15Q($y@a_$>=NR2160qGLzHYFSS!V10#fmkyaffs2image Version: Linux-2.6.35-Google Nand Controller V301, make time: Thu Jun 8 02:39:27 2017 .`߿.flash%AN9YH9YH9Y0nfsrootAN9Y8Y8Y&init=9Y8Y8Ysbin/init3mkimg.rootfs=9Y[tX8Y=)#!/bin/sh #$1: rootfs dir #$2: output dir #$3: name #$4..: types rootfs_dir=$1 rootfs_image_prepath=$2/$3 while [ -n "$4" ] do case "$4" in "jffs2") echo "making filesystem image jffs2 ..." mkfs.jffs2 -e 0x20000 -d $rootfs_dir -o $rootfs_image_prepath.jffs2 echo "making filesystem image jffs2 for nand ..." mkfs.jffs2 -e 0x20000 -n -d $rootfs_dir -o $rootfs_image_prepath.nand.jffs2 ;; "cramfs") echo "making filesystem image cramfs ..." mkfs.cramfs $rootfs_dir $rootfs_image_prepath.cramfs ;; "yaffs2") echo "making filesystem image yaffs2 ..." mkfs.yaffs2 $rootfs_dir $rootfs_image_prepath.yaffs2 >/dev/null chmod a+r $rootfs_image_prepath.yaffs2 ;; "cramfs-initrd") echo "making filesystem image cramfs-initrd ..." mkfs.cramfs $rootfs_dir $rootfs_image_prepath.temp mkimage -A arm -T ramdisk -C none -a 0 -e 0 -n "initrd in cramfs" -d $rootfs_image_prepath.temp $rootfs_image_prepath.cramfs.initrd rm $rootfs_dir $rootfs_image_prepath.temp -f ;; "cramfs-initrd-img") echo "making filesystem image cramfs-initrd ..." mkfs.cramfs $rootfs_dir $rootfs_image_prepath.temp mkimage -A arm -T ramdisk -C none -a 0xe1100000 -e 0xe1100000 -n "initrd in cramfs" -d $rootfs_image_prepath.temp $rootfs_image_prepath.cramfs.initrd.img rm $rootfs_dir $rootfs_image_prepath.temp -f esac shift done =%`߿binAN9YH9YH9Y<pppoe-stopH9Y)tX8YO ?#!/bin/sh # ../scripts/pppoe-stop. Generated from pppoe-stop.in by configure. #*********************************************************************** # # pppoe-stop # # Shell script to bring down a PPPoE connection # # Copyright (C) 2000 Roaring Penguin Software Inc. # # $Id: pppoe-stop.in,v 1.2 2005/08/10 00:25:19 dfs Exp $ # # This file may be distributed under the terms of the GNU General # Public License. # # LIC: GPL # # Usage: pppoe-stop [config_file] # If config_file is omitted, defaults to /etc/ppp/pppoe.conf # #*********************************************************************** # Set to "C" locale so we can parse messages from commands LANG=C export LANG ME="`basename $0`" LOGGER="/usr/bin/logger -t $ME" CONFIG="$1" if [ "$CONFIG" = "" ] ; then CONFIG=/etc/ppp/pppoe.conf fi rm -f /tmp/pppoe_startup rm -f /tmp/pppoe_fail if [ ! -f "$CONFIG" -o ! -r "$CONFIG" ] ; then echo "$ME: Cannot read configuration file '$CONFIG'" >& 2 exit 1 fi export CONFIG . $CONFIG PPPOE_PIDFILE="$PIDFILE.pppoe" PPPD_PIDFILE="$PIDFILE.pppd" STARTPID="$PIDFILE.start" # Backward config file compatibility if test "$DEMAND" = "" ; then DEMAND=no fi # Ignore SIGTERM trap "" 15 # Check for pidfile if [ -r "$PIDFILE" ] ; then PID=`cat $PIDFILE` # Check if still running kill -0 $PID > /dev/null 2>&1 if [ $? != 0 ] ; then echo "$ME: The pppoe-connect script (PID $PID) appears to have died" >& 2 fi # Kill pppoe-connect $LOGGER -p daemon.notice "Killing pppoe-connect" echo "Killing pppoe-connect ($PID)" kill $PID > /dev/null 2>&1 # Kill pppoe-start PIDS=`cat $STARTPID` kill -0 $PIDS > /dev/null 2>&1 if [ $? = 0 ] ; then $LOGGER -p daemon.notice "Killing pppoe-connect" kill $PIDS > /dev/null 2>&1 fi killall pppoe # Kill pppd, which should in turn kill pppoe if [ -r "$PPPD_PIDFILE" ] ; then PPPD_PID=`cat "$PPPD_PIDFILE"` $LOGGER -p daemon.notice "Killing pppd" echo "Killing pppd ($PPPD_PID)" kill $PPPD_PID > /dev/null 2>&1 || exit 1 f0<߿i # Kill pppd again, in case it's still hanging around if [ -r "$PPPD_PIDFILE" ] ; then PPPD_PID=`cat "$PPPD_PIDFILE"` kill $PPPD_PID > /dev/null 2>&1 || exit 1 fi rm -f "$PIDFILE" "$PPPD_PIDFILE" "$PPPOE_PIDFILE" "$STARTPID" else echo "$ME: No PPPoE connection appears to be running" >&2 exit 1 fi exit 0 O<߿ ioniceH9Y8Y8Ybusybox*mktempH9Y8Y8Ybusybox*pppoe-startH9Y)tX8Y ?#!/bin/sh # ../scripts/pppoe-start. Generated from pppoe-start.in by configure. #*********************************************************************** # # pppoe-start # # Shell script to bring up a PPPoE connection # # Copyright (C) 2000 Roaring Penguin Software Inc. # # $Id: pppoe-start.in,v 1.2 2005/08/10 00:25:19 dfs Exp $ # # This file may be distributed under the terms of the GNU General # Public License. # # LIC: GPL # # Usage: pppoe-start [config_file] # pppoe-start interface user [config_file] # Second form overrides USER and ETH from config file. # If config_file is omitted, defaults to /etc/ppp/pppoe.conf # #*********************************************************************** # From AUTOCONF prefix= exec_prefix=${prefix} # Paths to programs CONNECT=${exec_prefix}/bin/pppoe-connect ECHO=/bin/echo IFCONFIG=/sbin/ifconfig # Set to "C" locale so we can parse messages from commands LANG=C export LANG # Defaults CONFIG=/etc/ppp/pppoe.conf USER="" ETH="" ME=`basename $0` # Must be root #if [ "`/usr/bin/id -u`" != 0 ] ; then # $ECHO "$ME: You must be root to run this script" >& 2 # exit 1 #fi # Debugging if [ "$DEBUG" = "1" ] ; then $ECHO "*** Running in debug mode... please be patient..." DEBUG=/tmp/pppoe-debug-$$ export DEBUG mkdir $DEBUG if [ "$?" != 0 ] ; then $ECHO "Could not create directory $DEBUG... exiting" exit 1 fi DEBUG=$DEBUG/pppoe-debug.txt # Initial debug output $ECHO "---------------------------------------------" > $DEBUG $ECHO "* The following section contains information about your system" >> $DEBUG date >> $DEBUG $ECHO "Output of uname -a" >> $DEBUG uname -a >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG $ECHO "* The following section contains information about your network" >> $DEBUG $ECHO "* interfaces. The one you chose for PPPoE should contain the words:" >> $DEBUG $ECHO "* 'UP' and 'RUNNING'. If it does not, you probably have an Ethernet" >> $DEBUG $ECHO "* dri 0<߿ver problem." >> $DEBUG $ECHO "Output of ifconfig -a" >> $DEBUG $IFCONFIG -a >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG if [ "`uname -s`" = "Linux" ] ; then $ECHO "* The following section contains information about kernel modules" >> $DEBUG $ECHO "* If the module for your Ethernet card is 'tulip', you might" >> $DEBUG $ECHO "* want to look for an updated version at http://www.scyld.com" >> $DEBUG $ECHO "Output of lsmod" >> $DEBUG lsmod >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG fi $ECHO "* The following section lists your routing table." >> $DEBUG $ECHO "* If you have an entry which starts with '0.0.0.0', you probably" >> $DEBUG $ECHO "* have defined a default route and gateway, and pppd will" >> $DEBUG $ECHO "* not create a default route using your ISP. Try getting" >> $DEBUG $ECHO "* rid of this route." >> $DEBUG $ECHO "Output of netstat -n -r" >> $DEBUG netstat -n -r >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG $ECHO "Contents of /etc/resolv.conf" >> $DEBUG $ECHO "* The following section lists DNS setup." >> $DEBUG $ECHO "* If you can browse by IP address, but not name, suspect" >> $DEBUG $ECHO "* a DNS problem." >> $DEBUG cat /etc/resolv.conf >> $DEBUG $ECHO "---------------------------------------------" >> $DEBUG $ECHO "* The following section lists /etc/ppp/options." >> $DEBUG $ECHO "* You should have NOTHING in that file." >> $DEBUG $ECHO "Contents of /etc/ppp/options" >> $DEBUG cat /etc/ppp/options >> $DEBUG 2>/dev/null $ECHO "---------------------------------------------" >> $DEBUG else DEBUG="" fi # Sort out command-line arguments case "$#" in 1) CONFIG="$1" ;; 3) CONFIG="$3" ;; esac