g? f '&=: `* .Jj  3 H \ q  y M%# 9w 3?P M u{ 7 4 ]E c %u &R2d5  L  s bL /        ki " K G" hJ _  4d (9   # 2 G [ p   3 H ^ r O { <   K,W b ,/? v38j)e s 3 W & B [ v  1Ql( =  | e  ^ + 5Z  Q  x yT*( L[rz GQ  {N Y !{ "   - @ V k   Z ?_ k q  } k &dh E  ;  s@h  I[f &; K  / @ Q   7  Lg k s. aU) V W) c"k W(  z!K  6C 0' !% ' j ,_ V Y F x) K< < T  F; I &F  @ s# f M om D  $37  t 7   0 0 9p;HN4    kV O ]l. \H -Ub Q5]va Y( P N!  \ o #  f)+ j *  U=% d\    ~ E2   0 T - 37" P V9<689=42;B4? =  5 : 1 7 A0;C1208B88A655=497514986B29@A 1 = B!2"0"4"8"@#>'9(9(<(=)4)5);*0+1+:+;,1,6-8-;.0.@/4/8050=0@111B2=2A3>40484>52838>9>9?:5:6:>;0;1;5;=<2<8<@?0?5?AZ *A0A2A4A7A<B2B5BBD4D:E3E6E<EAF5F<F=FBG4G@H@HAI0I1I;J2JBK2L8L>M1N5N8O1O7P3P@PBR2R=S8U0U>UBV4V:X4Y3Z4Z9ZAZB[:\3\=\@]3]7]<]=]A^7^=_0_A`=a1a4b?c6c7c@d=f4ggj2j7j8j9j@k1k5l3l4l>o6p5pAr6s<s=t1t=u8u9u;v0v3w2wAx<y7y=y>z?{0||3|8|9|:|;}1}7}A~2~<~=7A32358059:?37>5058:6?247>B<924<B0>B26@6=A44?2359;=1A47<A2:=;8=?B5?A16>AB44?5;06@>39>?55359?A57<?;@059:A:8;A=4>A1515>:;719B5<14456Z)B4B7A09B>46797<B569>9=@A@04>159034=?B6=8;61<529>A6B9:3012795@69<3>1<;6:;5B:@18;@537:=?;<8;;=:/270139:74B17=1B:kB@A57;4<=@8B20084A8>C=  1`: 6 : > ? A C 1? 3 ; 0 8 =8 ? 1 8 9= = >527:@:8<;ACA2^;45+>?5{9;A01 ;47=4?14<<= B?9A2=25;@A7>?A 0 4 9r3 < A1!0!5!:C!=@!>>!B"7":">0"A#?$66$7'>$:%0%2&A'0':'@(0@)@*54?*:*?+<+?,0,<;-7-:;-A-B.8.92.?/1/904080914191<1@292:62;32`>353B4;5455161:70B477787B:828;59:Z<:2:4:7;:<5<68>;>B?4A6A:97A?A@B>C0C4D9AD=E1!?E2EBF3F8G0G6=GAH5H:H>I4I5I>AI@J0J3J7J9J?K3I=K4K7K;`2K=L07L4F6M6M9p<M>N4>N9O3 BO4O@P4\4PAQ5Q?R9RAS7S9S=T189T4T;V2V6V8V>1V?V@W195W3W8X5X6X8Y1Y6Z2Z3Z>[3[5]4^3^4^9_2w0_<`7`8`;`Aa2a6a9b3bBcBc>=d3d9d<d?e0e5f@g6\0g:=g>g@h2i2h46i>j0n>j>l5l;m8n1n6o5q8q?r4As2s4d7s8e=s?t8t9u2v:x6x>xAxB;y;z1z=6zB{6|>}3};~43=B344@0344;6?;6AB36>40,89@A;@<<?3>5B588>R4?1A385924!8;99B79567B40>B<483;e6?AR6259:1=M:>B068B%?7:>3T>1?;?@A0<?0x0127?;>@1:=?0B14468<?QA03&2=5556Zf89?@569=57I29B=5;>54=A8=4?8@:<@@A8?224:;9;0==2441aB2P742:4?A60?@41436<61247860318~7928@<A7?A1A;;=k:?@>?B39:<>35_;?@43=8-1?153:2AB49;2026@>??5299:677:=2579;>3@45:58@A$9B23469;?>09;=B46=8>8;=905;B20689B0g058>>u>964A:=347=>=269B:489=:=;=8A567B@4?=0>?BA8:@>A184680>S?4A:;@2=>?A8>B62039<72?067;C04815:>084B1u<C+8891>5739?X3@  679.598@Z  2 5*= 3 ;;; A; 2 5 ?3 A0 C : >30 C C 4A @4AB3)B:5:;dBAA5Y<98;@49B>02j16&>7;N3>I9B848;@Z5B8W4;>2207{A>BAB;AB546=:;=>U268A@`<AFAQ06>&?8?45?0;;@:5AB,4 !" 2YA ;)=!;t>!@!A3"5#7#8#A$1>12$4x9.=$;%>%B!4&15&4&6&B';?(2=(:8(@(A(B2)9):c2)<<*;+5,A-9-@.1.458.7.:/<=@/>/@?/A/B0<%80>0?"?0A?15182021#622252812>?33424=4A5059455>8606365A67QB76>772737<480784B8687=>s@8=8?99B19;K69AW9:1>:9::Q=9:?:BG1;2;6;@;B<<4 ><9Y>=1SA=4=8=9=:<*7>2>44?1?7?=A??@0V3@1@3@4,?0@6@8@=p4A5B;B=B?y0C8=C9B9C;C??6D3D5D8D?D@DB7E92E:IBh0E>>E?F@G5G:G;49G=?H4H6H8I6J1BJ5AJ6BJ;9K0K8KBK:=K>K@KAL7M2AM4M7M@>MAN6N:1N==N>NBO2O9O<O=P8P=@Q9Q@t;R7R@^<36S1S3T<S4S5SBT3T6T8T9T?TAU3?;1U5U80U9U=U?V0W0ZV1V9VB3W5i?W:W<W@F4WB=6X0X7X?7XAYY8Y=Y@5YBS6Z[\[2[6[7[=\2\5\8\:\?1A>\B]2*2]9?^62^A;_5@`1a:a<a=@a?,=b0b9Bb@c1S>1c3F0c4Bc?d4$=d6!7d> Cg8dAe2e;o3e>eA9f12f2XB3f7f<g2g3g7g;g=hijh5h75h8V=5h9#0h@i1i3>i7i8j3k4k8k>@lmnl64lB>=m0O5m3B%3m:@m<mAn3~6n<1n@6Ao1X@o2c8o8*3o;o<o=:oBT=O0p0p2p7p?k;p@N@q0q7BUAq;0q@7r0r5s;r:@Bs1?s5t52tAuA:0tBU4uBv4v8v;v>u1w6{3Aw8w:wB==x2x=A8y4'1y6yBz;z>>zA{={@|=}5>5}627}8}=~~1~5~9~?@6~B689:> @?b>8>&=A07?6059@;0BB768H9=:ABA00B592;2<733865>AB<39499>1=3 9541?6@3y@?<677=A{@89@:0=:@118>??B!15B6:3;57901<>56Ab62 78T0:@BA>9:?1@8?5 :?(85]5=>0678@4;548;069;A!998;=?u47124A7;?0Z9>u:34268q:9:>A86:4;07;431:y:>@6z2176:[9At<2809=>8 6@7S;1CB>6575<082A18<34>?4K<03:6;?B556>B163??02j;3S@60703597nA=:2@7l06x7;;?B=B67:=g1B9m11s63Bg<34K1<>A19>^?]@6A:05?B~A0BAB719;8_>98@A6Y2<B7B497d07A78=@@B 404@B_:5?;0@<=3?@01A6B:588?017E@0P661\6:?A;An:=00@3>?B3<2?3{?8 4B48P?:?1>>?153673;8:;:>AB4;5<=B<<=AB04>=A><?A0?^86831B7>21<?97<8=?36>R0:;J=X>A0468@0345778@>9?68;>.Bn;=?;;=;?r=67:y2612:><>k7?<A69d85@@=BZ1758<231J:@A,@A7:8<038=0B09343A065z56=>34778>q6AB19<1Z=7p=@/;5@j<7@x13W2>?@B@19;=@A31<6/668G3<4x5=>?055j5<2;=m6{>?0A>C<025A:=9>0:@3e1[9>0@23'477;@H=ACA6;B18<<2>2{5:=B%AC 5678>> 246:<jB>99CC@ 1@l7250B 3 444z4 85 ;7 < < @5       0@ 1 7A=l1        <42 = B9 2y3 3 333 5>9E4 9; <0h1  0171 2; 52 6l@ 72 :< ? A2168TB<<<<=><+7?47r8057<=77WA?^1@$86 07^@C03133337:=1Y0@#2586277;;<;=3@0C[BA70v=5@11U18:::>:B51233334894:=87?651D;23?<065897;=<5132<@27:=;704295s>@=02233337A@9=4=6x48<9;A@B>780 B5<8B:<6 627b2X:8=? +!, 5 6@ : ? @5!"#$!6"GF-"#$%"#$%"1"2@5"9";"B#$%&#A@.#11#3$3(3)3#4#98L<#=;#B/0$CB/$>$? 6$B<%&'(%ED0%4%5%69 =%90%:%;1%<%=>&;HI&'()&'()&0&5&7@:9&:0&@>9'()*'PQ7'2'5#:CA'6'<'=6;8'?>'B(=LM(4(5(7;(;(>0.6)*+,)TU9)1)2 2)64)81H2)>)?923*XY:*+,-*+,-*69*8?4*<*@Q7*A*B6A@+,-.+0+3,3.3/3+6+=9,5oAb4,9,:6,;G>1,>,B @r9-./0-0 0-27-4@-5+9-6-=->A-?3./01./01.2@`5/012/2/56/6/:= 701M?03132333060;01123416171:1=?B1>>6i41?9234523452<3<5<9<2?E82@=;345630=373839X<3;3=3@1414353:3;344:4:4@567851+B56k@Q;5:5B=6JK167896789686:26;L1:6=6@;A789:74]?@769;7;=7=A7@47A8NO38185>?8@148A78B>9:;<9396t6u69=?3A9@2@>9BA=1:;<=:;=>:8q<:<>;>6;?3?3<:r7=>?@=5>VW4>?@A>0:>14U7>?7>@0?@AB?@AB?2?8d;?:@:B:C:@7"6@9@<@@ 8B2ABCDA1A3B334A9=<73C@D02D1D2DA,7EFGHE05BFGHIF2^2k22F75F:I:O:Q:F?GHIJGHIJG23G7<?@G8GJ@KLMNKLMNK5K9e?7K?5?BL207L5M5L6L9?>L=L@BT5?LALB 4MNOPM3M87M<[4=8M=(1a8NOPQN0N1N7N;O;U;W;N<<NAOPQROPQRO?|5OA>0OB@P09?P15P2P5rAP9P:P<|<}<

QRSTQ1Q2Q4:Q6Q<1;Q>;RSR1@R3R:S:U:Y:R>0RB1STUVSTUVS03S2t?6TUVWUVWXU6V;+AV<?VA-<WXYZW7W?2BXYZ[X126X9?X;1X=Y5jA;Y7]:Y93Y;\;c;h;Y?Z[?\Z0Z1Z6Z:^:f:h:Z?h=;Z@[1:;[; ;[?97[@A[Aq4*4\]^_\11+202\<>\>\A;]^_`]^_`]0]1];]B@@1^0^5pBB>^>]>^B<_`ab_14 B_4m7_67_7A_9=B_@O>`ab`04<9`3>`4`6`9`?`@`Babcdabc5a0[>a3;a7@a;491a@>9aA'74ff5u0f6@f;fA<ghijg5h>Ah?>hA8W6ijklii:l:t:x:i;b5A8i<i=i@'37iAj:klmnklmkk0k3$5k6Aa5k9k=kAR<0l8 8l9w;l<l=l?0?mnopm9}0;m;Am>9n05n4n5A;n9n=0Bn?6opqropqro01;o4Bo7+@o975z@o>q=o@JAp15p6/p815p93Z;qrstqrstq1>q>7?4qB8r1r<Ar@<;rB55stuvstuvs:>sAsBv?R?(6vAwxyzwxyzw1w4z<w5w<w=7w>=2w@x3x8s9x;x?yz{|y5Z;y<;yA;z3?z6z:z8<{|{|}~{2{7{8@0{:~:::{;Bp:{Bz0|10|2?|666)7|A|B}~}~}2C}47}>}?BfB}B6 9~0D>~3~;~>31x<>@6126e99=&;28@;6B;=;4;@@A88B14>38@=68;L:?1;AB2<613A47=8R;3>V52=<<<<@f014::::;8=8A2f=4831?o:=7? 7A5=\]^000C11(?8]8;;;;=;<>9?@2<7AB=127?A6B6003B58<<<<>}@A$2@1405:6=@::::<=C>A[8;9y?9<;?n2;1?H;@1445]6=@5103Z74264?@64<0:41\92>8;=9~@?66@3609::::<97*>=<[0q9?4qA:55=8O67==?_?054;8[<>3<5M0U@:729<<<<=96237;5@A0B@14;4B80::::0371;vB;@q5@def0@A@>z7;AAA_BB2i034:<@<1 @@5 >:5<6?B498<<<<@q2yz{59<83@:de03j?4r>2>59;7B55E577>9@1B<Z}55s39)AD6;;R82:>/?@@A.A3F>44::::=A?10r?7'Af9<;?<5@40k?123=B2#;385>@468w3?<=B>@?=,21>r2%72AA3=m59:|4;7?8:??@A7?+4=AB496::::0351AT:2l2757:AT20A133=19{4>>A)0iB1L3=?v@x@@146:1P;3?B69;A:B015L?89<<<<0@7313;>08}999;X2??6:@N?79>7274:@8130;35&882?B::B=@9<=T@39;46222240IA;;B?B02d:3B:?0|@t4"36/=7:<;9 ?F1=06413526900<>V70;618989<><3::::>??m?7;8>#@C>9>:j4y1A383;1<<<<=>B22224O88>9806B4;97<@=>A8BB8::::?@E=A3B7w919|?6<>2222=>1@A=?B08n7;=20?4539=A:$0;;<69=4Z<Z0173537:415<<"=m=A<822227@6035B466?@78_3A4;>@1{163:7;80@1k<37nB481>>?9N2>B#5?6y90=941222236569<>? 3W=>7h3979; </7?75Z8:&<14736g4<0@A1B=@c0142@7B9::E;F;?4A3288;Be<47:5;263?A222230@4S<545:==@Ai9;?n8;A2B056'88v1;8=A7cA8@?:9=2=B0:866:B6>p;&35<=AB?r;1$<4bA@4>A69999>24?7:>=A1722238A:M;93<;c==b:?:AA1;j6<A@ >BB?B5689MB;B4B68;<=lA@.;0}:1&9=2633=B%@5022f>4<B2:mBBB<>=39798$@8<=3=4?A8B126453:/m413467038=9::: 2OPPD,P8P>PDNPQQDzRT6UEUUUGZeedccbbaa``_^^ ] ] \ \ [ [ Z Z Y YXXWWVVUUTTSSRRQQPPONMMLL  KK  !J!J" J"J#I#I$ I$I%H%H&G&G' G'G(F(F) F)F*E*E+D+D,C,C--.B.B/A/A0@0@1?1?2 ?2?3>4=4 =5 <5 <6 ;6 ;7 :7 :8 98 99 898:7;;<<==>>??@@AABBC CDDEEF~F~G}G}H|H|I{I{JzJzKyKyLxLxMwMwNvNvOuOuPtPtQ6Q6R 6R6S5S5TsTsU sUsVrVrW4W4X 4X4YqYqZ3Z3[2[2\ 2\2]1]1^ 1^1_0_0` 0`0a /a/bpbpc pcpd.d.e-e-f,f,gogoh+h+i*i*j)j)knknl(l(m'm'n 'n'o&o&pq%q%rmrmst$t$u lulv kvZkw #w#x"x"y!y!z z {{||} }~~ jjii hhgg gg   ff     af_ZAam_ETar_AEar_BHar_DZar_EGar_INar_IQar_JOar_KWar_LBar_LYar_MAar_OMar_QAar_SAar_SDar_SYar_TNar_YEaz_AZbe_BYbg_BGbn_BDbn_INbr_FRbs_BAca_EScaeEScs_CZcy_GBda_DKde_ATdeeATde_BEdeeBEde_CHde_DEdeeDEde_LUdeeLUel_GRen_AUen_BWen_CAen_DKen_GBen_HKen_IEeneIEen_INen_NZen_PHen_SGen_USen_ZAen_ZWeo_EOes_ARes_BOes_CLes_COes_CRes_DOes_ECes_ESeseESes_GTes_HNes_MXes_NIes_PAes_PEes_PRes_PYes_SVes_USes_UYes_VEet_EEeu_ESeueESfa_IRfi_FIfieFIfo_FOfr_BEfreBEfr_CAfr_CHfr_FRfreFRfr_LUfreLUga_IEgaeIEgd_GBgl_ESgleESgv_GBhe_ILhi_INhr_HRhu_HUhy_AMid_IDis_ISit_CHit_ITiteITiw_ILja_JPka_GEkl_GLko_KRkw_GBlt_LTlv_LVmi_NZmk_MKmr_INms_MYmt_MTnl_BEnleBEnl_NLnleNLnn_NOno_NOoc_FRpl_PLpt_BRpt_PTptePTro_ROru_RUru_UAse_NOsk_SKsl_SIsq_ALsr_YUsrcYUsv_FIsveFIsv_SEta_INte_INtg_TJth_THti_ERti_ETtl_PHtr_TRtt_RUuk_UAur_PKuz_UZvi_VNwa_BEwaeBEyi_USzh_CNzh_HKzh_SGzh_TWeeuro ccyrillic&.9LC_CTYPELC_NUMERICLC_MONETARYLC_TIMELC_COLLATELC_MESSAGES"(/6BMYeq}ARMSCII-8ASCIICP1251CP1255GEORGIAN-PSISO-8859-1ISO-8859-10ISO-8859-13ISO-8859-14ISO-8859-15ISO-8859-16ISO-8859-2ISO-8859-3ISO-8859-4ISO-8859-5ISO-8859-6ISO-8859-7ISO-8859-8ISO-8859-9KOI8-RKOI8-TKOI8-UTIS-620Z     `  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??? ??? 