if [ ! -f "$CONFIG" -o ! -r "$CONFIG" ] ; then $ECHO "$ME: Cannot read configuration file '$CONFIG'" >& 2 exit 1 fi export CONFIG . $CONFIG # Check for command-line overriding of ETH and USER case " 3<߿$#" in 2|3) ETH="$1" USER="$2" ;; esac # Check for pidfile if [ -r "$PIDFILE" ] ; then PID=`cat "$PIDFILE"` # Check if still running kill -0 $PID > /dev/null 2>&1 if [ $? = 0 ] ; then $ECHO "$ME: There already seems to be a PPPoE connection up (PID $PID)" >& 2 exit 1 fi # Delete bogus PIDFILE rm -f "$PIDFILE" "$PIDFILE.pppd" "$PIDFILE.pppoe" "$PIDFILE.start" fi echo $$ > $PIDFILE.start # Start the connection in the background unless we're debugging if [ "$DEBUG" != "" ] ; then $CONNECT "$@" $ECHO "1111Start the connection fail" exit 0 fi rm -f /tmp/pppoe_startup sh -x $CONNECT "$@" > /tmp/connect_log 2>&1 & CONNECT_PID=$! if [ "$CONNECT_TIMEOUT" = "" -o "$CONNECT_TIMEOUT" = 0 ] ; then $ECHO "Start the connection fail" exit 0 fi # Don't monitor connection if dial-on-demand if [ "$DEMAND" != "" -a "$DEMAND" != "no" ] ; then $ECHO "Start the connection fail" exit 0 fi # Monitor connection TIME=0 while [ true ] ; do ${exec_prefix}/bin/pppoe-status $CONFIG > /dev/null 2>&1 # Looks like the interface came up if [ $? = 0 ] ; then # Print newline if standard input is a TTY tty -s && $ECHO " Connected!" touch /tmp/pppoe_startup /etc/ppp/ip-up exit 0 fi if test -n "$FORCEPING" ; then printf "%s" "$FORCEPING" else tty -s && printf "%s" "$PING" fi sleep $CONNECT_POLL TIME=`expr $TIME + $CONNECT_POLL` if [ $TIME -gt $CONNECT_TIMEOUT ] ; then break fi done $ECHO "TIMED OUT" >& 2 # Timed out! Kill the pppoe-connect process and quit kill $CONNECT_PID > /dev/null 2>&1 # Clean up PIDFILE(s) rm -f "$PIDFILE" "$PIDFILE.pppd" "$PIDFILE.pppoe" "$PIDFILE.start" /etc/ppp/ip-down exit 1  <߿mountH9Y8Y8Ybusybox <ftpH9YH9YH9Y# )ELF(4 4 (444  H    Qtd/lib/ld-uClibc.so.0av6N>EZ%hWnR&Yc[1@eqX"SGkVI/Fb<o_\0mi3-Q(? tjspBlCuJ^r f4d 5MO)P,g  '7:;A$T8.29=H`]+DK#* aUL!'̒3ؒH d ,JL8IDP\hty]ȓԓ:Hbb:(4@L"Xdp|2V6ĔWДܔHPT &<߿P  $.0z<<HT`Alx/~ؕ̕.H7T Cp ,8mDtP\HhtiXF'H \\[ȖԖT*N(41@LXidpmemcpymallocabortraisefreelibc.so.0strlenvfprintfstrncasecmpmkstempclosedirsetsockoptfflushstderrshutdownputsstrdupfgetcfopenfgetsforkacceptbindgetlogin__errno_locationopendirinet_aton__fgetc_unlockedgetpwnammemmovereaddirgetenvreadstrerroraccesssleepherrorputcharstrncatinet_ntoafdopengetservbynamestrcatisattysnprintfgetcwdgethostbynamefeofchmodlseekexitselectconnectsenddirfdsscanfrindexwaitstrchrfstatstrcasecmp__uClibc_mainferrorgetpasssignalfputcgetpidperrorlistenpopen__sigsetjmpstrncmpchdirunlinkstrcmp__ctype_bfilenorewindsocket__fputc_unlockedstrncpyexeclstrcpygettimeofdaygmtimefseekgetpwuidumaskfclosegetsockname__data_startgethostnamestrrchrgetuidpclose__stdinatoiatol__stdoutfwritesiglongjmp_edata__bss_start__bss_start____bss_end____end___endHL P5T6X]\d     $(,04 %<߿8<@DHLPT X!\"`#d$h%l&p't(x)|*+,-./012378:;<=>?@ABCDEFGHIJKLNOPRS TUVWX Y$Z([,\0^4_8`<a@bDfHgLhPiTjXk\l`mdohplqprtsxt|u -L-,~Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ Əʌ  --- 0{#\hN`<0@ R  /@@-0S00@S 0<߿ 3/l% - @ppWpW pp0Q0W0S@T* Zh<P@0@ZY T  T `\QP@@@T h  @/`Qh<0@@-0G @@ @ @l@r3\a :0@ @-xH @@ @ @@r3\L :0@ @-E @@ @ @@r3\7 :0@ @-J@@ @ @@r3\" :0@ @-J@@ @ @@r3\ :0@ @-hG @@ @ @@r3\ :0@ @-,G @@ @ @@r3\ :0@ @-H @@ @ @ @r3\ :0@ @-dG @@ @ @ @r3\ :0@ @-D @@ @ @0 @r3\ :0@ @-lH @@ @ @D @r3\ :0@ T p @-@@: 0@ | 8 @-@@y: 0@   @-@@n: 0@ )9 @0@P @8@-dG @@) @P@0P 0P88@-dG @@) @P@0P 0P88@-dG @@* @P@0P 0P8G-`w p@P@@dg X 0`@P@Td(  @ 20@Q! R PT 0 @P * @^ $ @P@8 @G0E-tM* @`0 @0 00000 0$0Q 0S $S \S S p al h @`l0`@FS- L[S@P \S  *<߿$Sc 00S [S0$S  S,SB ]S \S $S 00 S,SBS A0 S ]S \S 0 S` @tЍ 0Q 10Ap1l\ Hp$ W 0 g W Q 0 W 0 Wl   0R 10Bp1l R Hp$ R 0Z Q 0Q 0Z bn0Sh00Ÿ0VP @p f 0W10Gpp1n lpWT Hp$ Wn 0g W   \ 0 W 0  W  bQ0SS  p1@pPU 0 S `ppQ lpQ SpP$lPHQ 0S 00S00,S ]S R 0S  00S0S  00Sph,| @-@;P @0}Sd'  @Q @@+ @8@- dG 0@@@P0P P8@}P @ @@-` H @@@0 0s03R0 S@ @H@Q  @>@@d0S @@-`H @@0p03S0 (  @Q @ @ :0@P 0 @@@<\@H8@-@@P 0|S /S 8 /PP  @/P T@ @Z8L @@: 0@ h 8@-@P0S8&@` @ R T PU 5$8X @TPP ?<߿ &$P@-Pp t8 J0@@@`@ `6U` lE @@ -`l @`tH @@` @ :0@ P@- l @@d3 0@ +@  @@np@-H @@M0S '  @@ax @P p 8  *87 @@ @0@@dG O,g l h @@@`@@ RM0P@@@h \``QS00R  @`0% x  @@ `@\V  ! :@0@  @QR  t @`VO l% @ @@p: 0@PU?   h( @ @@`H  @@@ R`MP@@@, ^V  @ \ @\g @`@Q Rx @0S ڬU @P@8@@ Rʔ@Ѝp @ @ @x @PTPU @IG @@@x @-@0S  @0S  @  @0h<PA-M2pP@ `Hpd `  Vp X `Fx ` Vp `Fn ` `F pf ` Vp  @Ѝ @x@-X<0@ @>8@-H @@0S8 \U @P@P x @@ Q 8\7 0@8@-H @@0SZPRP p@-B@@`PU(PU% PU R P0 @Pp @4 `' @ @p$ @Pp @: 0@ p @ @ @P@-@ B@@@ R  <<߿ D@ @ @R @: 0@  @@@G-M@ pT P5 `T, ` y`DT P Z   `i|T `s ` WjTʨ @P ڍ2P.P ,7 @-0@M 0Sڍ @@7HOO@}T @ JP *nPNPP@-@ MP P p`00q`p0LDH@@P@nU PPPl> 0@ Ѝ@  @ Pp H@P |Q P T@P  @ @-4MPXpT`m@P DTHE @4Ѝ<9t@:0@@  p@@P+ /P% p`-00@6P +d(  @QU . @0xZP@@v@NpxN4@@ fH|p@g|nO-M M@`P/R  /R  Vw .R  /1P` 0 S /S ?S*S .SQ0 S LO@ P> PF @*@ 0|S0 /PSP+/S!p p'P @0/S0/S .S /@P P@ ]PV0S/@PpWp )<߿@u Ѝڍ @@ @  @@7 O-0@,M@P`V h @0S,`, @1h @Q `l`@qW& `L @@PP  /0Pg ,Ѝ`<0@P@@AP`\P@P a@?#0&8 ZYd `(  @@0U 0pp/p0 S7 L?PL 0@@PP@U0T 0 L @`\PP@& qx @pw3Hx @~3AP@P@ Q{(@vx@qP0@-MM4 P @: 0@ Ѝڍ0@P EP P @  @  @ X @P0 @@C@@ "R ??@ 0@" P@-#@ P$dH @@R p @@@} :0@Rp @@0dH @@ p 3@c: 0@ @- RHG @@@0S |*  @PPTPXl,W P@`@p@PpFpqME-G @@ MpP9P`(@@P#T @ 0 e08P $P PE7  0@ R H"00\ Ѝ$@&##G-M0M_oP0_OoOp@ \\ejO0P P`:0 0Q X@ * @P+ 0P L, @ 0^ 0 )<߿*O0S0 L  @ 0 00S0t @^|p*  @0SmO00W%ds p@ Ru P0@P#0ЍڍT  @BP*0O`@l: 0@ UWe PZd dw @p@X0 O0@P[ \ @p  200Pu \NH  @P??O 0A<//O00f?ʍ0?OwPUP@ ^F? ?O0 0ds p@oP=ʍO0, ds 0p@ bʍ$ʍ ʍ\ ʍ*:@, (0@ X ʍ,0v. \ S!  0p0ds p@6@<::_0_OXL@@P@0 @&:( Q  0p0ds p@ $R* 0\ ^ ? ?O0 0ds p@l>@- 0@@P @@qd# @- @0l0@@@ T 0@l0 0@hP0@-4M<d dG @@@PP  @P \ @rP4Ѝ0 @P$ \ , (0@@ 0 ,@(  $0   @P@: 0@ P- M4@ Ѝ  @ P@: 0@ O-\G @@ M0S/ P ,W P@Q0U P@ ` m0Sq!`x `C` `PZV P|p@ H [ 0S*0  <<߿ { [ ` VA X. H[ 0S*0{ [ ` V-0S~*0{ [g `H[K 0 Sq*0{ [I ` V H R_{@:0@P|p@0H R&  RI* P p@: 0@ Ѝlg `@ `0H\;  R:* P 0H R&${ { [0\'  @ \i XHPm 0\'  @  P[ VFP_ omjc@2({ { [M0\'  @  P2 VFP6 ?{w { [J0\'  @ ^ VFP <1.l! @ Px@  @ l0@`0dJ@@]<@UlP@- MC P0ڌx pJ *0@@ @p@xj 0 `@0UP@UZ `P@`/(o P hX P@/ Ѝ Q  @4@ " @ >P(@l@pJ @@@ :0@ P0@-M BXpm ^v  \- P :0@Ѝ0X @@{  \0 0SB A3/(  @0S4 @c @AH, @^D"  @PL@: 0@ @PU@#H, @@8 }@00P 0/P 0@j: 0@ P- Ml@ P Ѝ@}Pd7 0@ R@ @# @  PP@:: 0@ t@\P- M@ P Ѝ@}Pd7 0@ R@ @# @ PP@: 0@ @(P@-XM0:0CS@ P 0PSP/ XЍ@  @ H<@0 @Q2(@z PP  @p 0# @ 0 @ b 0@@H@T<P0@  0 @0@@ 00PO-,M0S@CH@!  LPa0LD^XL@@P@@g \ `@@lP>P$PDg `@ R QL@l| , @p@@@@PT00$ !0 S R7 0@ ,Ѝ0 P 0  R0 @PL^ 0|Q 8 \ T @P @T  @P 0v\@: 0@ @L$ @P 0\P- M0!S@ P Ѝ$ @ P@: 0@ @q $ @ P 0  *<߿PO-M RXLw @@Pp@`\ @Pn.DW t| , ܔP@p@@@@@`@P 0S 0@P '  @@ЍQ *P ! R0S  @P @L$  @!P@O: 0@ P- M@ ЍH  @ P@1: 0@ P- M,@ P Ѝ@}Pd7 0@ R\@ $ @ P@: 0@ 4@#O-M4M?OʍP0 ?OOO#0O@Xl `@@P \ @P.gF6d@_xj :O0_O`@@ @*0@$@P 0S'  @0*0@@P= @@4Ѝڍ @0S 0 VP @Xst @Qp @0S/Y  / p 0.R p pY S 0\.S /S00$ pY \.R0p S.RjpY00CP T l>@ 0@  @Qv| @0Sq ,  @@@@ P  @0, @@\Q L, @00가0^ 0 0 灐 Ⰰ Qt @Qg Dp @0Sd `/R  S1Rxw/R  ?