0 0:0:0 ???? hlLjztq|*'InpxXoudifFeEgGaACSncs[ annfinity(nil)SuccessOperation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorNo such device or addressArgument list too longExec format errorBad file descriptorNo child processesResource temporarily unavailableCannot allocate memoryPermission deniedBad addressBlock device requiredDevice or resource busyFile existsInvalid cross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeNumerical argument out of domainNumerical result out of rangeResource deadlock avoidedFile name too longNo locks availableFunction not implementedDirectory not emptyToo many levels of symbolic linksNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedInvalid exchangeInvalid request descriptorExchange fullNo anodeInvalid request codeInvalid slotBad font file formatDevice not a streamNo data availableTimer expiredOut of streams resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorMultihop attemptedRFS specific errorBad messageValue too large for defined data typeName not unique on networkFile descriptor in bad stateRemote address changedCan not access a needZ ed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in too many shared librariesCannot exec a shared library directlyInvalid or incomplete multibyte or wide characterInterrupted system call should be restartedStreams pipe errorToo many usersSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocolAddress already in useCannot assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableTransport endpoint is already connectedTransport endpoint is not connectedCannot send after transport endpoint shutdownToo many references: cannot spliceConnection timed outConnection refusedHost is downNo route to hostOperation already in progressOperation now in progressStale NFS file handleStructure needs cleaningNot a XENIX named type fileNo XENIX semaphores availableIs a named type fileRemote I/O errorDisk quota exceededNo medium foundWrong medium typeHangupInterruptQuitIllegal instructionTrace/breakpoint trapAbortedBus errorFloating point exceptionKilledUser defined signal 1Segmentation faultUser defined signal 2Broken pipeAlarm clockTerminatedStack faultChild exitedContinuedStopped (signal)StoppedStopped (tty input)Stopped (tty output)Urgent I/O conditionCPU time limit exceededFile size limit exceededVirtual timer expiredProfiling timer expiredWindow changedI/O possiblePower failureBad system call5@@. @@  !1Aa  0@` #+3;CScs???/etc/busybox.confZh11AY&SYA*_rp`ďA@}]Nn}w=qJ6ȕ٧gG[4ݨFsmR}vvZwm/kfm.Wm(V4o.^ 'o =sϫY[WkQypPz ެz{/{zSmX&@-Qܛ3.zvڶugL%Lˑt²dSIא%011lti]MM2jyud iUipI<"k$%*]%L&uwã~}Gx'FT?jaTBO٪N?w7lD*wOW辅_r-I"Oޫw~cï]Yf6 R! ƶi*Ӧ6*렆z$[3Y'Y`k\UvI=r#0QoGޱ9,o5Д_&ݜ}j4.wE"3"!U Q1.H Gnw>gfg8P csGWst< ۊ c\}S'Xn4"BzB"[]35 $-S^VTp0Ue AipJ0#aZA(/LC_ J5$vk?{p|ْ-Ff]2 I:;҃ y{|"N1EXQÔ;EcFoӧXЈ@0H3OF%txv>11㰒0o%CnO&SAb  iɆ2jzdžsی "T ؃"F"4yՓNGW}hDg4- ,5:,`ۓGK N=0 /_{hJ!HE:3JLIw68e5axE; *)z+G rDX=[ߕqjc&"] ϥ\FfL1ڂEy*hݙo喧mpl+$1cӺrac&6&6aﭟۇr ]CNs 9Ȱ.zѼ7 ͹ҵI,U?m%}c:g_2c]V E7tСcQQA^ U-d*3DC&;M-s $!u!b)ӳWiu2"94R@;zPPa8d`4`^end*o,|%㱳9?І{O%nYUW ahP-/mI,.Tی:Q5JHB%Kuʆv9l?I5N ~+@lokxnS me^ʒ3tՍL&A ݴOQMaB\k-<lCrh~XE@ |:sWW׋} c5t̳ 73;\G+$gs[Lte)cciaJ@XtAR;N5CVVy!} ?S[[b`K~C"M~6,^As=h \ũjvt)i#qhwxx_RH) (eZ$T~Ǎ+(Յ$CL@ bA-({ ۻߙ,BMkL\ g;L(1@LQl~ײܺAbryb:fe;~6'ɓQy 7钇fʣ vIe$1V۫94DEF.-H_E&u,J4[?rOU~DG|-Хs>F#CcHe\t̉z#r6TΛ OW$flb5O)}@Җ,he=NS]Q34I0#y%IONEb}DAr(%S84S!._B7xd95J:/r?U x ڇ$8"^)u: ×8.i}Zr) \%lRM[OuqT AoơU9NWb \zB:IVOշh+: hFM byA{s`!{MKlBDLԪ{9&:P#%?ӵ`m?uy|xmt}'!W}#!rUb?/է;kjm;{)?a}[]U{n\~L2bErת̕%P= / BԮƉ_-/O2{JQRx.b(Ӡ?N.g `JKW|ObP`g9sةȰZ>ٳq6g*(7e:P}Vp晡"ShHf@: uUiQͱE[ XܙDقѓG0YX]v*/%@5}Zo*c752_CylWYq⛷GGTR_/M{9X!*]3Mvdɒ##TR< D-] U$ăL4=\~ C:zS.yڔJBE¥^rؑHDL;_q"LRHB 瞐y_"}9eE('ԄH(]k4dεxil/ g*Z :mX%@ AR,fsǛq uг0d'!8{5ڟŇCI|Xlhǔ",E$ez|pSǑ7\<ƘYbU-5JPóq3q[`Ulb!1l:\{{jlbl~!KgaO0Y2!k2ЖJZuPIɸA>=oat+ ge^0<2$2_MzkqE ` ,^k E'#Z @OGC:Gl&Jw|/ފ͋:})YsjnLJOz|nvJ3q\VF"r!q POl^:^J M$c_F sbg!6;AzOo&Yln1e(3Xl;2x->n/;P8R8~kt=mmH|CF9<ۂoSJF; #v+16?!L쿚oP3C}j2c?["6 bQvꮄt=D1\Z=3d,U :9`r,IL_D tJL{H4T29_(*%>]k^6ĩCrZ*(ISnIQpka5+1oM1SCf>g0V0; cY@bHϑ؎x+A+gj|`%jDQp=/:#OEa`biШQ sN7))Rټd _}n@gq z\1*"7l a %6L 5 {Ic˫SY-,ԄgPi[/W1U çB9yNP5{-A-Nr acJ5Pf7ȜҦx*FBh2#ançF#Ϸ[7&]N~ګZd ΈKDE` RZ;XBy: NB B1Y#5rmk2_Q*k vWlKcl:>?Lz; L~\r{w,x娗NY*UL < TQu%Jo.c,ܒ1ΐf\J$I8nD;骵TzS'kiۅg>coG?e`3FP7aUZ" Y`(tEˌ[\ٜ8Sч[Y(_`; [9^ZWu,g ί<35Պ#86D6i\)[V ؎E-63W kcsk<iKف(^yp6-_\Pn;Bas毰_q!z0(l*D|p?7bg1Hxzuɖ/uB${k2?d(cӭ;޶ gc^́:eOZ~^5Cj'?{7p˶Do=2qhQ:sv )ǭ̌yj^697Ug<]u??-dx@pXCHguxDZp|Gz8P@+-T!q1Ce; h?@-L&\T/&U=qT=el<,b!T]=m w R ]Ixu9a׶=[nmmrǘQqىUa=a%yWǹ7asCl OTIy.;˯0.w:_zy~¹=]H.BD\\n}QXjvX';N;)` ;]ByC"$@J{وP; #҈Ud!՟b{*B)orPѶ2ఛyUH yGQ6$ t/iD?lH`Ș(L QWsi+! [CXi s{PۙEO}Hf釯|N:6JM][{+2 dR'0aC-H4<3.wn{!R ?"FI!򛟧n$ϐ8F0΍6 GkA_:)N>% TD`0=ڬ8Eg VB Y%44W"Vj<7vy=~,n6?FE>v\Tae.j;ˑS08OJ%R0Уd[{q,}20i ze1X;3k>DK0H\SW'tNh^w'PJ]\3P_"6Cq%6Z iWȕ $f|2#ao G$d!}uIe^$~_U ,o1x_]hOG9.O*+G?W!P!Aױ^,O+Ok&ZD KHZ#1c%idV|TڬF =jXX(f(.mbT ԣH(G1Dr~&C0 @ZZ=ޕ u#~e tqu:Z %~զ$.{RdK!uM! 0)c %o7c9{lӖ{ir[,2eUASKI6iODlͭdaE88dbԤ-].TDPvj"JZ/C myaK4tL6zkZ5(TAfx}?x n#Сe(- m ut|Ȑ9Imj   >eP$yHs:{E&ha!(NEqoeM[@(GMI  7kDd$YKeJ(ь.M6 `[m6s3 CEAV*6~vLKv$sLu_vo!DQ"wV&ЧU9vkq9:`Na.Det6@ƙr@%1=AQANXm ޭQ6$ 4Rw`hS.|! HRlSmjkmHRP4 L*?Hz(_;GwַD$:ە#oh>Hfp]exXnn4m~ٱTvG0N5(f~ YiOs146sfMg놧c !TЃ=(30aܯ֞ P 9<3Bٷ}9P2?b~n['MH8x l =Zz4d r01 xgȦFS(ȃqd'5 Fܣ_w+Χ$ZEy@PqK->^'ޡZUyQPe?4~+1Kd ~]V1%wY>3ujN?%n=M_mEėdH@HL(sa੆G`H8uхo]Rr5q33 # f47pR9#'- @5 bdPtʃ^ ;]}6>=GotO49UZ5:YM 5fNZ5BK B<ZN7ty؊?TTEI}/HVA Vgċ<śNh_]st}k3Y( 孛7]w_b=@COLItM#$iF^Nh9C6|{Js{ÕPA \<>:274ui[oPnbG,&3Epۍ=1g|x>e&!Ѡ]c>Pg J2wN{BHA8EI `16ڿw:yyk_ 6r]pE:)إ5 ?Hp4 NNRHD((=}y膅 K- Ȧ[?N'_}jN=_وwd7:RX=-*{Sl81Td8bdA'_I0X` ͪ ),?B 0dE"DF"u>P~~^V|ӵr~n )t`G|v4E8/uJF#q'{JҨMM2y4sGy7A MrxfPqĞ~:t^=J:;HhwMc=4y`wXIS"B *Db$Qhx4|a۽|̋)t ʙ8Ri%deC 2|2EB쀤Bq ӚCv7I":J|'zE)|hI=vd=P0g[CJj(ϱ c{ab_E66:x6URq {]nE *u0(,/猂SP%=#5([?'"Y4x0v6< RcNb9:_$Giy1k3$i@q@06ǷƮ rl4c[nׂd7qUG\xr!wp;)q,l C̹ Y\"ti8I7COnN1HmkɱJ>̴)Zk^ȇ:+Nb) ˨5՞eߋT:|-\)bJQJ6EMБ@UM(E1Q$*߇:BEt-fyN2 ,VHۇwgl ;lRqo},.x,mS w.7 7@TDXF Nt8~¡f, ,ac_'gĂre/QvJ (w$> ͚< F%dd6ɘD#䠸l dO'NR"fsn dgyCǿ.,X%D\SBYj?8P4o:ƣal-jnQ ^vJr0}jrNX;ׅ&_ ZᮦvR'~-qn*Iu '72AڬAs445uF@"67 arapڣΉIn74yq!ܨ26l"B ?:EZ c~R#¸t鹣[m}9boJUz:zc3htj\ ~ODvYO;a% H=g|`ngV*>^>-o842m9ZLB0`A#QQV )ؒs=aHlaU|^ ];b$(i؄Y^J =懸|Ghl/m#b+ g_i![kE ?@Α ajn!Dc#I $@Ʒ(RV(YҠHw0i-ֱ!Cn<ؽl@DQD@ED@aAB'~x6޽*on?D,5+ 6?sJ->rƥ{^ YcY>kQ='~z&Q?\SєȚ%%: j>_I$A>Y-Rͭq -e(E &DqcTa>,)L]ӳ>*sXN>]g+C`:zeTjvFr\hZ~EZ^rPc!FYJEEaKH/%dmQUFjxt]Ϣlw >E|찿⠔@-ofHz؃+v CIzda8]aB]ͨ b` nLheC Dqb}{]G0%"lD)Mc l`t5 ~]4#Ⴖw[Z%V],;م)оuIʐm(ZF^Ǥwj_Aa|>%ZBHl߷nbCb&vFXeA>&8e>ô01!CCH`!څD$EwLu+g֨ώUPa)~_^/ ք;L0~CA}J ($$E㋸И5[VU?)hH2Ca~ %ӏ/~``ziI[plk>~e p(n9ٯXCATHu. "&}PUJF kVgx} [fbK9t`4bLY4gɀy ^e+ =U?Tı+$NJ!ʨL{=io%!4%8q{T%SB9*6Hȑo<Ѭ=gǗ{1- jUIĥ+ n}H$owEMmjKEZ`N(Dح_u!V'n ;+|&B1[>FR7>;C#O@ZiJ?&FcHćjLdٽ$B2zQ|]ɵ8 TPtlU4l[=) Rx%evug\+o]mOK83Ň:".ՖHzr-ffCYՏ qX3AbÑ++S{'&%BR,=nT/wJ|ih`#UpU G#ۮbGPK>'DDQP\ Ǚ@ÿ́N ~ʯ|.c$%'Ґy 9"5}yHQ.Z*~E2Ԥ_\9p hRfX/Mi<`l,^+_GS|i'"pƀ:ʓ|uܫ@w9D3(vhd XTc@I*nsx2R:}Bg' k/ɤlKF"e숁, 4Pob΢& h#P| 0z= @[vE2 _L&&հ}u>՘Ϫ{>ndA`0,P%Nؔl/5'Bq hedC^yij uܛ"]*dʘ89\ 5` b[yx 3CrQ!Ll1pǠW1.O0I0:ol9wņfĪ\%uBIbzW`5OðU^`|Z/x4"{nu'x|B; |lŴo7~a(NqZ&S7,dgNi=faFO-'6҅mYiPc$oJ-ശ2[lQ LRՔ- %@F1 10- TK~!M811 b[gQ+B"0aɬAKA9 ̉3 j,Ж) X֦L% $6$PYP`Dvw&~A,FTDE cVEtnxvI cBUlծ+XC#fYf`\k*4BFNSMV|Uoǿ;&`9+ 8 W2BFT}P1'ɇQE2bPa,xL=;[hi؂k>]ma>ʜ#52"kD! -[  z*2 h=ZcZND IdL^ѱ' ܚ.V "3& hc{*!CFZHD@zr ]=LSBzrkt dg+s' MJN."j1kV(z;);fӣA@undu¶,9PR$cmi"V^10 ##N= 4QP?!?ʔ|w2SH'r`YIQ;IJY0`_gٿM,($Xsz, gWe)zr;8][SeaY<7k hS4a?,KG Ɨ3DPTaXU>Pm5A oks:4?p{p X^2r6ߒ0!FI`l5pNܰ8y`7Xo`hR8 x#N44Wa. ;8aeҮq7J{c4  iV8\@a#iZF% F !C" 噳"L/-p5HT bA9r%ȱթ 2E@(L`\G)8 VR:cT3Jy@uxf~,(pNid(XܨJ61g'M,EL`qبW84#[Z˻heRA<({v  mysdJkq댆 ^D;BG=]It-)m* H(!kG ®_\2afBAeZ^ AhpB ΅cѽkB6 c5m7A1BHUv*g ldW*T!`Д[*_dԃraއX>cB_g`U>jv\6{jP1(OvU& B}! M(m:KNCBx9G|Z'B+oD] ǁ텳w ^<@@+Art鴂GhrWeW6192|Јq%@ѯ-458f1|3M66[Z`(`CP &c-Ǣ<\ &2X)-Mt_1{7iM%u2\ә%ֆ;9ޥd::iF;(ڶ$- =g|H;{GT( :ҢA(̾n e5 ;\T\Ԫ mn 6πX:6KU-RuSqT L_{]Sv< jg5^[ # BF+`)7ń3"+HDcy[D .EҕT?4?$ړ2^jɱ@4;:gl}d ` %+T*F)hVc02`Ib6 8װW(9WsIq%5U'}qP3XY(6\ڂNN^K -h[JϚؒ03 )?GQ7+05c#7=[9C+>]D'OA2$trCJ/A@ Ļ>}*>B8!ZeXpoC w36X7OV:rOcFOD߆NI⋌1vc-{҆3 Bf[ >V=X*ʔUDBZl A1"ػ>q/QPXV#KV]$sӝ{aFG`H Ad9CbX)рùB^Rl*śuZ{qQ0zXK3 0V,1/~jYv&ni `p clh2Z.7^~zyO+C p{y}4H($W46Z"ZԱtmh *ІxB ozhy+əMBt $JՙPHL28=c]qdWŮt 4 ٠L4Sl+rzxt*vzx&⒤KAQ-#)}/R$!f =w_1xE61B,PL`j52Ti6% i5y9E $=Y@\`,IaDLȝ9μswLGa }$l [R@ kA K5rTZ(-UUt0z*FwMi.l]= ǦQcYefÌ(yTPtNFCʫa(|]˲}9xli N_X¡clŖDDZ`HSA01lh:' I"%NEn- KƁ$I(Sj f}=ܺIDX`FDT,! I=槚CfXX]%B1%Il6');.E` D =4j}}xŨpÜ #ĝ@C ͇DAQTUPQQV:Tc˂" @6y%MP(m]$6KEɿy=vڗh&[ J5[b_6%ӊD ;%u*l]&%8o:?M #*82 F! He7u* B%DKm4i;@ٱt ̋dɎ\Fe1mةb?fUus:ǖSlu+DHy IMq,Ҵy)D%D*UުpƜ_ ]LU5ZL 6`ZۥY=l+wmDds?F,n0 4HAX6l㤱1 ACHQ`fXLJУj52ʡS3 e3hZL.