\-R0r 0p/RP O^ L$0 @P0@ :  0<߿ 0@ !JJ? 0!J0J>\  S-,G @@R, @ r3@ !00J$0J 0O-M$M?OʍP ?OOO _ _OXL7 @@0@P \ @P.Dx @P) OOW zt Ll OOP@p@@`@ ʍ P 0SFʍ0 P7 0@$Ѝڍ??O  Rw t p Op@@@P@ RaO @P^h @P  )` @P &Z j \ *  0P Q& 0SIp @PL @5@0@\ R 0 Y| @ R ,7 0@@@tP ,'  @m: eP P 0 Q5 0@@@\RU 0d Rw| @Qr , @`@@6P 00, @`_7 0@?ZU Qn ` f%|: @@ @0@  0 R`QW 0S VR QO R;QI 0S  P Q ^ 0PR 0 R0P ,'  @@@P ,7 0@ 0P Q \ 0PR 0 R^ ,7  0@@@ P , @ %  @P\ @ :0@Q  0  %<߿ 0R  0    Q0 S p @P      04P$ QF \R @P0RM 0< R0\ ,  @ @@P 0, @c   @W ?,7 0@0|03, @0q03_{ , @0~03,7 0@0|03.7 , @0~03ʍ +PA-M7 P;`P* 0Rf TS pPG PaUD @P@@U PPV t @0SCp @\7 0Q, 0 Ѝ0  `0PT  @  @P PH   @P@@ UP@0X0p 0 p : 0@ p@-H @@M0S^Pd@QNh P`@Y`PpP\ Ď|PD P@ @P4 `7 0@@8 lP@ P@l  @xP@ @v|8 p 0@P@ @mt @@ @PdX 8 @0@ R 04@1  @ Ѝp7 0@@q`0& @ P @40@PO-M1\7 0@Xe `@@ pH PP# @T Z  PP @T @Q {P @TQ pP @a @ 0 ` Ll `@ @Tb 0僀p  0pP S &<߿W P@ $Sj \Sc 0p0SZ0@Sp0PPpP P ^ @P d @^k 0Sc 3/l(  @\ 0S \ @H^~ 0 S}*  0 @d0S @T^ YЍiRY9p0@p0 p 0@Ap0 0@Aἀ B\0/A!020Pu0S- 3/ @B0  @0P\ @/: 0@ `@'@Pt@1/h@T e Q`@l@: 0@ l! @P T@>0@ /-0M  0 ЍO-n4Mp0`@@0<W x: 0@ RPDCx: 0@Q (S@p倘 w @p@Q ? $ТT TDDXu p@4 @` @ 娥 @㠕 @x @蘊@\ @t @刀,<B-40 (0$ 0  @d0,l0dl0p0pphp0hp0ttxpx0p0|p|倀p00pp,)0 p@l  @(( l @p:  0@/@$ppp$ p@ph /@ 0@Bh p0@ l >0@R  2/4ЍJLo d @-@@MP  0\ bJ:K*[j @ 3<߿  {5{@zg jz{j {{&{Ѝ=9 B = .AP?G-/P@P^ /00X_AX. P 41`P9V@`p% `mP`v`$0V$ @YpdW7 9VP` ~`WP0V PP 9V@`pGP0`0T.S D0`0U.S 00EP@+@W X @@&.0 @O-$Q$`0 0`X @H0S1  R2* AR? SL 0 SR*0\ @@ 0s0S5UMTK7 G$ `0_ -?H0ZH0S( 0$@"0P0d'  @Q @H@1<Ѝs4e00*'c1U  5 0@ 4Q(\P . @^ 4 ,0RR <߿0ES5U1\@H0S  $ !f2/0E[A-0M @ 0SXU `P@q0က  pPЍXW@: 0@ .@- \H@> ' 0@dN @@C@dN. @ (@-@@qH<0@|0. @ \@-@@^H<0@{i@@- H, @p >0@@0 Q @T07 @-0@$M Pp WJ@@ k`P 0# `xP $Ѝ@@@ E-BM M`!\U 0 @@P@ 0P @ @1Z0P 0SXe `@B͍rq0ဠT` B}렢0 q ကV: P'T B]1P UR P*PSP OЍڍ@PE @dP @Z`@t-d @ 0@-^ MP@S `/\E @@0SE $@$p I 0@@q5 0@@@p3 @RW+ Ѝ@Ѝ/$p@ @ pP HL @@ \E @@B0S@@@7/HL@@@@-@M@@0 0P& @4 @00^ %  @Q$ @\ 00` @ R @iP <߿  @Ѝx %@ @@Q @0S* `7 0@\ fl @@?P PP4tC@@@ ` `)P`~ T@* @> 0@@0)P\ xJ @@P E @@^~ kx: E 0@@@p3\ ^x: 0@~3~ @\$ 0@P0SXU P@/b0ap) |p# MQix @0SZM.  @dQ @Ix*  @Q :15 @@P`N @@0 0+"e|  @0[PUt@ zP Q PUzt@ hP Rp mUP  @d^  @ `@ 07 O-0@ (d0@oO (PO| @  <߿ pLČ@,l\ Dx ̆Tdd'Č`J(@@P)80 # 00PPP@@Z }T@Z00rPp4@$@g@b@]@XJ@@ TO-M@ +0 p30S d7 0@Q^ P  -R @6 R @/x @Q 0S*0 @000P$ P0zP' U P@@T @QJ@@P00^ :0@Ѝ0\00RP@yH@P  |P PNx @ R 9P Q 4' `  @@Q -P P0S @QP0S t@ _PL@Q H@nP |P V@T @PHP:H0> 0@+R*;S HN P@@P  Hx)` @0S j@CTgN @@[UdN `` X \|H㔘 @@@@p@ @@#``P+PPڤI U`0S  R^ PUQ  %n \ʀ [P0^`7 0@\M J (XP@@ 0 @p@X @@P0 @[pP  mj @ RB @* @T ^ 1/\ J@@P00Pl@x  <߿p0=P0PL*0 0RH^H, @@@:0@/P@P P00UJ 0t/ PlxX P@^  PP_Q 0 S@Pb~@x`8 0@@T$ P! \ \L@@H^ 0S*#0\, @H0S 0S* @@0H@w @P 0S @ H, @g^P @ T @5P X @@P 0 @m\ 03/ R  yp@:0@Qڐ^ l@0x N @@\`H \|Hl@@p@`@HQf 0S*0 X XH 㼔@@#PX# 0\H*P0 0R 0Q^ HX 0R^ X\D0H\1 0 S3*0 X^HP 0 S*0儀 PHP 0 S*  0X x X - 2 _ 80Q   R` @@T# \ ڄ  R \<0@H^ 0S*#@@0\, @H\ 0S* 0H@LH @@0S \UkVVXL@@ @^@P: 0 q6 gl @0S  @< IP[@  P"* P@ TU0H  <߿ RpX<@0@P0@ Q ʍ 0@  0SP' U P@Q @PJ@@P00 ^ d\  ]@Ѝڍ@R*0H@0P#T @ PK  = \  6: 0@R * 0@ R 1/00@ 0~ #ʍ Pv : + ^lʍP: L@H, @ <߿X@@0 @ @H@PX@P0 @ x {u u#r##Y#iV@E-dM@`X T0@!PT@X@ P\`T@ pVe`Pl  @[O u@P r a` aLPVV\` @Pm 0PSTQ @x @Qp\ @pWkڬe `@@G@P PU^X @@P PUR@P UM@Q@P!@P@  @@P8P `\p0P@ `VO @P X@@0 dЍXQ! (@P @0 @T0x0: 0@ X<@@0 @XO-n`@P$MtQ^xQ@|QQUP ~ p@]?NG,+ZG ]@@ @P~p@XHv!@㲀@,Uk Qg u px 6 @ p 00px#  @m @Pg RP PP"jP 0P# PPPL@XU P@l@\e `@\u Ps d7 0@Q@PB 0 # PA  $@3 @$ЍPP7 ]OR ~ p@4NG,0:GV@ :0@ @P P d(  @P 4@X@@ 2 @ @  <߿ {`@X, @@0 P h D6 0@0 S Pp {P@0 //@-@PPG-p @ pH W*@@X P`@P`P@Xp W@: A-@nPkp4 P0@P U`V`5 H&0@ @ pe``RPOtPP 3`FQ\@O-pD @@MPp~Qb `D& @` l@@0 0RG RU*/Q  FLU*0/S /R xL/P HLU:/Q {^ 0S P@U PP t NP  PZ  ` &@ @ =Q1 \: 0W Wv*``` l@@`AAa Ay0rSY00_Q0 Ar  R-Qb P\:` pT P@^@+pЍX{P@$0$p @P+ ^ ` .\0.S(y(`P( $${^dJ 0Sx ^@`` l&@ @ `/QQp @X& 0P  9 Z:` 〆@@ ,  &0P Q0 4;0@O-M0M{Sx `00{S0Ss @ }S? [S4 0S {S0 Sp pP@ 00UW- a p  GYC LPFFWPU0{S1 ,S [S P]PP   <߿ ]PP R  BЍڍ}S SW PW pGP0P]SS 0S]SS PpP Y `@E-pT 0P@`\M 0 0@?S [SJ {SD S \Ѝ*S. /S Sp3\ 0`?S @PP` ` lv@p@(00p Q. S*0SB /SH P;`Q0S* ]S@ -S PQ0PSp$  @:`u l&p@ @  Ppt p@0  P `\/@Q@{$ $ O-jM4M j( p *D6p@0@` WP& @~TJ @P @P T 0 0R4 T{T@@`@vT`pWV'[ `PpP`p ʍ:S @P@80 PSߍۍq```΍j `E PU00@@_Op/p@Њ z#pD  ` 0@@Њ$p(P  @"P; @$@p4 0@T p Pap@Wp@ R: 00^ dPPp* R% 0` 0 ` Rj= 0Єp pPU s\@t@0\@\3-0@ R- `PpQ"V Q  @Q T  R PXp/ `\ U@ p-h( w h X JP@Mp@ @@@@ <߿ `P0@pRSj0, 0@`!Vp`P0E$Q!Q Q7 Q5 QpSpV P @  @Ѝ/S=pp Qp0 Q Q 0 QS: pV`"Q \QQ Q "Q 0Q "QS 0pSpS ` 0@00ꠤ0PO-P$M@D 0@ PS `p (@PE U $Ѝ40@  PEU`@p  P 40@  `PE@p P@@@d@@@\# @p $'WP`V`U:`P`PDP\#x:  @0@ 0P\\P@   RFpQ P @T  0RC* 0@T *H^ j@v1 S.|@T@@H R 0 ^*T00 Qp \A 8 h e 6 0`0p@-H @@0S \U P@P 6ZP@P6 ^\ \U P@P 00* @p@F` @-@8O-MM_Oj _OOOP @@H@28 D0@H@@PP *0x h , X 0 @@p@@@/P,P l@P0 @@@??Op <߿*Oj@hW 0G p`@P@@@Z -R,  X d p d8 @@@@@0@ Rl dB[ VRQ$RQlQ\Q$R$R$R$RLQ$R 0S6 *3/l @P 0S \@H RN 0SM*0 T@ Q  Q ? WPP 0S+ 3/ @R`@Nt@J@F  R * P p 0HP_%ʍ1/ O L@ @{CP8@-D @@P@0H RL  QM* @ P\,P "PL Q R3* P P P,P \P 0HPp <߿  0S K@@PKPH @sP880H\  R* up 0lP  R* "P \P 0H RUp0H^  R *  8@O-CMMD (P@@ @ 0^3)0@ @P0OL@P` B]@Pa.̂X;@x P@@ $6P Pn P \:, PpP2 W \P@`P* .PP $P Pf IPP`V .`P $PT P@`n 2PP0SZ\ u Ll@p@`@P8 PP5  @Rh ]\$\[ R ) Qa* P P_0HPp @*(P8?NP \ 0|P- X@YP *(P8?9P \ 0hP P 3P @h@( Pp R 1!H0^ P* q0H R4  R* `H R=  R* PH RD  R* @H R?  Rz* 0H R6  Ro*  H R5  Rd* H R8  RY*  Q 4 Q* P+ 0H Rp @ <߿vЍڍ 0S   0 0qTY0S C1   ! 0Sp   H\~ \*p \ 0S\ R HQ Q*p R 0SI  ` RG* pp Wp 0`pHQ#  R:* p0 S0! `V& 0HQpx pp Wp0VFS `0pHQpe p0 S0WGP `VL @9Xl7 0@ 0_\00qD 00 p< p \~SC^{ x00q+00p% p R zSC\d t00q*00q 00q  0 000q00 0 000q000000000000000 p `  UUtZX<$ 0@00 @M<@}X\d P@0- @@ 00 @:X\d P@0- @1 01 @+~lQ  aB Qp 00`BSoq /oo @ r  S?C S?C S>C S>C S=C  S=C SLocal directory now %s %s: bad debugging value. Debuggin <߿ g %s (debug=%d). Continue withsorry, arguments too long(%s) remote-filelocal-fileusage: %s remote-file [ local-file ] MDTM %s%*s %04d%02d%02d%02d%02d%02dRETRLocal file "%s" is newer than remote file "%s" r+wfilenameusage: %s filename %s %02d/%02d/%04d %02d:%02d:%02d GMT SIZE %sLimit of 16 macros have already been definedmacro nameUsage: %s macro_name Enter macro line by line, terminating it with a null linemacdef:end of file encounteredMacro not defined - 4k buffer exceededNmap off.mapoutUsage: %s [mapin mapout] commandusage: %s command ?Ambiguous command?Invalid command?Invalid proxy commandNot connectedfile-nameusage: %s mode file-name SITE CHMOD %s %sarguments to SITE commandusage: %s line-to-send SITE command line to senddirectory-nameusage: %s directory-name RMD %sRMD command not recognized, trying XRMDXRMD %sMKD %sMKD command not recognized, trying XMKDXMKD %susernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: Login failed. remote-filesusage: %s remote-files local-file from-nameto-name%s from-name to-name RNFR %sRNTO %susage: %s remote-files DELE %smdeleteusage: %s remote-file remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWDXCWD %sWarning: embedded .. in %.*s (changing to !!) mgetlocal-filesusage: %s local-files STORSTOUmputusage: %s local-file remote-file APPEAlready connected to %s, use close first. tousage: %s host-name [port] %s: bad port number-- %s non-printstreamfile8AIimageebcdicsend account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftptoggle carriage retu <߿rn stripping on ascii getsdelete remote filetoggle/set debugging modelist contents of remote directoryterminate ftp sessionexecute macroset file transfer formattoggle metacharacter expansion of local file namestoggle printing `#' for each buffer transferredprint local help informationget (set) idle timer on remote sidechange local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesshow last modification time of remote fileset file transfer modesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingenter passive transfer modetoggle use of PORT cmd for each data connectionforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename filerestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filesclear queued command repliessend one filesend site specific command to remote server Try "rhelp site" or "site help" for more informationescape to the shellshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle printing byte counter during transferstoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode!$accountappendbellbyecasecdcdupchmodclosecrdeletedebugdirdisconnectexitformgetglob  <߿hashhelpidlelcdlsmacdefmdirmkdirmlsmodtimenewernmapnlistntransopenpromptpassiveproxysendportputpwdquitquoterecvregetrstatusrhelprenameresetrestartrmdirruniquesitesizestatusstructsystemsuniqueticktracetypeuserumaskverboseUsage: %s macro_name. '%s' macro not found. %ld bytes %s in %.3g secs (%.2g Kbytes/sec) runique: can't find unique file name.%c%c%c421 Service not available, remote server has closed connection%s: receive aborted waiting for remote to finish abort send aborted waiting for remote to finish abortftp: acceptftp: setsockopt TOS (ignored)abort%cABOR ---> PASS PASS XXXXNo control connection for command PASVproxy server does not support third party transfers.No primary connectionPORT %s%s %slocal: %s remote: %s ftp: socketftp: setsockopt (ignored)Passive mode refused.%ld,%ld,%ld,%ld,%ld,%ldPassive mode address scan failure. Shouldn't happen!ftp: connectftp: setsockopt (reuse address)ftp: bindftp: getsocknameftp: listenPORT %d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %ld Bytes transferred: %ld Bytes transferred: %ld netin%s: short write WARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly.received%s: not a plain file. netoutName (%s:%s): Name (%s): Login failed. Password:init$initftp: %s: ftp: connect to address %s: Trying %s... ftp: fdopen failed. ftp: setsockoptĆArguments too longOut of memoryPathname too longUnknown user name after ~./Bad directory components{{}`{[*?Commands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s %d ftptcpftp: ftp/tcp: unknown service pftp Usage: { ftp | pftp } [-pinegvtd] [hostname] -p: enable passive mode (default for pftp) -i: turn off prompting during mget  !<߿ -n: inhibit auto-login -e: disable readline support, if present -g: disable filename globbing -v: verbose mode -t: enable packet tracing [nonfunctional] -d: enable debuggingftp: %c: unknown option ftp> sorry, input line too longHOME%s/.netrcError: `password' must follow `login' in .netrc anonymousError - .netrc file not correct permissions. Remove password or correct mode (should be 600). Remove account or correct mode (should be 600). Missing macdef name argument.Macro definition missing null line terminator.4K macro buffer exceededUnknown .netrc keyword %s defaultloginpasswordpasswdmachine "<߿ ؗ \h̋l a 0`00 mvmvvvvjmtn-$Id: cmds.c,v 1.33 2000/07/23 01:36:59 dholland Exp $$Id: cmdtab.c,v 1.8 1999/09/28 15:36:05 dholland Exp $| ~xvȬvmvvXmwH|`0w`Xw$xwwpxw x0xLxHpxH|`x؜|xx yTJ8yvw\yL |yH$yty,yuy4 z<4z|z@dzTuzHzP{XzH`@{hwp{xt{{h{\}|H|`h| #<߿||D4}0Ā|`̀|<Ԁx}h܀|̨ }@T}d8s}}8 ~<~ P~~Tl~m~$~h,~4<LD,LhȆyTJJ$Id: domacro.c,v 1.4 1996/08/14 23:27:28 dholland Exp $$Id: ftp.c,v 1.25 1999/12/13 20:33:20 dholland Exp $$NetKit: netkit-ftp-0.17 $$Id: glob.c,v 1.9 1999/10/02 13:25:23 netbug Exp $$!Tk@(#) Copyright (c) 1985, 1989 Regents of the University of California. All rights reserved. $Id: main.c,v 1.15 1999/10/02 13:25:23 netbug Exp $ $$Id: ruserpass.c,v 1.9 1999/10/02 19:12:33 dholland Exp $A.aeabi$7-A A  ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.32.1+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.init_array.fini_array.jcr.dynamic.got.data.b $ <߿ ss.ARM.attributes.comment d ll`!̋ a) 0002 ``0;6AG\h\MlhlD"Uamr  { HHpH/wx %)<߿tarH9Y8Y8Ybusybox 3pingH9Y8Y8Ybusybox &dateH9Y8Y8Ybusybox%loginH9Y8Y8Ybusybox0fgrepH9Y8Y8YbusyboxpartedH9YH9YH9YELF(Ț44 (pll l 444tt,YQtd/lib/ld-uClibc.so.0EYjt.v3V#Rosc\47ikpXWT5nK2[a^_y?eJw~bz|,LufH:q{r%>Sxd}Q&mOgI](8hl"  ' 1BD<=@-6FG 09!U+*)CM/ $P;N`AZHT`ldxhl _nؕ̕Q, ,(8DP\ht8Z{PvȖԖ@s<߿/(v4$@ELXdMp5|pcI[,0!ȚP ė)З'ܗ0< $0<BHT`lqx D6̘Xؘ,Jj , 8kD5P\Uhot;f,"a}!ș"ԙ[DȒ(4@L,Xd7pb|K=Wgetenvmallocstderrfree__data_startmemcpyabortcallocreallocmemsetraiselibc.so.0strlenvfprintfsrandomstrncasecmpvasprintfiswprintclosedirfflushstrdupfgetsvsnprintfforkreadlinkgetppidlseek64fcntllstat64ftello64__errno_locationopendirstdinmemmovegetpagesize_exitreadfseeko64fsyncaccessfdopenstrcatisattyfopen64__fpendinggetcwdsigactionfeof__fpurgefscanfstrtollmemcmpconnectsscanfmbrtowcusleepunamewaitpidstrchrioctlstrcasecmpsysconf__xpg_strerror_r__uClibc_mainferrorfputcfputsgetpid__sigsetjmpstrncmptolowerftruncatestrcmp__ctype_b_stdlib_mb_cur_maxsyscal <߿lstrtolfilenoposix_memalignreaddir64rewind__assertsocket__fputc_unlocked__freadingstrncpylocaltimeexeclsigfillset__glibc_strerror_rstrcpygettimeofdayjrand48gmtimestrstrumaskfclosembsinitstrnlenstrrchrstatgetuidatoi__stdoutfwritesiglongjmp__cxa_atexit_edata__bss_start__bss_start____bss_end____end___end:^g      $(,048<@DHLPTX\` d!h"l#p$t%x&|()*+,-./012345678;đ=ȑ>̑?Б@ԑAؑBܑCDEFGHIJKLMN OQRST U$V(W,X0Z4[8\<]@_D`HaLbPcTdXe\i`jdkhllmpntoxp|qrstuwxyz{|}~ -L-Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌ<߿ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌƏ_ʌxƏ_ʌpƏ_ʌhƏ_ʌ`Ə_ʌXƏ_ʌPƏ_ʌHƏ_ʌ@Ə_ʌ8Ə_ʌ0Ə_ʌ(Ə_ʌ Ə_ʌƏ_ʌƏ_ʌƏ_ʌ  --- 0c(gD$GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/H-M   0 00 0S  000 0000  0  0  0  0KH-M 00000 0K-M  00 000 0!000S0!00  00!00 Ћ/H-M  0 0 00 0S0700 #0!0000T0S S0!000 0S  0s0 0 0 0 00 000 0!000S 0s0 0!000KH-M 00 0 0 000c0w00 00 0 00S0KH-M 00 0@h0 0x000 0H0S 0 00R*00  0   ~K8gH- M 0 0S @ @00 n0 @-0 0K  00S 00` 00P+ 0 1Y8u+ 0@P00  "?c0t0#0"? c020b1 c  0$00 Kp m(mH-M 80S 800 @$ 0!*00KHmH-M 00I&0S X00S 00  `, 0)0 S000KmH-M 000 )0S00KmH-M !K0 K0SHHH H0$!KK0S0!K 0K4nhn ~H-0MK0 40 0"K 0!K00S 00s "2$000S  0 0000S 0 000 ? 0!K4!KK0S K"K P0"K00 0 000S 000 ? 0!K4!KcK0S K!K P0!K00 0 00 000S* 000S% K"KPK"KQP00S00 K!KPK"KQP00s00  0C$000S 00 000S 00 0S 0S"K 0!K  0Ktnhn-}nM0H- `MP T X \0 P0 "KP0!#K 0#K 0$K0L0 L0H0 "KX@0 0 #KX@00 0 00!QP000 T0S T0 ,K\0S 0<߿ H0 T0!4K0S 0L0 0RH00H0 L00L0 "KHK <K \000 #KLKDK 000 #KR$KR\\\"\2#0S> 0S;0S8K#KPH00H0 "KHK <K \000 #KR!1w#L00L0 #KLKDK 000 $KRlTh!T1]#0S 0! 0S 0 0 0"K"K0S0 0 00S0"#K#K"K\J0S 0.##K J0Sl l0##"KKPtDj/D0#"KCKK@TPPH K0nhn}nnnoLoH- M   D0<00"   0@L0KhH-M 0=00 0S K$H-M00  001000  01SK$H-M00 \ X010 D0!80 1$000  01SK\o0iH-M 0S 00 0S M0KH-M 0 0 '00 300 0S '' 0KR0S6 0S /0S& 00SK0S 50 0400 0S 50S 500 0S P0 0 40Kto H-pM` X(0@0 0$K 0%K0X0 0\0 0 0 00 00 00 00 `002080 80S 870S 70S008 570S 800Y60S0<0 <0Kd8 <߿ 0S 800F60S 800000S<0S 00 0 0$0 <0S $0S 6 $000000S 0@0 @0KT0Sp $g`0L KX0Kh 0Sg `0T K\0KH0S` <@K%K 8 :040 40SS 40 X0\8 \`0X \0 q000 00S%5f!l50S`00%0,0 @50S`00$0,0 `00k$0,0 ,0S$ %5B!0,K0(0 0#L,!L(0S &84( A0S00 0K(L 0[0#0S &`00N00 84 A0S00 0KK 0[0#0SX40!G0S \40"G0SB`0$K--00 `0%K&-00 `040!-00 `040"-00 30S   t30S @00XQ D  #0%0S{20S84 k00#0S 20S84 ^00#0S 20S 0`0|"|%0@SR%;% 0S 4 ;0S$ "1| ?0 0 @04A;0SE 4:0S 4 N:830S8 8%3X0S X0E\0S \0E`00 0S D1 0484rA49  82X0S X0E\0S \0E0KoВoooooooohna}okp4ppp H-M 00 0000 0 0S3 0K  W<߿0S# 0j;0 000 0S 0;0S  730S 20 ~ v20KqoH-$M(  (00 0 0 0 00 D00 6(90S, 0S 00 0 0 00 K' 00 0C00 0 0  @000 K' 00 jC00 0S0Kq- M 0Ћ/H-M 0S 0A0H0 0 00   ?A+00 |00S p 0 0 00 H 0 0 00Kqhn?