̰ƳL6Aqł,DZ)fA4O^# fbM 4<7 ;5hCrjPl*6 @H@Pދ-I Л_6tomYZ& rd;HI ߄7* qiչoʶQM'I:)ҙPz=Б c.AS#wn_r{ 9 ݂3R31 i \sĹijX"Re23VA,40RXRUh,I2Z0Mi"1`4 &C&I, , ebh[C|x= {tFİ8錱m3;]<.A@Da*05 }P4kؽ:r L়LwavbBݷ].[D2nY6@+a范sh"gD‡OeQHa4((?!}m+ IO $O*KYVO XĈAe" `11A`"֝FF in4'˖% o)21Q_U+6?QB0<pN@+"Nb0:D x@;:;=J;+ߔWwghac?T/Jbu3<=c Xje|HAIQoycF+Zc9NCUN"'z]b#qW=WG87љYm @H"H"ãIfx4cR1PROù*$#wÙ"y {^ ۹:'7c9+l蠥J+' @Рb06U- a(eb0X"EMӇ9Z5=4EH*$W* 1#Ш !R@ ͭTDV2 F1Ne,mB R$UJ ]?yǩOJu"WU _ T*7 OU<śy2f1sN\9"UlC3@` (*)f[JbY.1.ܱ0%E# r ayAmOſT! jaZY)@ټ^1]T{dO.wfw1a|DÒnQwDȝ|fo1#a2pO3PHͪ2"ť,a2;0RJX8H=l GwU` S8֧=P:Z*Yb$PFH)I0y/>"* T=g$`vC2lȵAjPc oNPr"(ȄiS.B[DNQ9u$~ȏS|J $#"c!ŞWD.u(F ImAd5dXDPPG7)lBR ` Dl*PefCqhHu(j^I'N5ClĨT"Y٘QY]Zs w}(1T}.R}E0|ᇠlhiַoCqMtH`\; fm 8}ԨPrmK5$0,)lqnqqem,Eaɀm6FǞ8R).xy4qUrF-()dzlȒ5}Hx^ 2v il;x+lŐ8xuT2+Ey,dsR[ʁt(U-@ԇ+H B7`wZQ@|YIR6 ڀ./!b-A0sW(m0{(P0JLVi KM:I_sTnIj`LgxxG`y!Nrm^^<0 R (4\?Zo7 їrKa!OA$ycL)uTFx0~D F[qHb|/k`zZ\2Qk(֙źK ^GtP,F(U9h6=ou:I(9ظrA pp8HvSPv cAJfpS GU7@q{{YQzZܠc#l:7_\]۬ISd(+ñpN :A@h!0"]8na wnZaYXzZ ubeg3VxxM:0/;NE`(K;hJ(s6E|߫m)*)tG6Vw&dxkĕ[z:8SIDŽ|d/&YYtWEGNPrDnnH.!,0( <Ę8B4sbt5`;DXG Dat V@gMZ0b>9y},lqG#Ƚ@BD%4TZIT:0 !ҭ{J3ٚpFXCqC8BhWGp-@ɽ:@,\,/[)HI M"h@ ΆpB6BvP3;*C( J"fxtj%7h"k"]:4C*:fЈ J r͞Wa_x ~4-Xc" c6aӪuA0A  D.[+=6aKa-F (EO `E EyAiQ,V_GAg 3`ؒ*Z X3g^ۛ5uWk/qkw %&b#&QF.£eFJ"a.SQC)QQ ]aˌy2$j"_-@Whrsd E C 8]; ?O  )qc桤P@P,B[}xr "Y~(.~,/O8fjB&q@U"ٜ9NXv) mVaԉX~e<+Y:Q_>hK]Eꍱ tn"/@)LJU}WM :`mx6OϦKhb]G'brLHo Em^(cHL)%z`pV)B/j^Ov5a &ȴԞFܽ Gi9 HR{.Pyv8{1Db {PFpw@ć eil߿ \Pa*U74.bMV/~Mty[ H`scL~IAutyY&:LLMhƦb`I2!CKA1ݱih LBkъI7&1$EB1lCcR@`ʘ-C{}{t*@yԅ YP2n{c`#PfӉMҸI?M6y\ bאf5Ck/TTյ(d!}0,tt6:} v ?'FQhAfQ>mх<ɡ׏?$D16uN 4{# =o/9y2GsHU(C4 ~@mUѢ`3O 9 u+:NM[RZA@(ZtZ BX_4MQCPT>OXESX:5vtA$t(O~gç@~8^$-C_8y1}:}%)„"/usr/binreadingSUIDuserkeyword outside sectionsection header.Parse error in %s, line %d: %s multi-call binary. No help available. Usage: --helpyou have no permission to run this applet!setresgidsetresuidUsing fallback suid method must be suid to work properlybusyboxCopyright (C) 1998-2009 Erik Andersen, Rob LandlZ,ey, Denys Vlasenko and others. Licensed under GPLv2. See source distribution for full notice. Usage: busybox [function] [arguments]... or: function [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use and BusyBox will act like whatever it was invoked as. Currently defined functions: , --install: applet not found Ssx-Ssx-Ttx-/usr/sbin/dev/urandomLINESCOLUMNSSELinux support is disabledcan't stat '%s'sendtolistencan't open '%s'can't change root directory to %ssetuidsetgid%s: I/O errorlseek(%llu)lseekclose failedshort writecan't duplicate file descriptorcan't create pipecan't move '%s' to '%s'can't remove file '%s'not a symlink%s: cannot read link: %sshort readcan't read '%s'no gzip/bzip2 magicread error from '%s'poll%u.%u.%u-%u:%u%c%u-%u-%u %u:%u%c%2u%2u%2u%2u%2u%c%4u%2u%2u%2u%2u%c%s:%s:%lu:%lu:%s:%s:%s %s:%s:%s:%s:%lu:/etc/group/etc/shadow/etc/passwd   gidgsystemS-1:?2:g+g:S%s '%s' in useno %cids leftx:%u:!::homehgecosgshellsingroupGdisabled-passwordDempty-passwordDsystemSno-create-homeHuiduLinux User,,,=1:SD:u+h:g:s:G:DSHu:/home/%snogroup/bin/falsex:%u:%u:%s:%s:%s!:%u:0:99999:7:::addgroup '%s' '%s'addgroup -g %u '%s'can't execute passwd, you must set password manuallym--e:e--mmissing new password$1$an error occurred updating password for %sPassword for '%s' changedencryptedemd5mstdinspassword-fdPsaltSmethodm?2:P+sP:S:m:a:sha512Password: /var/run/utmp/bin/login/etc/issue-2:t+bad speed: %stoo many alternate speeds/dev/%sstdin is not open for read/write%s: TCGETS%s: read%s: input overrun%s: TCSETS%s: can't exec %sI:LH:f:hil:mt:wn Login timed out after %d seconds f:h:p-f is for root onlyUNKNOWN/dev/ on '%s' from '%s'/etc/securetty# Login incorrectinvalid password for '%s'%s/etc/nologin System closed for routine maintenancZ- e LOGIN_PRE_SUID_SCRIPTLOGIN_TTYLOGIN_USERLOGIN_UIDLOGIN_GIDLOGIN_SHELLroot login%sa:lud%s can't change password for %sno record of %s in %s, using %scan't change locked password for %sChanging password for %s Old password: incorrect password for %sIncorrect passwordNew password: Retype password: Passwords don't matchpassword for %s is unchanged!%scan't update password file %sPassword for %s changed by %spassword for %s is already %slockedmplc:s:none%c %s %s:%sincorrect passwordusing restricted shellnot a ttyGive root password for system maintenance (or type Control-D for normal startup):Normal startuplogin incorrectSystem Maintenance ModeSUSHELLsushellno password entry for root=0/dev/ttyVT_GETMODEVirtual console%s locked by %s. Password incorrectus-asciitext/plainc:e:o:C:N:a:m:j:%u-%u-%uMime-Version: 1.0 Content-Type: multipart/mixed; boundary="%s" --%s Content-Type: %s; charset=%s Content-Disposition: inline; filename="%s" Content-Transfer-Encoding: base64 --%s-- %%llu.%u.%sContent-Type: ;" multipart/mixedboundary=header: %sno support of content type '%s'charset=Content-Transfer-Encoding:7bitfilename=CONTENT_TYPECHARSETENCODING8bitno support of encoding '%s' x--X:X--x:m::x:Xdeis:r:c:m:h:o:O:%s failed: %s-1:dd:t+:R+:L+:H+bdmVcasTkt:R:Z:L:H:M:F:APOP %sUSER %sPASS %sSTATRETR %uTOP %%u %utmp/%llu.%u.%sdelivery helperDELE %uQUITRCPT TO:<%s>Bad recipient: <%s>f:w+:H--S:S--H:a::tf:o:iw:H:S:a::SMTPHOST127.0.0.1NOOPINIT failedEHLO %sHELO %sAUTH LOGINMAIL FROM:<%s>To: Bcc: To: %sDATAUser: no username or passwordtimed outhelper killed by signal %uhelper exited (%u)qo:f:p:t: mode: %d -o offset: %ld -f frequency: %ld maxerror: %ld esterror: %ld status: %d ( | ) -p timeconstant: %ld precision: %ld tolerance: %ld -t tick: %ld time.tv_sec: %ld time.tv_usec: %ld return value: %d (%s) f:l:d:r:nKIOCSOUNDHANGUPABORTCLR_ABORTTIMEOZ.UTECHOSAYRECORDvVsSE%s min/max priority : %d/%d %s not supported? currentnew-1:r--fo:f--ro:r--fo+mprfocan't %cet pid %d's policypid %d's %s scheduling policy: %s can't get pid %d's attributespid %d's %s scheduling priority: %d sunmontuewedthufrisatIuser %s: parse error at %suser:%s entry:%sMAILTO= command:%sIuser %s: too many linescron.updatecan't chdir(%s)ignoring %sIcan't get uid for %sHOMEIcan't chdir(%s)/var/spool/cronchild running %scan't exec, user %s cmd %s %s %sExec failed: %s -c %s can't vfork%s/cron.%s.%d/var/spool/cron/crontabsf-b:b-f:S-L:L-S:d-l:l+:d+l:L:fbSc:d:crond (busybox 1.16.1) started, log level %d/var/run/crond.pid wakeup dt=%ldItime disparity of %ld minutes detectedfile %s: line %s job: %d %suser %s: process already running: %sTo: %s Subject: cron: %s can't create mail file %s for user %s, discarding outputUSER %s pid %3d cmd %ssendmail-tijanfebmaraprmayjunjulaugsepoctnovdecchdir(%s) by %s failed/tmpVISUALEDITORvi?1:dru:c:lerduser %s cannot read %s%s.%u%s.newcan't create %s/%scan't append to %s/%sstack underflowstack overflowsyntax error at '%s'error, base %u is not supported%g %x %o  bhwl /dev/memmmapbad width0x%0*llX ?1:t--T:T--ttTs/dev/cdromnot a sg device or old sg driverBAR_WIDTHBAR_HEIGHTBAR_LEFTBAR_TOPBAR_RBAR_GBAR_B/dev/fb0cs:d:i:f:syntax error: %s#=FBIOGET_VSCREENINFOFBIOGET_FSCREENINFOonly 16 bpp is supported[?25lbad PPM file '%s'P6 %u %u %u Erasing %u Kibyte @ %x - %2u%% complete.jq%s: not a char deviceMEMGETINFOMEMGETOOBSELautoplacement selected and no empty space in oob %s: %s Skipping bad block at 0x%08xbad block check not availableMEMGETBADBLOCK errorMEMERASEMEMWRITEOOB Cleanmarker written at %x.%lx is beyond device size %lx %ld are too many sectors, device only has %ld MEMLOCKMEMUNLOCKErasing blockVerifying kbWriting kb %s: %llu/%llu (%u%%) =2%s is not a MTD flash device%s bigger than %serase error at 0x%llx on %swrite error at Z/0x%llx on %s, write returned %dverification mismatch at 0x%llxUnspecifiedATA-1 X3T9.2 781D prior to rev.4ATA-1 published, ANSI X3.221-1994ATA-1 X3T9.2 781D rev.4ATA-2 published, ANSI X3.279-1996ATA-2 X3T10 948D prior to rev.2kATA-3 X3T10 2008D rev.1ATA-2 X3T10 948D rev.2kATA-3 X3T10 2008D rev.0ATA-2 X3T10 948D rev.3ATA-3 published, ANSI X3.298-199xATA-3 X3T10 2008D rev.6ATA-3 X3T13 2008D rev.7 and 7aATA/ATAPI-4 X3T13 1153D rev.6ATA/ATAPI-4 T13 1153D rev.13ATA/ATAPI-4 X3T13 1153D rev.7ATA/ATAPI-4 T13 1153D rev.18ATA/ATAPI-4 T13 1153D rev.15ATA/ATAPI-4 published, ANSI INCITS 317-1998ATA/ATAPI-5 T13 1321D rev.3ATA/ATAPI-4 T13 1153D rev.14ATA/ATAPI-5 T13 1321D rev.1ATA/ATAPI-5 published, ANSI INCITS 340-2000ATA/ATAPI-4 T13 1153D rev.17ATA/ATAPI-6 T13 1410D rev.0ATA/ATAPI-6 T13 1410D rev.3aATA/ATAPI-7 T13 1532D rev.1ATA/ATAPI-6 T13 1410D rev.2ATA/ATAPI-6 T13 1410D rev.1ATA/ATAPI-7 published, ANSI INCITS 397-2005ATA/ATAPI-7 T13 1532D rev.0reservedreservedATA/ATAPI-7 T13 1532D rev.4aATA/ATAPI-6 published, ANSI INCITS 361-2002reserved*sdma0 *sdma1 *sdma2 *sdma? *mdma0 *mdma1 *mdma2 *mdma? *udma3 *udma4 *udma5 *udma6 *udma7 *udma0 *udma1 *udma2 pio3 pio4 pio? unknown1SectDualPortDualPortCacheHardSectSoftSectNotMFMHdSw>15uSecSpinMotCtlFixedRemoveableDTR<=5MbsDTR>5MbsDTR>10MbsRotSpdTol>.5%dStbOffTrkOffFmtGapReqnonMagneticsupportedenabledlockedfrozenexpired: security countsupported: enhanced eraseDirect-access deviceSequential-access devicePrinterProcessorWrite-once deviceCD-ROMScannerOptical memoryMedium changerCommunications deviceACS-IT8 deviceACS-IT8 deviceArray controllerEnclosure servicesReduced block command deviceOptical card reader/writerreservedhard sectoredsoft sectorednot MFM encoded head switch time > 15usspindle motor control optionfixed driveremovable drivedisk xfer rate <= 5Mbsdisk xfer rate > 5Mbs, <= 10Mbsdisk xfer rate > 5Mbsrotational speed tol.data strobe offset optiontracZ0?k offset optionformat speed tolerance gap reqdATAPI  !"