}(q8q0H- xMh l `2dK H0 h 00+00 (00 h0h0! B 0 0Q Q R0h*00 l0S l00010 10S( 0S Sl}dz\wXAh0h0 W0! PK 0h0h0!hPP 00P  0#h0 h0 W0 K 00  h00  h0!h IG(0S (0Sh*(00S80 K0|}qqqqqqqq r0H- M 00 0t0 0p0 0l0 0h0 0d0 d0S> d e0SP0D0 D0t0 -d` V0SA0@0 @0p0 d( G0S d @0S+0<0 <0l0 : d000000h0 dt0Sl0S00.00 0S 30S `:0S00 530S~ t0SC 040 y4040! B <߿0 04)0\0 )400\ O\41040 40S000080 Y8d 0 00S0K000S0B8o0>l0S X080S h0S 00 000 0K 0S 06000 N00000t0S |80Sp80,0 ,0H0S ,0 ,00R*,00  ,0  ,+ ,0010|0 0010x0 70SN'0S'0 0(0 00'7 0(0 |0S (h (` x0S (L (D (L0o00 (90H0 p0SH60S H0400Sn%0P0 H000S&H000P b6PT&\P 0$0 0H0!)0`0 0H0 000! B 0 0 0(0\0 0H0"(0X0 &0S$`5 $\2 $`. $\+ $X( H0400S+|0S H040@0T0 $T H080S H08004$ x0S H80T0 $T H0 0 $  E|0S $h $ x0S $D $8 $$U P+`)\'X%HW80H0 H0S=0L0 LL(5 B80H0 p0SH60S H0400SH000St#H000\#\30 0H0!P(00 (30H0 000! B 0 0 0'00 2s%0S 0H0"(00 \2aH040 <߿ 0SYH080S "H0800O100 0H0S 0 00R*00:  0 ::+x0S AH?70((100 0H0S 0 00R*00:  0 :Y:H00 0H7Hw70H0 H0S27.02.00 K0$r,rg4rВ8roDrLrTrXr`rhrtr|rrrrrrrrrH-M0 0  0K000 0H0S 0 00R*00  0    00 0 0S0KH-M 00H-M !K600 0S 00!KA0S00KH-4M( (00"0$0 $0S0j(00$!0 0 0S0^(00 MA0S t@0R G00 (0 0 0! ( <0SE0;E 0 0 &00 0 0!&00 $0@(040>000000Ft 0y00 4@RP0S @S0 0($L5(00-0KrpH-M  00! 0OP 00b Q00 000"dK 0L?p20#`20X$0 "Kv<2`0 K P0 @P0!  0  0!0#0DK 0 "K?1@100"PKDKdK! 0 C0!K  7300 0S0KD#T0K :0S V0S S s# 0KD0' <߿ ;An30KDK 0 0"K0"KPH00Hc#0 :R30KD0Kp$sh?H-pMx 0"K 0#Kx00;*0 0 0S x0 ,0K 00S x0 40K 00S K"K P0 0" 0@Px000 ?T K"K P0 0" 0@Px000@_x0002 ?R*K"K P0 0z" 0@Px00i0 ?T K"K P0 0c" 0x00S0 ?x00K02 ?!Kx0K!K P0R 0xBKaKV`p`pK@PTTK =x0K!K P0R 0xBKaKV`p`pK@PTtK =T Kt0K  S0S +x00 0S H0 0  y+0Koo H-M 0 0 008)00 0S% 0K 0S 0C0S 09+K+00 0S <0 0<+0Kq H-M 000 0Kts0S000S0 00 0 000K0sH- M  0 0R  07000 0S00 0 0S0 0 l\h \00 0 G! 0 QP000K 0[K@3000#340  p0L E@!0  0\0pl 1P` @300 0 C0z P@\200  *04a P@200  0Hlh P\@1H2 D20 00  0T) P@1 10 0  0  P@100 d 0LH ` H0mS mShS lS aS -vS  S% sS &00 &00 #T1 H1 0 0 01 ,1,  <߿! 1!1 1 00 0 00 0! 0S{D0S>0Se8 0 t00 c 0 $0 X001 $0 0K{g$xg {dgВ{(H-M  00S 000%00 0S0$00 C0 00 0 00 0SP@ F0S 00S00K|H-M  0S; 5.0S( 00S{0S"0S 00S00 0S || t0 l00S X0 0 0K|`($H-M 080S 0 0S l h00S \00SP00S < F000zKT| |$H-M  00 K0Kn0 0 0S00Sp00S  0 KT00  0K8 00 00S00K@$H-M &0KH-M 0 0K 0[$0KH-M   0KH-M     J0KH-M e0KH-M [0KH-M  P00 0S  0R 00 0KH-M  00 0K~H-M00 0 0KH-M 0S 00KH-M 000 KH-M 00 00 0 0KH- M 0<߿S @00000K-M  00 000 0S 00S0S 0  00Ћ/H-M  0S 00 000 00Sy 0 000 q00 00 0  0KH-M  '00KH-M  00 0 0  00S 000S#0 00 0 0S0KH-M  0v0K-H-M00 0S 00  0  0 0 0S0KHЍ/-H-M00 0S 00  0  0 0 0S0KHЍ/H-M 000KH- M 00 00 0 0 00 %00S 0000 n 000 0 0 0   0 0700C0 000 0S 0K~H-M 00 00S 00q000 0SK-M  00K00  000 [R0000  0R0Ћ/- M00K\0 0[000;S 80 0[000;S00Ћ/- M00K0[ S00Ћ/H-8M0 4 8 <0 4 <00c Sddo/`3A4 800c0 00(0 (00S (00$0 $0 0 0 0 0 C00CR000   0R0 $0000S 000 00C0 0S  $0000S 00C0 0S  $0000S00$ O00 0s 00C0 0 0 0S 0<߿ 0 00 000   0R $000l0S0S00$0$ 0$0 00c 0 4 <00c0 (00S$00S 1<!& 0S 000 0H0S 0 00R*00  0  T   0RU$ 0SO$G$0 0c0 (00(0 (0S2K~4~H~@~~H- M  000S00@0 0S00KH-M  0 0  00 0KH-M  00 0 0 00  00  0R00 000 0S 0KH-M  00 0 0 00 00 0S S 00S 0 0 00 000 0S 0S00K-M 0 0 00  00 0 000 0S 0Ћ/- M00 H00S<00S 90SP00 0Ћ/H-000S$ $00L -Ћ/H-M 00 0 0  0S# 000 0H0S 0 00R*00  0  0 0S +K`pH-M   0S (0 0 K脠0H-M   00 0S0  i 00S S  003 ppY/l0h T00< L 4002 , 0܂L `oH-M   10lZ 0Sl1 " 000CS?<߿G$Dd$!$10, L> !10& D6 00* <. 00$ 4& 00% , 00* $ d00- d D002 H $000 u܂ă@hĄH-M   10 0SXl1 000CSG$Dd$!$10# > !10$ 6 00, . 00! & 00&  00(  d00& d D00) H $000 ܂,Px̅ HtH-M  81  ,1  1  0S 0;L0000 @00 00 0S 00S  00yx0000S `0 C00 00 0  0K`p-M  0S00 000  00S 0000  0R0Ћ/H-M 00S0000 0900 00 00L <0(00 0 0 JK܂H-M 0000 000S0200S0S00S0#0 00c00 0S 0SP00S D00S 400S $0 00 0K0H-M 00t 0 K4H-Mp00Sddd d0 L000 0 40000 $0*<߿ 00  0K44H-000 4H-,00S 00004H-0004- M 000 D0 00000 0S00S00Ћ/H-FM  00 0 0K101 10 S 00 G10 S 0S1SB0S?0S 10L0S 00 10 0K$0S 10 [R00 0S 10\S100S 101 1 0K0 000 101 10S0S1S  D0K 0 >K10S 1SKІH-M  @0000 0"00 0KH- M  /00 0S 0S 0S/1 0SI 0SD00S 00 0 0 /  0R |00 0S p0SH00 00 $00 00 00 \ 00 0 0S00 $0S 00S r00 |m00 h00 `c00 00S <Y00 0KԆ  H- M  $0 0 0 00 0S  p0S C0 0 00 00S 0S6 3  <00  !00 0S0 00S 0S $W0S 0S 0S K0H-M   0 >0S$ 0 0 0S 0& 00 0S)<߿ x 0J 0S 0H00S 0  0n0S0KH- M $ $00K A$00S 0K0  00 0 0S0 ,0$ 00 Y0K,H-(M  $0 0 00 0  00 0y0 0 0S$ 0  0S$0S 0 {. $0 $00S00  0 0S   0 $0S $0 0  $000 0KH-M  00S 00!0 0 000 0 00  000 0S0L000S 0 0 0K<@DH-M  00S 00000  00 0 0S0 y 00 0S00  0KH-M  00S 0000 0 0K0S000Shhh h0C00 0R 0000 0S00  0K0H-M   00S 00000 0 0K0S@` R 0 0 %00 0S@( C 00  0K8XH-M  00S 0000 0A0 0 0S@p  0 00 0S@@ 0 0 0  0KTtH-M  00S 0000 000 0S@\ 0 0 00S$$$ $00KXԇW<<߿H- M  00 00 \"0S +00 >00 H00 >,00 0S 00 0  0S 6, 0 j00KH-M 00 9$0S0 000  0R0KH-M 0S0000S0G#0S 00KH-M 000S0.#0S00KH-M   0 0 0S 0 0 0 0 0S 0 0 0 0 0S \0 0 H0 0 0S@(! 0A 0 00 0S@ 0/[0S U0S0 L0S pF0S0 P=0S 870S0 0K$H-M  00  0 0   0800  0000  0 0 0S 000 0S0!~0 0  00S  00S  0 0 7 0KH-M  00S 00a0 0 00Z0 0 00  0T00 0S0D000S 00 00KHLPH-M  00 00 000 000 0 S000  00 0  0S  0 00KH-M10 0 0S0 0 0K !00 0K,0H-&<߿ M00  030 @ P 0 \0! P01S0 000  03@S 00 K0<H-M00  001000  01SK<H- |x t l0 hd m X0 H00@<000 0 0@<D@DH-,00Y 00U00Q<@DH- |x : l0 hd 3 X0 H00g@<00b0v 0 0HHPLPH-,00 0000HLPH-M0 0 0 0 00 0 00S0#  0 0 0S 00 d0 00 D0 <00S0 00 0S0KTH-M0 00 d0 00 D0 <00S000 0S0KX-0Ћ/H-M0S 0S H0S ~0S 0S0Wd( 0KT1T! P1P! L1L! H1H! <1 K0 1!1 0 ( 0 0  0 0 0 0 0 0 |0 t0 d0 \0  P0 D0 80 0K$| xH-0000TXH-M,2 (20200 0H0S 0 00R*00  0   w!10 v100 0H0S 0 00R*00  0   3<߿T 10 0 0H0S 0 00R* 00  0   7 00 6000 0H0S 0 00R*00  0  i $0  XdpH-M  00K蘈H- M $ $$00 1$  1 10 00|10&00 0 0 H+<100S $100 0H0S 0 00R*00  0   0K 0w0S 200 0S T000 0  0S  00S@=8H- M  $0 $1  00 0!$000a000   0R'00 0S& 00>0 0  0S 000Sl l00: FP 0S 0S00K8H-M 0S\\= X0F<00  0 0  0  0 0KlxH-M 0SN 1#00SO 00 0 !00 0 010 0100,000 0 0R0 0100 00 0 0 0R000 0  K耉x- M  0R00Ћ/0H- M 0Sh 100Sthi d10 0S0010 0 00 0 010 000 0 0R00 -00 "0 01@0 010P0 010 010 |000<߿000000 0 0R000 0 0R K0耉x`H-M  0S 0T0 0001V0 0 0 0010  00 0 eK耉x܉H-M  01 00 00 0!0@00000!000S000 000 0SKH-0@0S 0@00#0S  00@0S 0@00#0S x t0 :00 0S0 0  0  0 0 ,i0K( P?<ZH-M 0S 00nvKH-M 0S 0 0 0 0R0 0 00  3/KH-M 0S 0 0 0 0 0 0  0 KH- M  0S$ 0 0  tO0S0@0 000c400U0 0 KH-M  0S 0  KH-MK!KK!K 0 0!K? 0K- M 0  Ћ/,-00Ћ/,0H- M  0L0 P  ?!K0 SX(`4`@`L`<<߿\`h`8a```t````0!L 0I/0F=) -0BE? ?> <+09&06!03 <00!B 00"0!00! B 0 0d 0 0 @@ s 000 ,0 K0ʚ;@- M  01Ћ/0H-M 00  H010S0000 0 S0K0H-M 0000 0S00KI-M +K0! K` 0#K0SPP L4$0S:0H0 0 0 00 ?KH 0 00 ?? 0`p 00 ?K5 0 00 ?,@P 00 ?K$K`@!d {0K00S 0S 0S0c 0 K 0@PU 0K@ d W0Ks00S&+KP00+K&P00+KP00 +K' P0000 Kx@P 0n 0 0 56y 0#K0@K 1 70S 0@0S > 0@K 1Y80S 0@0S >  56#K` 0"K0@K 1 70S 0@0S @ @K 1Y80S @$@ @K#K $00 d 0K0KrN T{Gzt??$H-M !K0S444 400000!K0K  ,0H- M !K0S``` `00!)<߿ B 000 K00H- M !K0SddJ/`00!B 00(s0 K0,H-M   0 ,00    0w0K,-M 0 0 $0 000000 0S 000 0 C00  000  000S 00 0 000SЋ/H-M 000 00S P0 000000S00$0S0K(-M 00 00 l0 000000;S  00 000  000SЋ/-M 0 0 00 00 |0 000000;S00 0 0 000  000S 0S00Ћ/0H- 8M0 4 8 <0 40L04 P  ?!K000 0S07( K(0K0(K0S @!0`$ 40L0R40L00C@!S 40P0R40P00C@l!F(0 ?B 00$4P 0 ? 08 8040"PP4000@ 00S<0S 80 4 <0 "<0S <00S 00 8 0 <0S <0 0 K0,8`-M !K!KR 00 0!KP0 0 0!KЋ/H-(M "KK  P0 0!KK 0 0 KK K P0PK"K P0P0 K!KP 0 0 !K0KH-*<߿ M  r0S&0000iS000g0C S񟗂pprprprpprpprprprprprprp 0 0~ 0| 0z00Si 00h0%0COS`hrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtrtr8r`rtrtrtrPrtrtrtr@rtrHrtrtrtrtrtr0rXr0000000 0 0S,00S000 0K,- MKK 0 K 00S000Ћ/0H- 8M0 4 8 <0 00S 04< 0)000$0 $0S $p$0 0 8080 0 $ ",0K %0S @!i48 0!K40!K 0 0!K!KR 0!KK0S 0!KK"K 0@P40! 0J 0 0< $00-S<040" 0< 0S <0 K4| 0 00S4000@ 00n <0 4E 0< $B0$>< 0 0S 0 0 K0БԑH-M 0SxxF t0Y00S`TG P0P00S@0H ,0G00 0 0  KThp@H-M 00 00ST 0)0SU 0!00 0  00 00 0 0S 0R 0SXHZ D0 0S 0 0 0 0 K@hܢT- M 0S 0000Ћ/@H-M 0?<߿0 0Sttz p000 000S 00 0S0KĒhȢH-M 00 0S 00S0100 50S 0 00 00=0003/0S00 0S@00S '0KԒh,H-M 0S 0\0S, 0 0 0S00@ 0 z00 0S 0003/0S 0  0 0KԒhH-M  000,03/0 0 0S% 0  X0S   00 x0S 0S 3 0S 0  0KH-M 0S 100S xl h1000 0SP@,<1000,0S($!1000 03/0 0 0S1 0S&  00 j0S {0S  00 0S 0S 0 0 0 D0K h4LtH-M v00 000S0g00 0S0K0H- 8M8 80S!1H8t0Sk 040 40S!17400083/0S00-0K- [0"K80! V 0 0 0"K"K!K80BK"K 0P80"K P0!K!K 8"K0S% 8080"BKT"K 0 P0!KK"KP"K!K80!K P0 8!Kَ0S 8H <<߿08A0 K0Ԓh7=H-M  0S@@@!