#$%&'@ABCDEFG %-20s*%cdma%u setting %s to %ld (off) (on) setting %s to %ld %s = %2ld (tristate) (unknown: %d) CompactFlash ATA device, with unknownATAPI %s, with unknown device typenon-%sremovable media powers-up in standby; SET FEATURES subcmd spins-up. WARNING: ID response incomplete. Following data may be incorrect. Model Number:Serial Number:Firmware Revision:Media Serial Num:Media Manufacturer:Standards: Used: %s Supported: Likely used: %u & some of %u Used: ATAPI for CD-ROMs, SFF-8020i, r2.5 Supported: CD-ROM ATAPI-%u Likely used CD-ROM ATAPI-1Configuration:3ms<=10ms with INTRQ50us DRQ response: %s Packet size: 12 bytes16 bytes CHS addressing not supported Logical max current cylinders %u %u heads %u %u sectors/track %u %u -- bytes/track: %u bytes/sector: %u CHS current addressable sectors:%11u LBA user addressable sectors:%11u LBA48 user addressable sectors:%11llu device size with M = 1024*1024: %11llu MBytes device size with M = 1000*1000: %11llu MBytes (%llu GB) Capabilities: Cmd queuing, Cmd overlap, LBA, (may be)notIORDY%s(can%s be disabled) no IORDYsingle port, single-sectordual port, multi-sector with read caching ability Buffer type: %04x: %s%s Buffer size: %.1fkB bytes avail on r/w long: %u Queue depth: %u Can%s perform double-word IO vendorstandard Standby timer values: spec'd by %swith, %s device specific minimum R/W multiple sector transfer: Max = %u Current = AdvancedPM level: %u (0x%x) unknown setting (0x%04x) Recommended acoustic management value: %u, current value: %u ATA sw reset required Overlap support: %uus to release bus. %uus to clear BSY after SERVICE cmd. DMA: sdma%u (?) Interleaved DMA support Cycle time: min=%uns recommended=%uns PIO: pio%d no flow control=%uns IORDY flow control=%unsCommands/features: Enabled Supported: * %s supported Security: Master password revision cZ1*ode = %u highmaximum Security level %s %umin for %sSECURITY ERASE UNIT. ENHANCED determined by the jumper determined by CSELbelowaboveHW reset results: CBLID- %s Vih Device num = %i%s enabled and required by some commandsCFA power mode 1: %s%s Maximum current = %uma Checksum: %scorrect bad char: '%c' 0x%02x Model=%.40s, FwRev=%.8s, SerialNo=%.20s Config={ } RawCHS=%u/%u/%u, TrkSize=%u, SectSize=%u, ECCbytes=%u BuffType=(%u) %s, BuffSize=%ukB, MaxMultSect=%u, MultSect=?%u? (maybe): CurCHS=%u/%u/%u, CurSects=%lu, LBA=%s, LBAsects=%uon/off IORDY=%s, tPIO={min:%u,w/IORDY:%u}, tDMA={min:%u,rec:%u} PIO modes: pio0 pio1 pio2 DMA modes: UDMA modes: AdvancedPM=%s: disabled (255): unknown setting: mode=0x%02X (%u) WriteCache=%s Drive conforms to: %s: ATA/ATAPI-%u * current active mode BLKFLSBUFHDIO_DRIVE_CMDmlockTiming buffer-cache reads: Timing buffered disk reads:BLKGETSIZE%5u MB in %u.%02u seconds = %u kB/s %s: fs readaheadBLKRASET attempting to unregister hwif#%lu HDIO_UNREGISTER_HWIF attempting to scan hwif (0x%lx, 0x%lx, %lu) HDIO_SCAN_HWIF attempting to auto-tune PIO modeset PIO mode to %d set MDMA mode to %d set UDMA mode to %d HDIO_SET_PIO_MODE32-bit IO_support flagHDIO_SET_32BITmultcountHDIO_SET_MULTCOUNTBLKROSETunmaskirqHDIO_SET_UNMASKINTRusing_dmaHDIO_SET_DMADMA queue_depthHDIO_SET_QDMAnowerrHDIO_SET_NOWERRkeep_settingsHDIO_SET_KEEPSETTINGSdrive doorlockdrive keep featuresdrive defect-mgmtdrive prefetchxfermodedefault PIO modedefault PIO mode, disable IORDYPIO flow control mode%usingleword DMA mode%umultiword DMA mode%uUltraDMA mode%udrive read-lookahead setting APM level to %s 0x%02lX (%ld) drive write-caching issuing standby command issuing sleep command disabling Seagate auto powersaving modestandby%u minutes %u seconds%u.%c hoursvendor-specificreservedHDIO_GET_MULTCOUNTioctl %#x failedHDIO_GET_32BIT IO_support =%3ld (default 16-bit)32-bit)32-bit w/sync)Request-Queue-Bypass)???)Z2)HDIO_GET_UNMASKINTRHDIO_GET_DMA (DMA-Assisted-PIO)HDIO_GET_QDMAHDIO_GET_KEEPSETTINGSkeepsettingsHDIO_GET_NOWERRBLKROGETBLKRAGETHDIO_GETGEO geometry = %u/%u/%u, sectors = %ld, start = %ld active/idle drive state is: %s HDIO_DRIVE_RESETHDIO_TRISTATE_HWIF no identification info availableHDIO_GET_IDENTITYbus stateHDIO_SET_BUSSTATEHDIO_GET_BUSSTATEBLKRRPARTNOP cmdREAD BUFFER cmdWRITE BUFFER cmdHost Protected Area feature setDEVICE RESET cmdSERVICE interruptRelease interruptLook-aheadWrite cachePACKET command feature setPower Management feature setRemovable Media feature setSecurity Mode feature setSMART feature setFLUSH CACHE EXT cmdMandatory FLUSH CACHE cmd Device Configuration Overlay feature set 48-bit Address feature set SET MAX security extensionAddress Offset Reserved Area BootSET FEATURES subcommand required to spinup after power upPower-Up In Standby feature setRemovable Media Status Notification feature setAdv. Power Management feature setCFA feature setREAD/WRITE DMA QUEUEDDOWNLOAD MICROCODE cmdGeneral Purpose Logging feature setMedia Card Pass Through Command feature set Media serial number SMART self-test SMART error logging gfu::n::p:r::m::c::k::a::B:tTiId::S:D:P:X:K:A:L:W:CyYzZU:Q:wx::b:R:pio0pio1pio2pio3pio4pio5pio6pio7sdma0sdma1sdma2sdma3sdma4sdma5sdma6sdma7mdma0mdma1mdma2mdma3mdma4mdma5mdma6mdma7udma0udma1udma2udma3udma4udma5udma6udma7no kernel supportadd watch (%s) failedFIONREADacew0rmyndDMuoxn+:c+:p++n:c:p:bad class %dioprio_%cet%s: prio %d - %s(%u+%02u:%02u)logged in still- down - crash- no logout gone%-8.8s %-12.12s %-*.*s %-16.16s %-7.7s %s /var/log/wtmpWf:rebootrunlevelsystem boot wtmp begins %s @ABCDEFGHI@KLMNOPQRSTUVWXYZ[\]^_[%u;0H[%u;%uH%s%s (file %i of %i) lines %i-%i/%i (END) - next: %s%i%%read error%7u %07u %s%.*s%.*s%s%s %s%s%s %s(END)%s (file %Z3<i of %i)No previous fileNo next fileNo matches found Examine: Cannot read this fileEMmN~ISmissing filenameMark: Invalid mark letterGo to mark: Mark not setLog file: Error opening log fileDoneNo bracket in top lineNo matching bracket foundNo bracket in bottom line ::%crootdir=%s table=%40s %c %o %40s %40s %u %u %u %u %uinvalid line %d: '%s'line %d: can't chown %sline %d: can't chmod %sline %d: regular file '%s' does not existline %d: unsupported file type %c%s%uline %d: can't create node %scatman.so %s/%s.lzmagtbl | nroff -Tlatin1 -mandoc 2>&1 | %s+aw1:2:3:4:5:6:7:8:9MANPATH/usr/manMANPAGERmore/etc/man.config/etc/man.confMANSECT%s/%s%.*s/%s.%.*s.lzmano manual entry for '%s'can't tcsetattr for %s=1:s+:d+:t+Xs:d:t:/var/lock/LCK..%scan't create %s%4d qdxn%u:%u %s: not a block device%s/..not %s is %sa mountpoint bsfbsfmbsrbssdatacompressioneomerasefsffsfmfsrfssloadlockmkpartnopofflinerewofflineras1ras2ras3resetretensionrewindseeksetblksetdensitydrvbuffersetparttellwsetunloadunlockeofweof/dev/tapeunrecognized opcode %sAt block %d RAID_AUTORUN%c %c can't write to filebad block ones complunexpected block no, 0x%08x, expecting 0x%08xchecksum error, expected 0x%02x, got 0x%02xcrc error, expected 0x%04x, got 0x%04xtoo many errors; giving upafon:{%s}: %7llo currentnew+pcan't %cet pid %d's affinitypid %d's %s affinity mask: %s real %E user %u sys %T Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W FileZ4& system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %xcan't run %s+vpCommand terminated by signal %u Command exited with non-zero status %u %\%uh %um %02us%um %u.%02us%u%%?%%%u.%02ureal %e user %U sys %S+s:t:unknown signal '%s'exec '%s'%32.32s Ft:T:WDIOC_SETOPTIONSWDIOC_SETTIMEOUTV.kodepends=alias=__ksymtab_gplstringsaAb:eF:nr%d.%d.%d/ko_hi3531modules.aliasalias %s %.*s modules.symbolsalias symbol:%s %.