@10S0 ]/ 1000S !00H00 00S 000S^/00003/0 0 0S 0S 00S lDh D0 0  0 <0KԒhslȓuwH-M  00 0S 0  0  0  0 00KH-M KH-M 0SPPP P0.00S <,.,0%00003/K,hX<H-M 0S 0 0060S p00003/0S 00a000Z0K,h@(H-M 0S,,,!,100S !10000S000@ ,000S$ 00S 00_0S 0  00003/0S 00 0 000K,h(<PH-M 000S 0S `0S 000 000KH-M 0S444 40W000003/0K訔h/(H-M 0S444 40<000003/0K訔h;(H-@M8 80S@@/<2!80 000 0080,0 00So ,0Sn 000,0(0 (0Sf 00"(0!00cS0c ?"K00" @P 00"d 0 0*0!K000([0S !)<߿ "KKP000K80(0!00 (q0[0#0S 8000"0 0 0000    ` 00 vt00 0 S 0k80000 00Sz0K,h- M  0 00S00Ћ/H-M 00 0S 0r0 0 0  30S 0400S000  \0 0 0S0K,hH-M 00 0Slll l0C0 0 0 00 0R 0000  20 0 0S0K,hH-M  0Sddd d0000`0SH8D 80000`0 3/0K,htH-M 000d0S800d0000d03/0KhH-M 00S``/\0000\0S@4< 00000\03/0K$hH8H- M   0S 00000 0S0$O0Sn0   @l x000 3/0 0 0S0 0K,h4tH-M  0S``` `0i0000 0S00 03/0K,h H-M  0SXXX X0C0000 0$0S00$03/0K,h/H-M 0S$0@ 00K訕H-M 0 0  00 (0S "0S 0 0 0 0S0K- M 000Ћ/H-M  0S"*<߿  0000s9.000S 00000 0S 000L0S\/\0000S\4X 4000L03/0K訔hԕT H-M 0S 000S:.0}0000 0SlXh X0q00P0SL0H 00g00P03/0K訔hؠT8H-M 0S!1I00 0 0  00 0S 0S0# 00 0 0R0 00 0S 000s0S000 0S0K,hH-M 0 0 0S/0 00 0 0 00 0S 0400S 0400S  N 0S0K,hH-M 0SLL/H000S000X03/0K,hH-M 0 0  00 0400S  A .0 0 0S0K0H- 0M( (e00 0S0V0!"K00 0<00 (0!BKPK 00A 0 0 ( 00 ( w00 0""K000 0S0"KPK 00" ( o00 0S ( 00 < 0 K00H- 0M( (p0S0g(0S0`00 0"K(0 00 (0!BKPK 00A 0 0 ( '00 (  00 0""K000 0S(00#?<߿ 0 0KPK 0(00B 0 0 ( 00 0S ( &0(0  0 K0H-M 00S0S000 0 0S000 0 0KH-M 00S 0|00S0S000 C0 >0S000 C0 0Kdh{pH- M   0S 0DH00 0S. 0 0  0  00 P 0 0    0S 0 0 0 4 0 < 0 8 0Կ0K,hXH-M ĿKH- M   =0 0  0S 00 00 0S 00  } 0 0KH-(M   0S<<0S 06!K0S 0 0 00R 00!K0  P0 K KR0 KP 0 KKT l`H-M   0 0SC 10SD 00SE 0 PF 0!PG 0 ? 0 : 0  0  0  !!!0Kĥإ H-0M   0 00 0S 00 ! 00S 0L0K0H- XMP T P0SDD @1tT0S0$ 1lTP0S 0aP0T0 P@T@TP,K FP0P0!TAP@TPLK 3`0PX0@P0T0!,KLK  00 K00إ<HhH-0M( (0STT P0(0(00"$K 0$0K(0K0إ|H-M 0SXX T0P0H00!   0;0K<,?<߿إ`h0H- M 0Shh d00P0@00 00!  00 K0ĥإDH-@M0 4 00S 40S0m00 400l0,0 ,0S_ 00 400`0(0 (0SO 00 4000$0 $0S? 00 40 00 0 0S/ 40!0R 0!K40!0P 0!K!K !K ,($  000 0S ,($ 0 $(,0KH-M 0STTB/P0,0000000 0Kĥإ0H-M 0S ѭKH-PMH H0!HP0gH0H0 H0 0  0"KH0H0 H0 0! 0!KK 0QP K 0QP "KKPH0!KP08H0!KP 0 0!K!KR 0!KH0!KP 0 0 K KR0H00K!KP 0 0DK  !KH00D K0KH- M "K00 0S 0 00"K 0 K KK0H- PMH %KH0 00 0 H0%K 0 0 BP09H0%K 0 0!KH0%K 0 0!K 0 0!KP 0 0 0!KK!KP 0 0DK  !KH0 0D K0 K0H- M "K"K00 0S 0 00 ^ 0 K KKH-(M $ 0S0T$0SLLi/H1 00 $00R (-*<߿ $!1$0 D 0!KK 0QP01$0! !K 0!KK 0QP0 $0K!KP 0 0 !K00 0S0 40S0, 00Klإ|H-8M0 00S000000 0 0 0,K  0n,0K0x0KH-M  0S<< !K B>!KPL 004 0$J!K  I> !K 00$ B> !K 00$0(4 $ 0$0K谨 ,H- M  W00 0S+ 0 0 0 00S 00S 00$0 00 T 00 q0j0KH-M 0K00 0S 0S00KH-M 0K00 0S 0S00KH- tH- tH- 褓ԓH- 褓ԓH-|xt}p{lyhwdu`s\qXoTmPkLiHgܖ$Hlؗ 0<߿ 8PhȘH-}{yw|uxstqpolmhkdi`g\eXcTaP_L]H[ܖ$Hlؗ 8PhȘH-"M( (20!S R 0C(2!@P`0:K 0 (@ 00S0-?K 㒥0S$ 2/ S04 ?"K|0pK !K(2(2@ 0 0$ $ 0c 00  0p00KdH-H-0H- (M( , (00!S R 0K,0S S s B( 0 0 (n0 0 (0 0 0S/ 0 00 00S 000 0 B 0 0!K!K(0!!K(0(0 K 00 0S 0 0 K0H-,M( , (0 00 {0/ S04 ?!(000! 00 0  c00KܩH-,M( (00 0S= 0! w0 00 000! 0P0S# 00@0 0C00  X0S0  0  0$0K ܢ00K$0K@0 0K(H-M 0KH-M 0KH-M 0KH-M 0KH-Dg@e<c,4 (   dtH-8844(,pnld tH-xM  \K 0  0 0S0\0X0 X0#L3RX000 3 ?%KX00 0$KX0 0 0$KX05 0#KX00 0#KX0L0(0 0$0 0 0 X0\00S00$0 $0S& X0d00SX0d00SX0d0 0SX0`0@0S X0`00SX0`0<S 00 0 0S 0$0 X0S$0S 0S 0m0S$0S0e0S 0S0](0S?#KP@90@@0< 80D D <0c 00P#K P0!K!KRp060H0T P0L L T0C 00|K  !K|0K4000@H0T P0L L T0c 02<߿0  00X嚢0KSH-M  0KH-M 0KH-M 0KH-'% #DTH-HF DDTH-M 00 0 0R 0*00 0 0 S0" 0 0 X400 p R400 0 0 0 0c0C D400 0 0R00K44PH-0M(   (K(Q P 0R! 1 0 1 0 K 0 ( 00S 00 $K 0 ( K|0S $00 0S 0S 0S x0SСΡ0K 0 0!Kġ¡(0(0 K 0KH-iДH-ДH-!M K 0  00S0?K0T 0S 22 K( 00KH-2H-YH-M 000 0Sll+ h00SXL, H00!S R @,  10(0 ^( 1!002!P`N( 1!0 K0 0SA ?K40P 㠛0S ?K400 㗛0S ?K40 ㎛0S'0pK048#8 0"K(2 0!K0202@ 0 0$ $ 0c 00  0l0(00(0 ( 80!0 0QP0KЫܫH-0 00T(H- 00TH-cMM@ @6!P`0c>K0C0C@ 00S0c>K0C0C80 80\5,80\5#408 80\5#848#8 80\5#< 1RF8000,8000#408 8000#848#8 8000#<04 0#K80$0,80$0#408 80$0#848#8 80$0#<0 0"K@6@6@00, (04 4 ,0c 00  00(80\%0R"80004 0"K80$0 0!K@6@6@ 0 0$ $ 0c 00  000KTH-bMM0 06!P`0b>K0C0C0 0Y0S0b>K0C0C(0 (0\5,(0\5#408 (0\5#848#8 (0\5#<0"S !S !SF(000,(000#408 (000#848#8 (000#<04 0"K(0$0,(0$0#408 (0$0#848#8 (0$0#<0 0!K0606@ 0 0$ $ 0c 00  0 0.(0\5 S S S6<߿ "(0004 0"K(0$0 0!K0606@ 0 0$ $ 0c 00  000KV#P H- ,*@XH- PNX@K-M0 02 0R0K 0 0 00S0," 4R (24 0"K3K "K0202@(0$  0, , $0c 00  00,2,,2#408 ,2#848#8 ,2#< <3R(2,(2#408 (2#848#8 (2#<04 0"K2pK ̠  2K "D@#T 0 0HB PR )~K@ mK`F@Pt2pK "h`#x 0 0Ġx | =K @P(2`K "# 0  0ppr t '.KB1@K PlR `hb lr'4h ̠` `"0`2 l2S0~!K Ћ/H- M 0S 0嘾0!P0%0K0 0l_0S00@0 0 0 0   0<0 40R000K0.0[KDPWEVH-M 0!/ 0 0  4M00 0S!  0 0 0  0S 0,ブ 0@00  0W000E000V0000}0000    0 X Y Z [ 0!0(")"*", + 0P0 0,"-".", / 0L0 00"8<߿1"2", 3 0H0 04"5"6", 7 0P0 L  08"9":", ; 0P0 L  H  0<"=">", ? 0  H  I 0  J K 0 L M 0 N O 0 P Q R S 0 T U V W  0W000E000V0000}0000 0 0 C0 0"$("( 00KXPH-M 000 00PB00 0S0 00 0 0,㬔0K萕H-M 00ᶕKH-HM8 80000 88004 K  0]0S00 40,40ᓕ00@0,0 0(0 (0 C,0   "000<0S (0C, 0 00S (0 C,0      "000<0 0!K(0 C,0      "000<0(0 C,0   Ġ Ƞ"0 00<000C 0!K!K !K 8 g0$0 $0S; $0@0 0 (0C, 0 0 0 $0( 0 $00 $08 $00+0 0 0S 8$ 0S000K 0[0#0S(00(0 (0S+00KH- M 00 K  9<߿ 0\0S# 00 0@0 0 00S 0   0<0 @0R000 0,h0|KWEVH- M 00 0S000#03夻 00S # 3囻 000 0@00 00S 00 ֓0 0 q  '00 0Se 0@00 0C0 00 0C0!0  !  !  ! "00   0C0"0  ! ! ! "00   00 00 0 0S08#808#(0"$("(  0 0"$("( 0'0 ,Y[0S 00ᠽ00K舯PVtWH-(M    t0 0 0S$ 0S "00 0 @ 0S 0 0  0  0  0 @ 0 c0KH-,M 0@ 04 08 0 0"  00 0S0 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0KH-M 0S@@n/<0S0S 0@0BK謯P\H-M  0@00 0 8 0S0 00%0S 0 0 0KH-M   0S 00@0S 000Sv/00@00 0S S S0  00S 0 0  0 0S 0  :<߿ 0  0K謯PDدH-M  0S 0Ĺ0@0Sxht h0廹0@00 0S S S00000 00K謯P,- M  0S 03b0S 00Ћ/- M 0Ћ/- M  0 0Ћ/H-0M( (0 0 0$K ( 0Z$0K_0KH-M  0000  N0S 0@ )0KH-M 000s 00 0 00 00 0S0 0 0 00 0 0S@ 0K H- M 00 0S 000S&.00000 0 0  0 0 0S   0S s00K舯P_H-M $Z0S000K@H-M0K@Z00 0S $$$ $0嬸!KK@LPvH-M0K@Z00 0S $$$ $0呸!KK@LPvܰH-萕H-D萕H-M 800  0 ሐ0S00K蘱-M 00S 00S 00 000 0 S  S S  S  S000S0000S 00Ћ/H-(M 0Sxx t2( 0!P00K0  0X0S000 0!1408#(1Rg00 0 0  1 00S000  1 00S  1 00SF 00 0 0S;<߿0S0q0S90 0  1 00S/ 00 0 0S00S 00S00S00S 00 0S 000 3/0S0f00V0KU H-M 0S 0zx0 0 0S ׿00 0S .00 0  0K6H-M 00L00 0S00 00 0K蠕H-M 0S00V/,0/000 K-M   000 0S0S  0 00Ћ/-M  000 0S000Ћ/- M  0S00Ћ/- M 00 00#3040Ћ/- M 00Ћ/- M 00?00CЋ/0H- (M( , 0 ,0SLLL!L1島00S<,8!,1嫶00 ?"K00 ?!K00 ?!K"KP@ 0'!KRP 0 ,00 ?$ $B 00K,00 ? B 0 0K 0 K0$8H-(M0 4 #K00S!1O0S!1G40S00H040 4004   ?Ki 0"K400 ?K` 0400 ?W"K400 ?KP!K"KP/ 0"K4000C ?"K4000C ?!K"KO_ "0#P 0 0 "0# R0 0 $ [0  [(0<,!d`(0Ct030000 <<߿ 0 Kx8H-M   0Sddd d0ǵ0STDs/D0念0 00  0KhDH-M   0Sddd d0垵0STDP D0喵0 00  0K\DH-M  !K0S||| |0t 0Sl\.\0l 0   0<0!K 0KLDH-M  !K0S 0E 0S|lx l0= !K 0 Ġ  Ƞ 0<00C 0 0K@DH- M $ 0SDD~/@1 00S, (!1 0@0S !0 0@0 0 0$0S0/ 000 0$0 0$  0!K 0$0 0$ 6 0!K!K 0$0!KQP 0 !K 0$0!KQP 00KX h|H-M  00 0Stt!.p0宴s0S 0S0 00 0S0KH-8M0 4 3,K00 40S"2~00S/2v000S"2m0000St"t2c0000!/ 0 0 P,L",2Q0000!0ᱼ00 0S0u0080Si 00 00  '0!K 0 00800Ꮜ0S00 000  '0!K 00S0SE 00 0  00S: 000 000400 000 00040 0 0S$0?S! 0S 0S40  40  00000 =<߿ ? 040 00 哌0Kط$'Xh)*+H-M  0S )9屳0@0S )8娳0S(8堳0@00 0$0S0&0$0!00 0 ?)K0 ?)K0 ?(K0$0 (KK(K P0'K0$0%00 0 ?'K0 ?&K0 ?&K0$0!%KK&K P0%K)KR&KR@ )KPP&KP`0)KKPp0K 0 0@,@ 00KRP0'KP`0'Kp0 0$KL0;H0 0L0 K 0 0$K'KKP%KKP@00l h 0l b0p0  0t t 0C 0 0 P0$K$KP0ix0l h |0|l b0P0  0T T 0C 0 0 P0$K 0#K80D @0< < D0c 00xlh||l@PP TTa TSR 0#KPp0 #K P0)KP@0< 80  <0c 00K P0)Kዻ 0#K#&KPpp0< 80t t <0C 00K P0&Kl 0#KD @# 32#KPP0#K?P`0000"#KK 0"KK#KE 0"K#K!K"KPp0"KP0!KP@0!K?PP0~K 0 0$ $b 00> <߿K 0B 00K%KQPK 0 0'K0$  0  $0c 00 K 0B 00K(KQP 0.p0$  0t t $0c 00K 0B 00K%KQP 0 , 0 $ 0  0 0KX|$>H-M  0S<<$00$0" K4 0$0S% 0$0 00 0$0$0!QP 0 0 ' 0$0$0"QP 0 0 0KDO(XH-M   0SG.1Q0Sx!t1I00ShTd!P1@0 0  0 0 c0" " ", 0!0 " "",  00  000! 