*s can't insert '%s': %s/proc/modules%-24sSize Used byModule%s%*s %8s %2s %s symbol:optionsincludeblacklistmodule %s not found in modules.depfailed to unload module %s: %sfailed to load module %s (%s): %sq-v:v-qvqacdlnrt:VC:brmmod/etc/modprobe.conf/etc/modprobe.dinvalid module formatno such moduleunknown symbol in module, or unknown parametermodule has wrong symbol versionkernel does not support requested operation"%s" wfascan't unload '%s': %spubprivtemptraildontpubautodevnetmaskPERMPUPTRAIL/proc/net/arp%s 0x%x 0x%x %s %s %s ether%s (%s) at * %s [%s] netmask %s No match found in %d entries inet%s: %s not supportedaddress familyA:p:H:t:i:adnDsv%s: unknown %shardware type%s: kernel only supports 'inet'%s: %s without ARP supportneed host nameneed hardware addresscant get HW-Address for '%s'protocol type mismatchinvalid hardware addressfeature ATF_DONTPUB is not supportedfeature ATF_MAGIC is not supported255.255.255.255SIOCSARPNo ARP entry for %s SIOCDARP(priv)SIOCDARP(pub)Sent %u probe(s) (%u broadcast(s)) Received %u repl%s (%u request(s), %u broadcast(s)) eth0interface %s %%s=1:Df:AU:c+DUAqfbc:w:I:s:SIOCGIFFLAGSis not ARPableinvalid source address %ssetsockopt(SO_DONTROUTE)no IP address configuredis not ARPable (no ll address)ARPING to %s from %s via %s recvfromBroadUni%scast re%s from %s [%s]for %s for %u.%03ums UNSOLICITED?addbrdelbraddifdelifstpsetageingsetfdsethellZ53osetmaxagesetpathcostsetportpriosetbridgeprioshowmacsshowSIOCGIFBRbridge name bridge id STP enabled interfacescan't get bridge name for index %dSIOCDEVPRIVATE%s %.2x no yescan't get interface name for index %d %s bridge %siface %stimespec  0.0.0.0/etc/dnsd.confvi:c:t:p:derror at line %u, skippingname:%s, ip:%s.%u.%u.%u.%uAccepting UDP packets on %spacket size %d, ignoredGot UDP packetpacket has 0 queries, ignoredresponse packet, ignoredbi:p:%2x:%2x:%2x:%2x:%2x:%2xcan't read Wake-On-LAN passSIOCGIFHWADDR on %s failedSO_BROADCASTSIOCGIFINDEX425 Use PORT/PASV first ftpd213-File status: Directory listing421 Timeout FILE: uniq.XXXXXX Ok to send datat+:T+:vv:SSvSwt:T:Operation successful Error %s[%u]215 UNIX Type: L8 -Features: EPSV PASV REST STREAM MDTM SIZE Ok213 %llu 213 %04u%02u%02u%02u%02u%02u 211-Server status: TYPE: BINARY 211 Ok 227 PASV ok (%s,%u,%u) 229 EPSV ok (|||%u|) Opening BINARY connection for %s (%llu bytes)503 Use RNFR first 500 Unknown command unexpected server response%s%s: %scmd %s %s%s %s ftpanonymous-2:vv:cccvu:p:P:Connecting to %s (%s) r+PASSTYPE IPASVREST %lluRETRSTORcontinuecverbosevusernameupasswordpportPdomaindfqdnffileFsethostnamedfisF:vHTTP/1.0 200 OK httpd.conf/etchttp:///%s%.*sconfig error '%s' in '%s'closedStatus: application/octet-streamtext/htmlresponse:%uHTTP/1.0 %d %s Content-type: %s Date: %s Connection: close WWW-Authenticate: Basic realm="%s" Location: %s/%s%s Content-Range: bytes %llu-%llu/%llu Accept-Ranges: bytes Last-Modified: %s %s %llu Content-length:%d %s

%d %s

%s PATH_INFOREQUEST_METHOD%s=%s?%sREQUEST_URISCRIPT_FILENAMESCRIPT_NAMEQUERY_STRINGSERVER_SOFTWARE=busybox httpd/1.16.1SERVER_PROTOCOL=HTTP/1.0GATEWAY_INTERFACE=CGI/1.1REMOTE_ADDRREMOTE_PORTHTTP_USER_AGENTHTTP_ACCEPTHTTP_ACCEPT_LANGUAGECONTENT_LENGTH=%dHTTP_COOKIEREMOTEZ60_USERAUTH_TYPE=BasicHTTP_REFERERHTTP_HOSTchdir %sconnectedPOSTurl:%sCookie:Referer:User-Agent:Host:Accept:Accept-Language:Authorization:Range:bytes=%s %s%s%s%s HTTP/%c.%c cgi-bin//cgi-bin/index.cgiWeb Server Authenticationvv:ifc:d:h:e:r:m:u:p:ifv&#%d;setgroupsOKPartial ContentRequest TimeoutNo request appeared within 60 secondsNot ImplementedThe requested method is not recognizedUnauthorizedNot FoundThe requested URL was not foundBad RequestUnsupported methodForbiddenInternal Server Error.txt.h.c.cc.cpptext/plain.htm.htmltext/html.jpg.jpegimage/jpeg.gifimage/gif.pngimage/png.csstext/css.wavaudio/wav.avivideo/x-msvideo.qt.movvideo/quicktime.mpe.mpegvideo/mpeg.mid.midiaudio/midi.mp3audio/mpegHEAD%a, %d %b %Y %H:%M:%S GMTGETindex.htmletherinfinibandbad: '%s'SIOGIFINDEXSIOC%sinvalid hw-addr %sSIOCGIFMAPSIOCSIFFLAGSmetricmtutxqueuelendstaddrnetmaskbroadcasthwpointopointkeepaliveoutfillmem_startio_addradddeltrailerspromiscmulticastallmultidynamicSIFMETRICSIFTXQLENSIFDSTADDRSIFNETMASKSIFBRDADDRSKEEPALIVESOUTFILLSIFMAPSIFADDRDIFADDR%s: can't down%s: can't upifenslave%s: SIOCETHTOOL error%s is already a slave%s: can't set address%s: can't clear address%s: can't set MTU%s: can't set hw addresscdfa%s is not a master%s is not up%s is not a slavemaster %s, slave %s: can't change activeskipping %s: can't get flagscan't release %s from %sskipping %s: can't get settingscan't enslave %s to %schange-activecdetachdforcefdownupSIOCGIFFLAGS failedSIOCDEVPRIVATE failedSIOCDEVPRIVATE+1 failedSIOCGMIIPHY failedSIOCGMIIREG failedETHTOOL_GLINK failedSIOCGIWAP failedSIOCETHTOOLusing %s detection modeSIOCGMIIPHYwireless extensionIFF_RUNNINGnetlink: recvnetlink packet too small or truncatedcan't get interface flagsupping interfacecan't set interface flagsfailed to detect link statusIFPLUGD_PREVIOUSIFPLUGD_CURRENTexecuting '%s %s %s'exit code: %d/etc/ifplugd/ifplugd.actiont+:u+:d++ansfFi:Z7%r:It:u:d:m:pqlx:Mkifplugd(%s)/var/run/ifplugd.%s.piddaemon already runningunknown API mode '%s'doesn't exist, waitinglink is %sdisinterface %sappearedifacehwaddressbnmaskip link set %iface% downip addr add ::1 dev %iface%ip link set %iface% upip addr add %address%/%netmask% dev %iface%[[ label %label%]]ip link set[[ mtu %mtu%]][[ addr %hwaddress%]] %iface% up[[ip route add ::/0 via %gateway%]]ip tunnel del %iface%ip tunnel add %iface% mode sit remote %endpoint%[[ local %local%]][[ ttl %ttl%]]ip addr add %address%/%netmask% dev %iface%ip addr flush dev %iface%ip addr add 127.0.0.1/8 dev %iface%ip link set[[ addr %hwaddress%]] %iface% upudhcpc -R -n -p /var/run/udhcpc.%iface%.pid -i %iface%[[ -H %hostname%]][[ -c %clientid%]][[ -s %script%]][[ %udhcpc_opts%]]bootpc[[ --bootfile %bootfile%]] --dev %iface%[[ --server %server%]][[ --hwaddr %hwaddr%]] --returniffail --serverbcastip addr add %address%/%bnmask%[[ broadcast %broadcast%]] dev %iface%[[ peer %pointopoint%]][[ label %label%]][[ip route add default via %gateway% dev %iface%]]poff[[ %provider%]]pon[[ %provider%]]start-stop-daemon --stop -x wvdial -p /var/run/wvdial.%iface% -s 2start-stop-daemon --start -x wvdial -p /var/run/wvdial.%iface% -b -m --[[ %provider%]]kill `cat /var/run/udhcpc.%iface%.pid` 2>/dev/null/var/run/ifstatepre-uppost-downIF_%s=%sIFACEADDRFAMrun-parts /etc/network/if-%s.d/etc/network/interfacesanvfmi:mappingtoo few parameters for line "%s"too many parameters "%s"unknown address type "%s"unknown method "%s"duplicate interface "%s"autointerface declared auto twice "%s"option with empty value "%s"duplicate option "%s"duplicate script in mapping "%s"misplaced option "%s"interface %s already configuredinterface %s not configuredRunning mapping script %s on %s don't seem to have all the variables for %s/%signoring unknown interface %smanualwvdialpppstaticbootpdhcploopbackv4tunnelstreamdgramrdmseqpacketrawcan't extend file limit, max = %dsetrlimitpmap_unset(%u,%u)/var/run/iZ8%netd.pid%s: exit status %u%s: exit signal %u%.24s getsockname%s %s: pmap_set(%u,%u,%u,%u)%s/%s: bindparse error on line %u, line is ignoredrpc/no rpc version: '%s'bad rpc versioninternalunknown internal service %s%s: unknown rpc service%s/%s: unknown service%s/%s: unknown host '%s'/etc/inetd.confR+:q+R:feq:non-root must specify config fileaccept (for %s)%s/%s: too many connections, pausing%s: no such %snon-root must run services as himselfKiMiGiTierror: no inet socket availableSIOCGIFCONFcompressedDevice not found%s: error fetching interface information: %sX bytes:%llu (%llu.%u %sB)%s%02X-[NONE SET]%-9.9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s /proc/net/if_inet6%s:%s:%s:%s:%s:%s:%s:%s inet6 addr: %s/%d Scope:GlobalSiteCompatHostUnknown%4s%4s%4s%4s%4s%4s%4s%4s %08x %02x %02x %02x %20s [NO FLAGS] MTU:%d Metric:%dRX packets:%llu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%llu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R TInterrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x %02X:%02X:%02X:%02X:%02X:%02X%n%llu%u%u%u%u%n%n%n%llu%u%u%u%u%u%llu%llu%u%u%u%u%n%n%llu%llu%u%u%u%u%u%llu%llu%u%u%u%u%u%u%llu%llu%u%u%u%u%u%u10base210baseTAUI100baseT100baseTX100baseFXDARPA InternetIPv6unspecUNSPECLocal LoopbackEthernetPoint-to-Point ProtocolIPv6-in-IPv4infinibandInfiniBandUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARPPROMISCALLMULTISLAVEMASTERMULTICASTaddressroutelinktunneltunlrulenetmaskmbroadcastbnetworknprefixphostnamehsilentsmbnphsbad IP address: %suse prefix or netmask, not bothbad netmask: %sNETMASK=%s BROADCAST=%s NETWORK=%s PREFIX=%i can't find hostname for %sHOSTNAME=%s %s : USERID : UNIX : %s fiwb:nobodyidentd: interface name '%s' too longbus=driver=mac=can't parse %snZ90o selectors found for %s/etc/mactabsc:can't change ifname %s to %slp:w:i:f:e:acceptfdsocket:[[0000]:%s: bogus data on line %d%s %6ld %6ld %-23s %-23s %-12slaentuwxrWp Proto Recv-Q Send-Q %-23s %-23s State %s %6ld %6ld %-51s %-51s %-12s Proto Recv-Q Send-Q %-51s %-51s State can't scan /proc - are you root?showing only processes with your user IDActive Internet connections (servers and established)(only servers)(w/o servers)Local AddressForeign AddressPID/Program name /proc/net/tcp/proc/net/tcp6/proc/net/udp/proc/net/udp6/proc/net/raw/proc/net/raw6Active UNIX domain sockets Proto RefCnt Flags Type State I-Node Path/proc/net/unix%X%*p: %lX %lX %lX %X %X %lu %nFREELISTENINGCONNECTEDDISCONNECTING[ ACC W N %-5s %-6ld %-11s %-10s %-13s %6lu %08X%08X%08X%08X%*d: %64[0-9A-Fa-f]:%X %64[0-9A-Fa-f]:%X %X %lX:%lX %*X:%*X %*X %d %*d %ld %.20sESTABLISHEDSYN_SENTSYN_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSINGSTREAMDGRAMRDMSEQPACKET%-10s %s Address %u: %s%ccan't resolve '%s'Server:Name:send failedexecuting '%s %s'%s=%ustratum%s=%ldfreq_drift_ppmpoll_interval%s=%foffsetdd:p::wnnqNxwp:S:ld46aAbgLmalformed packet received from %s: size %usettimeofday%a %b %e %H:%M:%S %Z %Ysetting clock to %s (offset %fs)stepadjtimexupdate peer:%s, offset:%f, clock drift:%ld ppmrecv(%s) errormalformed packet received from %sreply from %s: not synced, next query in %usreply from %s: reach 0x%02x offset %f delay %f status 0x%02x strat %d refid 0x%08x rootdelay %fsent query to %stimed out waiting for %s, reach 0x%02x, next query in %uspoll %us, sockets:%u, poll interval:%usperiodic (DUP!)