0 0 0KDqr0H- HM@ $K@0Sddd"d2ڬ@0SL<H"<2Ь0S40"2Ȭ@0!"K@00, K $KM0S0o,00 0o?0@  0U0100U00100 0o?0$K0SH 0000@70(0 (0S1 @0(00!(B(@TP 00 0S' 80K(0s?08 KK  (00!(@w0S @0 0 $K᙮00 ,0 0 K0سH-"M K 2S 0-2 0KK M0S 2/K,Ƀ2݄?Ko?0@ ^L00K2K$ 0 K K0KUH-(M 0S 0 0 0 0K  00 0S A&<߿ 0! 0 0! 0KжH-M0Ku00 0s0 0KH-(M 0S"2孫 00S"2夫 00 K  0L0S00 0 00S  0,ك 0 K 5 0!  1<0S 0""", ! 0o?0@ 㫃 0U0100U00100 $ 00 0S 0o?0  B"0 0C0S* 040S 90S# 000 0S 0 0   0f00 00S0 00Э00σ0KĶH-(M    0 0 0S6 0S( (L00 0 @ 0S# 0 $ 0| 0  0  0 0 0  0  0  0   0 @ 0 {0KH-,M 0@ 04 08 0 0"  00 0S0X 00 00 0@00 0@00 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0$0S% 8Ȳ0 0$ 0$0S00$ 0$0@0$ 0$0 00$0$0##0KH-M 0S\\\ \0-0S 0@00 0$00@0KXeH-M  0@00 0 8 00S 0S 00 0S 00W0S 0  0400S 0 0 0  0 B%<߿  0  00S 0 0 00 0S 00S 00'S 00S 0 000S 0q 00 0S 0 000S 0 000S 0A 00S0| 00P0S00S 00 000 00S 0000 0 q00ʁ0S00S 0 0 000 00S 0000 0 P00D婁0S 000塁0S0 00 00S 0000 0 -00冁0S 00~0S0P 00r0S0@ 000S 0} 0| 0K - M 0 0  0  0  0  0 Ћ/H- M  0S#3Ȩ0@0S"2忨00S"2嶨0@00 000 00C S񟗟XPP8tPؖPPP040S@X"{00  080X0~0  0S0v|0 0  0R <0S   e0 0 0S0U 0S k0  080 0F 0S \0  08007 0S M0  0800(0  0800 0S 40  0800 0S %0  08000KX|h H-M  0Sb. 10@0S 00@00 00C S+XC0<߿4p|d040S000000 00 0 00 0000000KXt|!- M  0S 0#P00S 0S 040S0000Ћ/FH-M   0 0 d 0S0 00 x00 V0K0H- 0M0 4 8 <0 4004   ?"K80S<0j<0S80e80 "K| 00$0 <0 "Kr 00 0 $  0R%80400 ?c 0400 ?Z@P<0400 ?Q 0400 ?HT"00!80 00cS0c ?!K00!<0 00cS0c ?!KK!KP<808<0 K00H- M  00 0 00   ?!K4K!K  00S0vDK!K  00S0j0S- 0!KP0_0 0!K P0dK  !K0S0K0! BTK 0S*09 0"KP!K 0!K 0!K P0dK  !Kp0S0 0"K   0b0S0 0"4PKD@KdKK  00 K00H- M  0 00 0 00   ?!K0!S R+0!K00 ?!K4K 0 !KL0S0\DK!K  0@0S0P0S dK 0  !K0S0@0! BTK 0S0. 0!K P0dK  !K0S0 0"K   0D*<߿ 0S0 0"4PKD@KdKK  0 0 K00H- Mp t 'Kp0,0 p00(0 t00t   ?"K,0S!1娥<K"K 'K0S0XLK"K  00S0L0S ,0!,lK (}0S,0;,0 0 0"K! 0!K,0!KP 0 0!K,0"KP0lK!K (!KR0S0(0" $0"?KH00H!00 0SA 00q 08 $0 00 A0/K s0S ㋴000 0 H H0S000K {0[0#0S !$00$0 $0S 0S H0HY0K,̸ܼDA H-M  0@00 0400S HH.D1Z0"00"0#4080"0#848#80"0#<0 0 0!00!0#4080!0#848#80!0#<0 0 00,00#408 00#848#8 00#<0 0 K谹̸ȼH-M  0@00 0400S   ! 100,00#408 00#848#8 00#<0 0 J?<߿0!00!0#4080!0#848#80!0#<0 0 0 r 00 qK̸ܹH-M( (20 0 0S$$$%$5壙(b">K,q5 2 0408#80C8#848#( 0408#80C8#8#48#808#8 4 K 0008#80C8#848#( 0008#80C8#8#48#808#8 84 K 080S 080(00 0".K p 0K(20H08#848#((20H08#8#48#808#(t3 K (20L08#848#((20L08#8#48#808#( 3 K (20P08#848#((20P08#8#48#808#(2 K (20!8#848#(20!8#8#48#808#(x2 K 00 00(ጵ00 0S  0001 ">KN?0j000 0S(20"0(20"0#408(20"0#848#8(20"0#<0p0 0l0 4h0 00 00(L00 0S 0"">KH00000 0S0(0 ">K0L">K0#408@">K0#848#8@">K0#<0(0 ">K(,80S (20$0S 00K,̸ A H-(M    0 0 0S0 0S 0 @ 0(㚠 0@ 0@00 0S 0S00 00 T0 o 0"04 0 0  0K(H-,M 0@00 0@ 04 08 0 0"  ឰ00 0S- 00 00 孱0S0 @ 0K*<߿ !C 0@ 0@00 0S 0 0 0 00:o0 0 0幰0KH-M z0S 0@0S,,, ,0姗0@0hp困K̸NH-M  0@00 0 8 040S0 0040S00S 008o0S0 0 0K$H-M   0000 0S S S. D040S 0S @!30:0S 0000 40/040S 0S @ 0#0S 0000 00040S 0S @P 0 0S 0000 8000K(X-M  0000 0S S S 04 000R0000 000R0008 000R000Ћ/- M  00CS00Ћ/H-M  0@00 040S 00 n0 @ 0嗛K贺-M 0@00 00Ћ/H-0M( (0$K 0 0㌻0S0$0Kk0KH-0M( (0(00 0 0$K   0l0S0$0Kl0KH-M  0S 0[040S000000  J0S 0@ %0K̸| H-M 000s 0L0004000S 00 00徲0S0 0 02000 0Sڸ 00400S 0 0 00 0 S 00嗲0S0 0 0 000 0S@ ƚ0L0<߿KT̸+dX- M 0Ћ/- M  0 0Ћ/H-0M 0S!1嵕 厱00 0S 0! 00 00 0 0  Ϯ00 0S 000 0  :0S000K m0[S 00Kt̸WPH-M $=70S000K輸H-M0K@s700 0S $$$ $0S!KK輸̸s0H-M0K@r700 0S $$$ $08!KK輸̸sH-Ĥ谕H-谕-M   00 @0 0   0000# 80!$4@" 00 0 0R:0K/H-MK!KK!K 0 0!K 0K- M 0!0Ћ/- M \0Ћ/H- M @00cKH-M a'00 0 0 0\"]"^", _ 0KH-M 00 0 l0\ ] ^ _0<0@0 l0K0H- M  00 0S 0i0 l0\ ] ^ _0<0Pv 0@z0 k0 K0N H-M 0S! 0\ ] ^ _0<0SXXW/T0)0\ ] ^ _0<0llK 0H- M  0S!10\ ] ^ _0<0S 000 0R00 0S00 kM%<߿  0P0\ ] ^ _0<0@0 wk0 K08e fH-M 00 0Sc/0屓00,00#408 00#848#8 00#< 0 0048#(00#48#808#(0 0048#(00#48#808#(0 KDH-M    L00KH-M   0S 0\0Si/0T=00 0S00   0<0 0 k0KT8H-MK0K0 Rk0KH-M 0So/00!1408#(x0R 000  T0 00S0000 0S0K`UH-(M 00 00 0S"2ڒ 0"P0q 0300  0  0Ȕ0S 0 0 0 幔0S# 0 100 0  Ġ  Ƞ  ̠   Ġ  Ƞ 0<00 QP00 OkE0S0#0K0  0a30S00 0 0S0S  00T P00 0S0 0 0%k 0KEFI PARTTl0H- (M( (p0$0 $0SQ 4㭚0 0 $0  $00SB (0! i 0 0 0!K(0 0@P@P(0! S 0 T0!K K!KP 0 0 (!K 0 ,, ! " # 0$0 0$0<$0$j0 K0pH-$M( (000 0 0S0e(0N&<߿ 00 000 (0 0   @  0<0P0`d`h`l`d`h0<0  0ᛶ0 ! " #0<0 0 "!""", #  0$$ 0 )i 0KpH-M Q001j#KH-0M $ ( 000 $0T U V W0<00 0 ! " #0<0 (0 (00 00!< 000 00!c 00 0Pi0 0@ 00!0 ၙ0 0 0S01 0$0H I J K L M N O0<0 0 0S si000 imi0  0 0KH- M  0K j0 0 0S00 O00 0X Y Z [0<0 0R00  0 vi0KH-K0C0C 0g0S B>K0C0CC0S 0400`"j0S0(0 (0"B>K0C0C<0 0 o0S0  0!K0  0 K!K K 0 ~00 0Sz 0@00 0SY/1ke 00$ 00 0 00}0S0000 0S0KH-M 0S 0`00S,0v`000s 05z0St`p `0f`00 00 000S@4 =e00KH-(M 00 0S   ! 1;`00S 02`0000 00D0  @  ? KK 0 0  Iy00 0S  庀0Sy00Kd- M 0Ћ/- M  0 0Ћ/g<߿H-M $0S000KH-M0K@00 0S $$ - 0_!KKH-M0K@00 0S $$ - 0_!KKH-1oH-XoH-(M  0 0P+ 0{_00!0g00 0S0 7  00 0 00! 00c  70 0  0a00 80K<H- M !K0!0 g00 0S\\D X02_ !K2a0S70 0  0KH<H- M !K 0 00!K0K0H- 8M0 #K00! P@[ 1^00! %h 0"K"Kh 0"K 0!K (0 0, , 0C 00K 0K0a0S08K 0 0!KK"KPP(0 0, , 0C 00 P0!K!KP (0 0, , 0C 00K 0K0$`00 K0T<\-0 @ BRн d @ P @ < @ ( @0 0@0K/xH-P0S'S%0@-TT t00010` 0R 060S 0001 000x`H-(M  6000 0S0.0"0!QP 00!!@t b00!0 QP 00 !@ b00KtH-M  z60h<߿|00 0S00  0KH-M  `60b00 0S00! 0KH-M 800 E60 50S00KH-M   060 0 0R 0 0 00 0 00  000   0RK-M 00 0 000   00 0Ћ/- M 0 S S S S S x S s h S \0 X0 T0P0L0H0D0@0Ћ/GESLTOOBDHSFBDABKSDRTRAP $,4H-M  e00 0S00  0  0KH-M 0 0  000 50 0 0SK-M  00 0 0R0000 0S0Ћ/-M 00 00,00#408 00#848#8 00#<00 000,000#408 000#848#8 000#<00 0 S<0 0 0 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0R0Ћ/0H- M 00,00#408 00#848#8 00#<@z00cL00,00#408 00#848#8 00#<Pa00c#408@00,00#408 00#848#8 00#<PE00c#848#8@00,00#408 00#848#8 00#<P(00c#<0 0 K0H- M  !K 0  !K]0S0Z0S 00, 00#408 00i<߿ #848#8 00#<00S0; 0S5 00, 00#408 00#848#8 00#<0O!K ap p0`0S @S0 , 0  !K]0S0 0 0K@$H-M  `00 0 0 ) 0 ?x0S 00,00#408 00#848#8 00#< H0RO 0 00 0 0SD0KKSDRH-M 0Sttt t0@[0!0c0 0 0S0  00 30s00KtOH- M 0SXXX&X6[ 0D0 @  ?!K 0m00 0S0}00!0ec 0 00S30l000 00!P%5Z00!0 (30p% 0! 0 00!000!0#40800!0#848#800!0#< 0 0  0  0  0 0 $ 0 ( 0<0, 0<0#408 0<0#848#8 0<0#< 0@ 0D0, 0D0#408 0D0#848#8 0D0#< 0D 0@0, 0@0#408 0@0#848#8 0@0#< 0H 0 L 0<0, 0<0#408 0<0#848#8 0<0#< 0P 0<0, 0<0#408 0<0#848#8 0<0#< 0` 0<0, 0<0#408 0<0#848#8 0<0#< 0d 0 h !KDc 000 0 0 0C0 0 0,0#408 0#848#8 0#< 0 0, 0#408 0#848#8 0#< 0 0<00Cj<߿ , 0<00C#408 0<00C#848#8 0<00C#< 0 0,0#408 0#848#8 0#< 0 0 0 00 0 00 00 00t 00\ 00D 00Kta oRDSKH-M 0S 0nY00Sk/0eY00St t0\Y000 00dk00 0S000 0 ,00KH-M 0SPPo/L0.Y00S8,4 (0%Y001kK-M   00 0!00 0R0 000  0R:0!00  0Ћ/0H- %MH H2Sw/6XH20S&6XH20!/ 0 0 &6XH20Sd|&`6XH20@0 H20@.0s@@&@6]0H2 @0@0@0@0#408@0@0#848#8@0@0#<0<0H2 @0H0@0H0#408@0H0#848#8@0H0#<0@0H2 @0D0@0D0#408@0D0#848#8@0D0#<0D0@0H0,@0H0#408 @0H0#848#8 @0H0#<0@0D0,@0D0#408 @0D0#848#8 @0D0#<0 0 B 0 0#K#KHzH20!0`0<0 <0S00,0 , 3! PK 0 ,00,0 ,0S0,0 @00,@00#408 @00#848#8 @00#<080 ,0 -K8 0SH2<80 00S<00<00,<00#40k <߿8 <00#848#8 <00#<0 0404B 00"K"K<00,<00#408 <00#848#8 <00#<0 0 0404B 00 0!K"K !K H p0(0 (0S<O00V(0@0<,0/(0, 0 (0 4 (000_ (08 (00ቄ00 0S08H( x0S00 0KG 0[0#0S (p<00",00,0 <00,<00#408 <00#848#8 <00#<080 ,0S80s6</0 K0,H-(M   0 0S$$$#$3W00S #3 W0 0 K 0!000s K a"2[0@S000 0 K0S000,00#408 00#848#8 00#< 0R 00,00#408 00#848#8 00#<0Q00 K @!1[0Y 0!00 00,00#408 00#848#8 00#< (1R0H0,0H0#408 0H0#848#8 0H0#<0  P0S000,00#408 00#848#8 00#<0 0 KK 0QPK0K67`DHSFGESL-M   00 000 0!00 0R 0!000s0Ћ/H-M  r00 r00 0S o0S 0K0H- `M` `0S  -;U`00S +;U`00S| hx+d;U`00!0I^0X0 X0l<߿ S0`00XH0$0 $0s0$0 <0 `0 0 000@-)0S0,! 