%d bytes from %s: seq=%u ttl=%d time=%u.%03u mssetsockopt(ICMP6_FILTER)Destination UnreachablePacket too bigTime ExceededParameter ProblemEcho ReplyEcho RequestListener QueryListener ReportListener Reductionunknown ICMP typewarning: got ICMP %d (%s)can't set multicast source interface --- %s ping stZ:3atistics --- %lu packets transmitted, %lu packets received, %lu duplicates, %lu%% packet loss round-trip min/avg/max = %u.%03u/%u.%03u/%u.%03u ms =1:q--v:v--q:c+:w+:W+qvc:s:w:W:I:46PING %s (%s): %d data bytes Source QuenchRedirect (change route)Timestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply10245000cbp:P:t:T:Scanning %s ports %u to %u Port Proto State Service %5u tcp %s %s %d closed, %d open, %d timed out (or blocked) ports blockedadddeldelete/proc/net/ipv6_routeKernel IPv6 routing table %-44s%-40sFlags Metric Ref Use Iface DestinationNext Hop%32s%x%*s%x%32s%x%x%x%x%s fscanf%-43s %-39s %-5s %-6d %-2d %7d %-8s resolving %sSIOCADDRTSIOCDELRTgateway %s is a NETWORKnetmask %.8x and host route conflictbogus netmask %snetmask and route address conflict/proc/net/routeMetric Ref Use MSS Window irttKernel IP routing table Destination Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d %-15.15s %-15.15s %-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s -net-hostA:ne metric netmaskgw gatewaymss windowirttdev device reject!mod"dyn #reinstateGHRDMDAC#net#hostslipcslipslip6cslip6adaptiveset stateTIOCSETDcslipp:s:c:ehmLFprotocolbaud rateget stateTIOCGETDSIOCSIFENCAPstatus %u/%u%s%s=%s-3:i--i:ph:vv:b+:c++c:C:i:x:u:l:Eb:hpt:vlistening on %s, starting, uid %u, gid %ulistening on %s, startingcan't look up hostname for %sconcurrency %s %u/%ustart %u %s-%sstart %u %s-%s (%s-%s)UDPTCPTCPORIGDSTADDRPROTOLOCALADDRREMOTEADDRLOCALHOSTREMOTEHOSTTCPCONCURRENCYgot signal %u, exit?exitend %d %s %d Entering character mode%s'^]'. Entering line mode%s'^C'. Console escape. Commands are: l go to line mode c go to character mode z suspend telnet e exit telnet continuing... telnetConnection closed by foreign host Escape character is /etc/issue.netwF:w+:i--w:w--if:l:Kip:b:FSw:file nZ;&ot foundaccess violationdisk fullbad operationunknown transfer idfile already existsno such userbad optionbad blocksize '%s'can't open fileremote filename is too longoctetblksizetsizeserver error: (%u) %sserver only supports blocksize of 512rcu:malformed packet/.dot in file nameg:p:g--p:p--g:gpl:r:b:OUT-OF-RANGE-1:x-xFIlnrdvxt:i:m:p:q:s:w:z:f:46setsockopt RAW_CHECKSUMSO_SNDBUFsetsockopt tos %dcan't get probe addrtraceroute to %s (%s), %d hops max, %d byte packets %2dsetsockopt UNICAST_HOPS %dsetsockopt ttl %dsent %d octets, ret=%dpacket too short (%d bytes) from %s %d bytes from %s to %s: icmp type %d (%s) code %d %2d: x%8.8x %04x: %s (%s) %d bytes to %s %u.%03u ms ! !N !H !P !F-%d !S !A !C !V !U !I !T !<%d>Dest UnreachablePacket Too BigParam ProblemMembership QueryMembership ReportMembership ReductionRouter SolicitRouter AdvertNeighbor SolicitNeighbor AdvertRedirectICMP 1ICMP 2ICMP 6ICMP 7EchoTimestampInfo RequestInfo Replytap%d/dev/net/tun=0:t--d:d--tf:t:d:u:g:bSet '%s' %spersistentnon and owned by uid %ld gid %ld/proc/net/vlan/configioctl error for %sVLAN_PLUS_VIDVLAN_PLUS_VID_NO_PADDEV_PLUS_VIDDEV_PLUS_VID_NO_PADaddremset_name_type set_flagset_egress_mapset_ingress_mapcontinuecspidersquietqoutput-documentOdirectory-prefixPproxyYuser-agentUpassive-ftpheaderpost-datano-check-certificatefdopenhttpftp://not an http or ftp url: %serror getting responsebad header line: %sWget-1:::csqO:P:Y:U:t:T:http_proxyftp_proxyindex.htmlhtGET %stp://%s/%s HTTP/1.1 POST /%s HTTP/1.1 GET /%s HTTP/1.1 Host: %s User-Agent: %s Proxy-Authorization: Basic %s Range: bytes=%llu- Content-Type: application/x-www-form-urlencoded Content-Length: %u %sno response from serverserver returned error: %scontent-length %s is garbagetransfer encoding '%s' is not supportedtoo many redirectionsanonymous:busybox@USER PASS ftp login: %sSIZE SIZE value is garbagebaZ<<d response to %s: %sRETR ftp error: %scontent-lengthtransfer-encodingchunkedlocationscript %s %s failed, exitcode=%d=2:vv:vffqr:vinvalid link addressSIOCGIFHWADDRstart, interface %siface %s is downdeconfigprotocol familyinetinet6linkonelinefamily460peerremotebroadcastbrdanycastscopedevlabellocalpeeranycastscope"dev""dev" (%s) must match "label" (%s)broadcast can be set only for IPv4 addressesfailed to send flush requestnil ifnameDeleted %d: %s@NONE: @%s: ,M-DOWNmtu %u qdisc %s master %s SIOCGIFTXQLENqlen %d%c link/%s peer brd wrong nlmsg len %d%u: %s inet inet6 family %d peer %s/%d brd %s any %s scope %s secondary tentative deprecated dynamic flags %02x valid_lft forevervalid_lft %dsec preferred_lft forever preferred_lft %dsec %sflushcan't flush link addressesunknown command %sLOOPBACKBROADCASTPOINTOPOINTMULTICASTNOARPUPLOWER_UPadddeletelistshowlstflushtoscopeuplabeldevonoffargument of "%s" must be "on" or "off"wrong address (%s) length: expected %d bytesSIOCSIFNAMESIOCSIFMTUSIOCSIFHWADDRsetshowlstlistupdownnamemtumulticastarpaddressdevsrcviamtulockprotocoltabledevoiftometric/proc/sys/net/ipv4/route/flushprotocoldevoifiifviatablecachefromtoallrootmatchexactmainNot a route: %08x %08x %08x default from %s/%u from %s from 0/%u via %s src %s metric %d %c cache /proc/net/psched%*08x%*08x%08x%08x expires %dsec iif %sneed at least destination addressnot a route?wrong len %dfailed to connect the route"ip route flush"can't flush routing cachecan't send dump requestfromiifoifdevnotifyconnectedtoaddappendchangechgdeletegetlistshowprependreplacetestflushadddeletelistshow%u: 0: from %s/%u0/%dto %s/%u to 0/%d tos %s fwmark %#x iif %s lookup %s realms %s/map-to %s masqueradepreferenceTOSfwmarktable IDfromtopreferenceorderprioritytosfwmarkrealmstablelookupdeviifnatmap-totypeheZ=)lpSIOCGETTUNNEL%s tunnel modeyou managed to ask for more than onecan't guessikeyokeyTTLTTL must be <=255greipipkeys are not allowed with ipip and sitbroadcast tunnel requires a source addressSIOCCHGTUNNELSIOCADDTUNNELttl != 0 and noptmudisc are incompatibletunl0gre0sit0can't determine tunnel mode (ipip, gre or sit)SIOCDELTUNNELipv6any%s: %s/ip remote %s local %s SIOCGIFNAME dev %s ttl %d ttl inherit tos inherit%c%s nopmtudisc key %s ikey %s okey %s %c Drop packets out of sequence. %c Checksum in received packet is required.%c Sequence packets on output.%c Checksum output packets.wrong format of /proc/net/dev%lu%lu%lu%lu%lu%lu%lu%*d%lu%lu%lu%lu%lu%lu%lucan't get type of [%s]modeipipip/ipgregre/ipsitipv6/ipkeyikeyokeyseqiseqoseqcsumicsumocsumnopmtudiscpmtudiscremoteanylocaldevttlinherittosdsfieldnameaddchangedeleteshowlistlstdeficit %d, rta_len=%d!can't talk to rtnetlinkOVERRUNEOF on netlinksender address length == %dtruncated messagemalformed message: len=%d!ERROR truncatedRTNETLINK answersunexpected reply!message truncatedremnant of size %d!dump terminated"%s" is invalid lladdrcan't find device '%s'if%d[%d]database %s is corrupted at line %ddefault/etc/iproute2/rt_tables/etc/iproute2/rt_dsfield/etc/iproute2/rt_realmsglobalnowheresite/etc/iproute2/rt_scopes/etc/iproute2/rt_protoskernelgatedmrtzebrabirdunicastblackholeunreachableprohibitthrownatxresolvelocalnatbroadcastbrdanycastmulticastprohibitunreachableblackholexresolveunicastthrow???either "%s" is duplicate, or "%s" is garbageduplicate "%s": "%s" is the second valuecommand line is not complete, try option "help"an %s %s is expected rather than "%s""%s" may be inet %s, but it is not allowed in this contextprefixclientidcclientid-noneCvendorclassVhostnameHfqdnFinterfaceinownpidfilepquitqreleaseRrequestrscriptstimeoutTversionvretriesttryagainAsyslogSrequest-optionOno-default-optionsZ>*oforegroundfbackgroundbarpingaclient-portPEntering listen mode: %sUnicasting a release of %s to %sEntering released state/usr/share/udhcpc/default.scriptc--C:C--c:O::T+:t+:A+:vvc:CV:H:h:F:i:np:qRr:s:T:t:SA:O:ofbaP:vunknown option '%s'%s (v1.16.1) startedudhcp 1.16.1Waiting on select...leasefailNo lease, forking to backgroundNo lease, failingEntering renew stateEntering rebinding stateLease lost, entering init statePerforming a DHCP renewReceived SIGTERMRead error: %s, reopening socketxid %x (our is %x), ignoring packetchaddr does not match, ignoring packetno message type option, ignoring packetno server ID in messageno lease time with ACK, using 1 hour leaseOffered address is in use (got ARP reply), decliningLease of %s obtained, lease time %uboundReceived DHCP NAKnakfSvP:/etc/udhcpd.confmax_leases=%u is too big, setting to %uError on selectReceived a SIGUSR1Received a SIGTERMMAC length != 6, ignoring packetFound static lease: %xReceived DISCOVERsend OFFER failedReceived REQUESTReceived DECLINEReceived RELEASEReceived INFORMUnsupported DHCP message (%02x) - ignoringbad server IPabsolutearemainingrfilef/var/lib/misc/udhcpd.leases=0:a--r:r--aarf:Mac Address IP Address Host Name Expires %s %-16s%s%*sexpired%u days %02u:%02u:%02u too many leases while loading %sRead %d leasescan't parse line %u in %s, , /-Attaching option %02x to listAttaching option %02x to existing member of list192.168.0.20192.168.0.254max_leases235auto_time7200decline_time3600conflict_timeoffer_time60min_leaselease_filepidfile/var/run/udhcpd.pidsiaddroptnotify_filesnameboot_filestatic_lease%s belongs to someone, reserving it for %u seconds%s: 0x%02x %soption 0x%02x did not fit into the packetAdding optioncan't add option 0x%02xbogus packet, malformed option fieldOption foundOption 0x%02x not found hlen %x xid %x ciaddr %x yiaddr %x siaddr %x giaddr %x chaddr %ssocket(%s)bind(%s)connectPacket read error, ignoringZ??Packet with bad magic, ignoringReceived a packetMSFT 98Broken client (%s), forcing broadcast replies%s%u.%u.%u.%u%s=interface=%sip=mask=%dsiaddr=boot_file=%ssname=%sExecuting %s %sForwarding packet to relayBroadcasting packet to clientUnicasting packet to client ciaddrSending NAKSending ACK to %sno IP addresses to give - OFFER abandonedlease pool is full - OFFER abandonedSending OFFER of %scan't send signalOpening listen socket on *:%d %sis interface %s up and configured?IP %sAdapter index %dMAC %02x:%02x:%02x:%02x:%02x:%02xstatic lease: mac:%02x:%02x:%02x:%02x:%02x:%02x nip:%xcan't enable bcast on raw socketNo a%srp reply received for this addressPacket is too short, ignoringOversized packet, ignoringUnrelated/bogus packet, ignoringBad IP header checksum, ignoringPacket with bad UDP checksum received, ignoringGot valid DHCP packetSending renew...Sending discover...Sending decline...Sending select for %s...Sending release...Opening raw socket on ifindex %dGot raw socket fd %dAttached filter to raw socket fd %dCreated raw socketCommand %02x %s DATAFILEDuplicated subcommandNo or bad filenameBad lengthFile is too bigExpected %d but got %d bytes . Server said:error while %s%sP:U:sdfP:U:VhC:J:mPRINTERlocalhost%s %s%c%s connected to server%s setting queue/tmp/lprXXXXXXmkstempfA%03u%sH%.32s P%.32s C%.32s J%.99s L%.32s M%.32s ld%.31s sending control file%u c%s sending data file%llu d%s local file changed size?!job accepted%6s%13s%13s%13s%13s%13s totalsharedbuffers%6s%13ld%13ld%13ld%13ld%13ld Mem:%6s%13ld%13ld%13ld Swap:/proc/net/%s%*d: %64[0-9A-Fa-f]:%x %*x:%*x %*x %*x:%*x %*x:%*x %*x %*d %*d %llu%*s %*s %*s %x:%x %llumks64%u/%4sexelibbad signal name '%s'bad option '%s'bad pid '%s'you need to specify whom to kill%s: no process killedcan't kill pid %ucan't kill pid %dncmsfixptbdrpage kmgtpezyctxtintrSwapTotal:SwapFree:MemTotal:MemFree:Buffers:Cached:Slab:%02d:%02d:%02d.%0*dcpu 2.4.loadavgmeminfodiskstatsZ@sys/fs/file-nrs+:P+vlfxons:P:o::so:%PPID-:wwTw PID USER VSZ STAT COMMAND mgtpezy%5u %-8.8s %s %s pguunknown user %sbad value: %s%cetpriorityerror: '%s' must be of the form name=valueerror: malformed setting '%s'error: '%s' is an unknown keysetterror %sing key '%s'%s = error reading key '%s'+neAapw/etc/sysctl.conf/proc/sys# = 100% MemTotal: %lu %s Mem: %lu %lu %lu %lu %lu %luMemFree: %lu %s MemShared: %lu %s Buffers: %lu %s Cached: %lu %s Mem: %luK used, %luK free, %luK shrd, %luK buff, %luK cached%s CPU%s:%susr%ssys%snic%sidle%sio%sirq%ssirqLoad average: %s PID PPID USER STAT VSZ %MEM CPU %CPU COMMAND%6ldm%7ld %5u%6u %-8.8s %s%s%3u.%c %3d%3u.%c Writeback:AnonPages:Mapped:Mem %stotal %sanon %smap %sfree%.*s %sslab %sbuf %scache %sdirty %swriteSwap %stotal %sfree PID VSZ VSZRW RSS (SHR) DIRTY (SHR) STACK COMMAND %.*scan't read /proc/statd:n:bmno process info in /proc %02d:%02d:%02d up %d day%s, %2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld -1:n++dtn:Every %us: %-*s%Y-%m-%d %H:%M:%Sreaddir %swarning: %s/%s is a directoryopen %s/%sread %s/%sfchdir-1:a+:c+:d+:f+:l+:m+:o+:p+:r+:s+:t++a:c:d:f:l:m:o:p:r:s:t:u:U:e:/:n:vP012nice%s: warning: cannot %s%s: fatal: cannot %s%svfork for control/?setup stdout for control/?run control/?wait for child control/?stat control/?%s: warning: cannot open %ssupervise/pid.newlog/supervise/pidsupervise/stat.new, paused, got TERM, want down, want exitlog/supervise/statwrite supervise/status.newlog/supervise/status./finish./runvfork, sleepingstart start log/: name too longstat ./logstat log/down: log is not a directorylog/downreadlink ./superviselock supervise/lockreadlink ./log/supervisechange back to service directorylock log/supervise/locklog/supervise/controllog/supervise/ok%s: fatal: can't %s%s%s: warning: %s%s%scan't runsvstart runsv open directory stat read directory Ps:open current directorychange directory, pZAausingchange directory to fail: warning: warning: can't stat %s/downrun: finish: %s: (pid %d) down: %s: , normally down, normally up, want upfatal: can't %swarning: can't stat %s/check./checkwarning: can't %s child %s/checkwait forok: runsv not runningcan't open supervise/controlcan't write to supervise/controlcan't open supervise/okcan't open supervise/statuscan't read supervise/statuscan't read supervise/status: bad format; log: warning: can't change to log service directory: %sSVDIR/var/serviceSVWAITw+:vvw:vtcuforce-reloadforce-restartforce-shutdownforce-stopcan't change to service directorychange to original directorytimeout: kill: warning: %s: %sinfo: sig%s receivedhangupalarmtermpausing: out of memorypausing: can't %s %sopen directory, want rotatecan't unlink processor leftovercan't read directoryinfo: delete: %s/%scan't unlink oldest logfileinfo: close: %sfsync current logfileset mode of currentprocessor already runningvfork for processorinfo: processing: %s/%sfatal: can't %s processor %sopen state fornewstatepausing: can't %schange to initial working directorywait for processorchange directory, want processorprocessor failed, restartrename processedset mode of processedwarning: can't unlink: %s/%srename stateinfo: processed: %s/%schange directory, want rotateinfo: rename: %s/current %s %urename currentcreate new currentchange directory, want remove old logfileopen directory, want remove old logfilecan't read directory, want remove old logfilewarning: out of disk space, delete: %s/%swrite to currentchildcan't open log directorycan't change directorycan't lock directorywarning: %s/configinfo: read: %s/configcan't stat currentopen currentinfo: append: %s/currentinfo: new: %s/currentfatal: %sno functional log directorieswarning: %scan't read standard inputtt:vvr:R:l:b:tv%04u-%02u-%02u_%02u:%02u:%02u.%06u000vipipefailnewlineredirectionword;&&&|||(!caseforifinuntilwhile{RANDOZBMLC_ALLLC_CTYPEHISTFILE !"$&'()*-/:;<=>?[\]`|}~@=nrbtfavx\01234567*?[rwxHOME}-+?==:ugo%s     ()&|; (core dumped)Done(%d)You have stopped jobs. unlimited %lld %ldm%ld.%.3lds%c[%d] Running %*c%d %s%*c%s%sline %d: parameter not set or null%.*s: %s%s%.*s: is read only%.*s: bad variable nameOLDPWDcan't set tty process group (%m)%d: %m (expecting %s)exponent less than 0divide by zeroexpression recursion loop detectedbad fd number%lld"$(...)"$(...)${${#"}$(())>|<<...while && || if ; then ; else ; fiuntil ; do ; done in () { ... };; >>>&<&%s=%s %s: %s not found %s%s%.*s%s can't forkillegal option -%cno arg for -%c optionLPNo previous jobNo current job%s: no such job%s: ambiguousjob %s not created under job control -%u[%d] p:u:rt:n:sIFSexpression expected%.4o illegal mode: %sHSatfdscmlpnvwtoo many argumentsbad number%-20s error setting limit (%m)out of file descriptorstrap -- %s %s %s: bad trapCDPATHcan't cd to %susage: getopts optstring var [arg]OPTARGIllegal option -%c No arg for -%c option OPTINDcan't access tty; job control turned offillegal option %co %s%-16s%s set %co %s illegal option %c%credir errorpipe call failednonexistent directorycan't create %s: %sno such filecan't open %s: %smissing '))'unterminated quoted stringmissing '}'bad substitutionEOF in backquote substitutionillegal eof marker for << redirection Use "exit" to leave shell. %builtinfunc%s not defined in %s is a shell keywordalias is an alias for %s a tracked alias for is%s %s is a shell functionspecial is a %sshell builtin: not found pvVPS1=# HISTFILE.ash_history/etc/profile.profileENVbad for loop variable-obad function nameeerrexitfnoglobIignoreeofiinteractivemmonitornnoexecsstdinxxtracevverboseCnoclobberaallexportbnotifyunounsetend of file);;`dodoneelifelseesacfithen}3.3:2[2[[6alias2bg3break2cd0chdir2command3continue2echo3evalZC3exec3exit7export2false2fg2getopts0hash2jobs2kill0let4local2printf0pwd2read7readonly3return3set3shift3source2test3times3trap2true0type0ulimit2umask2unalias3unset2waitPS1=$ PS2=> PS4=+ OPTIND=1Illegal number: %s   read: '%s': not a valid identifierinvalid timeoutREPLYinvalid countinvalid file descriptorS%dcan't execute '%s'ambiguous redirect%s: readonly variablePWD=%sStopped[%d] %-22s %.40s %s: not in a function[%d] %d %s waitpidBuilt-in commands: ------------------%s: bad arguments%s: not in a function or sourced script%s: only meaningful in a loop!+vfunset: -v and -f are exclusive%s: '%s' invalid mode%04o RANDOM%.*s/%sa shell builtintype: %s: not found%s is %s '%.*s'trap -- trap: %s: invalid signal specificationtrap: invalid arguments!nexport %.*sset: %s: invalid option*?[\!srn:p:t:u:glob error %d on '%s'syntax error: unterminated %s$!?#*@_${name}syntax error\$`"\ ! ! commandnot a valid identifier in forsyntax error: unexpected %s{}<>;&|()#'\$"`unexpected EOF in here documentBUG: unexpected %c cd: %s%s: no current job%%%d%s: bad argument '%s'%s: %d: no such jobkill (SIGCONT)bug in redirect parsemalformed forerror in arithmetic:-=+?%#parameter null or not set$%s: cannot assign in this wayBUG in varexp3BUG in varexp2wait: '%s': not a pid or valid job specwait %s%s %c HUSH_VERSION+c:xinsRun commands in a fileResume a job in the backgroundExit from a loopChange directoryStart new loop iterationConstruct and run shell commandExecute command, don't return to shellExitSet environment variablesBring job into the foregroundList jobsSet local variablesmemleakInput into variableReturn from a functionSet/unset positional parametersShift positional parametersTrap signalsWrite a description of command typeSet file creation maskUnset variablesWait for processdivide by 0HUSH_VERSION=1.16.1<<=>>=<< >>,||&&!=*<=k>=K== |=B&="*=/=#%=C+=-=--3^=b++*ZD */!0< >+=|& */.%N+ --^~,?:$)4(c:nklogd started: %sklogd: error %d in klogctl(2): %mklogd: exitingsemop[SMrup]can't find syslogd buffercan't access syslogd buffercan't get access to semaphores for syslogd buffersemop[SMrdn]p:st:unknown %s name: %sfacilityprioritySMwdnSMwup/dev/console%s.%s%s %.64s %s %s m:nO:l:Ss:b:R:LC::D/var/run/syslogd.pidshmgetshmatsemgetsyslogd started: BusyBox v1.16.1read from /dev/logsyslogd exitingalertcritdebugemergnoticepanicwarnwarningauthauthprivdaemonkernlprnewssecuritysysloguucplocal0local1local2local3local4local5local6local7/var/log/messages ./%srun-parts/etc/acpi/proc/acpi/event/var/log/acpid.logc:e:l:dg:m:s:S:vPWRF/00000080LID/00000080RFKILLSLPB/00000080s+:n+cs:n:klogctlgeometrytimingsinterlaceddoublevsynchsynccsyncextsync mode "%ux%u-%u" # D: %.3f MHz, H: %.3f kHz, V: %.3f Hz geometry %u %u %u %u %u timings %u %u %u %u %u %u %u accel %s rgba %u/%u,%u/%u,%u/%u,%u/%u endmode /etc/fb.modes# endmode%d %d %d %d %d %d %dunknown video mode '%s'FBIOPUT_VSCREENINFOFDGETPRMSingleDouble%s-sided, %d tracks, %d sec/track. Total capacity %d kB Formatting... FDFMTBEGFDFMTTRK%3dFDFMTENDVerifying... problem reading cylinder %d, expected %d, read %dbad data in cyl %d Continuing... EmptyPartition %u is already defined, delete it before re-adding cylinder Disk %s: %lu MB, %llu bytes Disk %s: %lu.%lu GB, %llu bytes %u heads, %u sectors/track, %u cylinders, total %u sectors Units = %s of %u * %u = %u bytes The number of cylinders for this disk is set to %u. There is nothing wrong with that, but this is larger than 1024, and could in certain setups cause problems with: 1) software that runs at boot time (e.g., old versions of LILO) 2) booting and partitioning software from other OSs (e.g., DOS FDISK, OS/2 FDISK) %c%2x %-22.22sPartition %u has different physical/logical beginnings (non-Linux?): phys=(%u, %u, %u) logical=(%u, %u, %u) Partition %u hZEas different physical/logical endings: Partition %u does not end on cylinder boundary %c: unknown command Unknown value(s) for: (settable in the extra functions menu) Disk %s: %u heads, %u sectors, %u cylinders Nr AF Hd Sec Cyl Hd Sec Cyl Start Size ID%2u %02x%4u%4u%5u%4u%4u%5u%11u%11u %02x Warning: bad start-of-data in partition %u Partition %u contains sector 0 Partition %u: head %u greater than maximum %u Partition %u: sector %u greater than maximum %u Partition %u: cylinder %u greater than maximum %u Partition %u: previous sectors %u disagrees with total %u Warning: partition %u overlaps partition %u Warning: partition %u is empty Logical partition %u not entirely in partition %u Total allocated sectors %u greater than the maximum %u %u unallocated sectors %*s Boot Start End Blocks Id System Devicepart%*.*s%s%-2u%s %c %11u %11u %11u%c %2x %s Partition table entries are not in disk orderCommand Actiona toggle a bootable flagb edit bsd disklabelc toggle the dos compatibility flagd delete a partitionl list known partition typesn add a new partitiono create a new empty DOS partition tablep print the partition tableq quit without saving changess create a new empty Sun disklabelt change a partition's system idu change display/entry unitsv verify the partition tablew write table to disk and exitx extra functionality (experts only)The partition table has been altered! Calling ioctl() to re-read partition tableWARNING: rereading partition table failed, kernel still uses old table'%s' is opened for read only Note: sector size is %u (not 512) device has more than 2^32 sectors, can't use all of themDevice contains neither a valid DOS partition table, nor Sun, SGI or OSF disklabelIgnoring extra extended partition %u Bad offset in primary extended partitionWarning: deleting partitions after %u Warning: extra link pointer in partition table %u Warning: ignoring extra data in partition table %u Omitting empty partition (%u) Warning: inZFvalid flag 0x%02x,0x%02x of partition table %u will be corrected by w(rite) DOS disklabel/dev/hd/proc/ide/%s/mediaDisk %s doesn't contain a valid partition table /proc/partitions %u %u %u %[^ ]%s (%u-%u): %s (%u-%u, default %u): Using default value %u Value is out of rangePartition numberWarning: partition %u has empty type Selected partition %u No partition is defined yet!First %sSector %u is already allocated No free sectors availableLast %s or +size or +sizeM or +sizeKAll primary partitions have been defined already!b+:C+:H+:S+b:C:H:lS:uCommand (m for help): WARNING: Partition %u is an extended partition DOS Compatibility flag is setDOS Compatibility flag is not setThe maximum number of partitions has been createdYou must delete some partition and add an extended partition firste extendedl logical (5 or over)Command action %s p primary partition (1-4) Invalid partition number for type '%c' Partition %u does not exist yet! Hex code (type L to list codes): Type 0 means free space to many systems (but not to Linux). Having partitions of type 0 is probably unwise.You cannot change a partition into an extended one or vice versaChanged system type of partition %u to %x (%s) Changing display/entry units to %s Expert command (m for help): Partition %u has no data area New beginning of dataNumber of cylindersDevice: %s 0x%03X: %02XOrdering is already correct Done.Number of headsNumber of sectorsWarning: setting sector offset for DOS compatiblityb move beginning of data in a partitionc change number of cylindersd print the raw data in the partition tablee list extended partitionsf fix partition orderh change number of headsr return to main menus change number of sectors/trackFAT12FAT16 <32MExtendedFAT16HPFS/NTFS OS/2 Boot Manager Win95 FAT32 Win95 FAT32 (LBA)Win95 FAT16 (LBA)Win95 Ext'd (LBA)Hidden FAT12Compaq diagnosticsHidden FAT16 <32MHidden FAT16Hidden HPFS/NTFSHidden Win95 FAT32Hidden W95 FAT32 (LBA)Hidden W95 FATZG16 (LBA)