200!)0S0! &00)0S0 00 )0S0 00(0S0 0 0Ko,<LNXEXTSWPFAT FATHFSJFSNTFS$RFS0SUFS8HUFS@XFSH-M   0Sxxx!x1cP0@0SdT`!T1ZP0@00 00CSELLL 0S 00$0 00$0 000S 00$0 00$0 0 0S 00#0 00#0 00S 00#0 00#0 00K<H-M  0S 0O0@0S 0O0@00 00CSDD$o<߿ 4004 0040030030K<- M  0S 03r0S 00Ћ/H-M  0S\\>.X0O0@0SD8@ 40O0@00 0$0 K<H-M 0S\\\ \0}O0@0SH8/80tO0@00 0$00K<H-M 00D0  @  ? K K}0K0H- hM` `000 0D0 @  ?!K,K!K  0Z}0S0/<K!K  0N}0S0#0. B0 0\K . 0t0S00",PK<@K\K\K  0[x0 K0H-M  0S 0N00Stdp d0N000  g0S 0@( S0KDH-M 0S 0N00S 0N000s 00 0 00 Nk00 0S0 0 0 00 0 0S@( |S0K'(xH- M 00 0S 0}N00S 0tN00`{00 0 . 0  g0 0 0S   o0S g:y05y0KCpD- M 0Ћ/- M  0 0Ћ/H-M $0S000KlH-M0K@,00 0S $$$ $0 N!KKlhLH-M0K@+00 0S $$$ $0M!KKlh0H-}]H-p0<߿]H-M 800 k&0 %0S00K8-M 0 0 00K 0 0[0"0K 00 0 0?0 S0 [ ! [ !Ћ/-M 0?0 0 00K 0 0[0"0K 00C 0 0 R*0[S00Ћ/H- M 0S 1xM0K0 0V0S0/0 0 00 0!1408#848#( 01408#8#48#808#(d0R 00 0S00 @, 'R0&0KHT8\0H- 0M( (0H00 00   ?!K!K 6M(_0$0 $0S {U $0 $00S $000 00@_(0"!K1V 0UT  5L(0"!Kz 0 00 0 ,2% 00%00100A001 0 ! !008#848#(008#8#48#808#( 0"$("( ! 0  !  ! 0 !  ! 0 ! !008#848#(008#8#48#808#( 0"$("( !008#848#(008#8#48#808#( 0"$("( !(0"!KU 08#848#H(0"!KU 08#8#48#808#( 0"$("( ! 0`000 0000!00000000 0  0  0 0 ! ! ! !0 00 0#4080 0#848#80 0#< 0""", ! ! 01408#848# 014q%<߿ 08#8#48#808#8 01408#848# 01408#8#48#808#8 01408#848# 0A1408#8#48#808#8 0A1408#848#H 0Q1408#8#48#808#80 0# $0$9^0 K0T,H-M 000 00H]00 0S000 0 /#0KH-M 00$^K0H- (M  000 0!1408#848#(01408#8#48#808#8 0D0R!0!1408#848#(01408#8#48#808#8 0@0R0 H0< 0!1408#848#(01408#8#48#808#8S  01408#848#01408#8#48#808#8S0001408#848#01408#8#48#808#8S00S00!1408#848#(01408#8#48#808#8 0P0R0!1408#848#(01408#8#48#808#8 0L0R 0H0L0P0!1408#848#(01408#8#48#808#80!1408#848#(0A1408#8#48#808#8 0A1408#848#H0Q1408#8#48#808#8 0`! 0O0@S0h0!1408#848#(01408#8#48#808#8 0P 0!1408#848#(01408#8#48#808#8 0L 0!1408#84r&<߿ 8#(01408#8#48#808#8 0H 0P0 L  H  ?P 00`( N0 S 00 K00H- XMP P0S )9IP00S )9IP00S )9IP00@0 PkkP00H K  0f0SF @000 H0,%!H09"P'0S7 P00P0P  L  ?"KP00H0 ?$ $B 00@ 0<0 < 07    !000<0< 07  A@ Ġ A@ Ƞ !0 00<0#408< 07  A@ Ġ A@ Ƞ !0 00<0#848#8< 07  A@ Ġ A@ Ƞ !0 00<0#<0S <0 "0 00S <0 "0 00Sw < 07 !000<0< 07  Ġ Ƞ!0 00<0#408< 07  Ġ Ƞ!0 00<0#848#8< 07  Ġ Ƞ!0 00<0#<0 0$ $B 00"K"K< 07    !000<0< 07   Ġ  Ƞ !0 00<0#408< 07   s3<߿ Ġ  Ƞ !0 00<0#848#8< 07   Ġ  Ƞ !0 00<0#<0"K 0 0#K"K #K P `080 80S^ 80@0D0 <0 "0 0 D0 D00S  D0 D00S  D0 D00S  D0 D00S  D0 <0 800 800O 808 800st00 0S# P8 h0S00 0K3r 0[0#0S<00<0 <0S0 0 K0T= >?H-M  0 0 00S" 0!1408#848#( 01408#8#48#808#(80R000 00,0K0H- 0M0 00S(8F000Sxht(h8F000( K  00S0(000S(000000 00$0 $0o?@ $00 00 G000Lc00 0Sf0Sc0$ "0 0  $07 !00 0 00 0#4080 0#848#80 0#<$07  !  !  ! !00   0S 0@0 0 0  $"00 @0000P00  L  ?PO 00\0000P00  L  ?@O 00#408P0000P00  L  ?-O 00#848#8P0000P00  L  ?O 00#<$07 t)<߿  ! ! ! !00   0"0!00c00"0!0 0c0#4080"0!0 0c0#848#80"0!0 0c0#<$07  !  !  ! !00   000 0S000H0S000H0 `" 0 0$0R 0$ 00R t  0$ 00R 0 0  00 0 0 p0R 00!t0000-S 00!t00000S 0 0$ 0 p0R0 00!t0000S$ 00 0 0 0$0R 0$ 00R t m 0 0$0R 0 0 0p $ 0p  0 p0R  0 0$0R 0 0 0 00!t0000-S  00!t00000S 00S0 00 t    0 0 00!t00 |0S 00t00000-S000 0 |0S 00!t00000-S 0S 00!t00000S  00!t00000x:0S0T0 0P0 0L0 0H0 0D0 00`0 `00`0 `00S `00=S`  000c\0 |0X0 0@0 IX0 00\ 0S8X000 \0RX0T0 @0D0 0L0 2T0SX0T0 @0D0 0ST0 X00R T0 X00RT0 X0 0R 0<0 <0X  <0P  <0P0 X00X0 @00@0 X00SP0S_ L0S\d0S> T0l0 P0h0 l0KP0 <;t0 00t000 ;*P000 P00P0 P0S:080 80H0S 80 800R*800  80  8z<<߿ 8Q 0@ 00l0 0 00 0 0  ?0P0040 P40P0 P0ST0S D0@0 00 0 `00SB T00S `0 0 qd0S& 000C!t00000-S L9t0 T00$9t0 000Ct0000T 0@ 00 0 0 T0 0 ?0T00S3 0 p0R 00 t    0 !d0S 88t0 T00N 0@ 000 0 T0 0 x00:S:0?0V 0@ 000 0 0S 0@  T00S T00T  0;T0 080S 00!t00000-S 000x0S4d0S$ 00!t00000-S 6t0 006t0 00t0000 < 04& 00 0 0  ?0 00 - K 0 -0[xc0,0 000S 00 0 ,0S -0[:S -0[;Sd0S 5t0 -0[d- [ 0 ?0,00WS],000;SX0 0 00 00 00 000S 0 0 00 0 ) 0 p0Rd0S 4t0 -0[o- [ 0 x00:S:0-0K?0-0K-0[ 00 t    0 0 0(0 0(  (00(0 (00S (00=S|0$0 00 F$0 0 ( 000c G0S1(  000c@$000T$0 0 00 00 ( 0S$0 0 00 0S 0 $00R  0 $00R 0 $0 0R 00 $00$0 000 $00S0S 0Sd0S 2t0 0 0{)<߿ \ 0@ 00n0 0 00 0 ?0 0S 00 (00S 00S (0 0 Nd0S 1t0 00 0@ 00?0 0 ?0 00S/ 0 p0R 00 t    0 d0S 1t0 00 0@ 000 0 x00:S:0?0 0 0@ 000 0 0S 0  00S 00  0r@p$Hx 0 0` 0  W0[,000:SU,000:S 000S 0 0 00 0  0 0  : 000S 0 0 00 0 ( 0 p0Rd0S 1t0 -0[ - [ 0 x00:S:0-0K?0-0K 00 t    0 0  -0[KH-(M   0 0 0 0 0 0000h00 0 0 000 <0 00 ,0 ,0 0 0 0K(d,$0H- M   000000  00KH- M   0 000000  00KH- M   0 0000000 0  00KH- M   0 000000  0w0KH- M   0 0000000 0  0V0KH-M y00 (0 $0R0  0K4H-M 00 (0 $0R0  0K4H-(0 0$0 T00K00KO0S `00P000[0#0S 0(0 , D0R*@ ,00(  ,00,0 (00(0 (00S00K0(0 ( 0$0 0000K0[0#0S , D0R*@ ,00' ,00,0 T=(0 0$0 00K, 000 <00K0[S $0S 0 $0 L0RH 000($ \ 0S0[Sk00KH 00000K0[~S񟗝mqqqqqqoooopooqqqqqqqqqqqqqqqqqqpppppupppppuuuuuuuuuuuuuuuupppp nquuuuuuuuuuuuuuuuuuuuuuuuuup pupupuuuuuuuuuuuuuuuuuuuuuuuuuuhpphpp0[S< 0[S, D0R*@ ,00\ ,00,0 00 L0R%*00 H000/S00 H0009S, D0R*@ ,000 ,00,0 , D0R*@ ,000 ,00,0 000K000S N0S S 0[S00S 00 L0R*00 H000?S00 H000!0CS #80S 0[Su00 H0000K00000 , D0R*@ ,00? ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00" ,00,0 , D0R*@ ,00? ,00,0 a00K"b00Kf00Kn00Kr00Kt00K ~%<߿ v00K0[0K0[S 0[S $0S0S0[S0[Ss 0[0KL0sH000S000L0S000S`00S_0S^0[S] 0S[0[S, D0R*@ ,00' ,00,0 , D0R*@ ,00\ ,00,0 , D0R*@ ,00' ,00,0 40[S 00 6 0[000@0S000K80K 00 00KL0sH 0L0 0 0 H00 00L  c<K80K 00 0Sn 0s00Kk0s00K000 0 0 L0R[*0 0 H000SS0[S: 0S70 0 00 0 0 H000[0C!S!xxsxsxsssssssssssssssssssssssssssx 00 0 0R:<00S00K 000 80K 0S 0S0[S 0[0#0S 0 000 0[S9 0[0#0S4 0[S, D0R*@ ,00\ ,00,0 , D0R*@ ,00 ["# 0  ,00,0 , D0R *@ ,0 0[1000000,00,0 0[0000K0[S , D0R*@ ,00\ ,00,0 00K00 0R_*, D0R*@ ,00 [ ,00,0 00000 H 00000K 0[0#0S 0[0#0S 0S 0[20! 00 0[030S0[0#0S0[Sz, D0R*@ ,00\ ,00,0 , D0R*@ ,00 [ ,00,0 00000 L0s H 0000S000 ptxQ80 L0R000S,0S0S0[S9(0S 0[0<߿0#0S , D0R*@ ,00(  ,00,0 (00(0 (00S, D0R*@ ,00 ,0# 00 0000 000@DH L00KH-8M  $0 0S 000 00 0 0000( 0,0 0 $000 0  0KH-M     00KH-@M $ ( ,0 ,0S ,0 10 000 0 (0S0000 000( 0,0 0 $0H00 0 00 000( 0,0 0  $0.0  (0S 0 C(0 0KH-M00 0 00 0! 000000 00 R: 0 l0R 00T0, H0@  80R 0 0 KD8<H-TM8 < @ D0 B0000 80,0 p20(0 80SX2 ,0R4,00$0 ( 82R000K$0s0[S 0(0$ !?0(0 1(  0[S (0!10!(0 10$0c1 |1$  80!(0000 80!(0000 D0000 D0D0D0( D0,0 0< @0t00  0R+80!(00      0R 80!(0@00 00D0D0D0( D0,0 0< @0B00  0KD8<H-M    0F0KH-M     060KH-M 0KH-M   0K0<߿H-@M8 < @ 40K<40K8@ 0KH-@M8 < @ D0 40K<40K8@D 0KH-M   0KH-M    00KH-@M8 < 0=0KX04K4 K=0[ 40K8< 0KH-M 0 0K 0[ 0KH-M :0KH-M   : 0KH-M   0 00  00KH-@M8 < @ D0 T04K40K<@ 40K8D c0KH-M    00KH-M   0 00 00KH-Mx | x00 0S 0 Cx000/S t0Kx;0Sl0 0x| 0KH-M  0S00 00 0S00 00 0KH-M   90KH-M  0 0 0S00: S 200 0 C000/S0 0 0KpH-4M  $0 0S ,4$    0z 4 $0s#3n 00 S$(Dh4 <00 T0 000tK0 000D>0 000 -0 000 0 000  T0 000@ @ %<߿ i0 000P @P@ dH0 000` P@ `P@ #0 000` P@ `P@ DwKp| `p<lH- M   0 00 000 0!000S0000 0KH-HM8 < @ D0 00 000 0 S0 + K  + 1K000S00K0008<@ D0K0-H-$M   0 0 00 0KHЍ/H-00x,,, t(00$? m(LH-00 0M$H-M  .0 0R*0 a0KH-M   .0 0R* 0 [0KH-M   000 0S0S@.00 0S00 00 p.0 0R000 00 0  0 !0K說H-M 0KH-M 00 0S0S n0KH-M  0S0S  0  g00 0S 0S O0KH-M    0KH-M 0 i0KH-M  $00 0S!0KH-M  0 0KH-M 000K- M000S$0&<߿ 0 0  Ћ/(0- MK $ !40*"*0@P0>00K0/- MK  ,&  6000Ћ/H-(M( , 9 0 00 0 ,0 ,00S0e,0 00$0 ($)00 0S0S$ / 000 0 0 0 ,00 00 0S 000 ,00+0  03,0  0S,00,0 0#,0 00o0 0 0S 000 ,000  0 ,0  ,0 00 0KH-(M( , 0 0 00 s00 0S0] 0Kj0S0R 00  00 A00 0K0 0S   0S%00 # 0$0 $0S $00,E0S $0K 00  (0R 000 [ 000  g00 0S 0u0K- M 00C6S8강00Ћ/- M 0GS0OS0gS0oS00Ћ/- M 0OS0WS00Ћ/- M 0S0S00Ћ/H-M 0KH-M  0S 0(000S  0(00\0S00@00#00P8 0,0S 0K4H-M 0X00 |0K3<߿0S0l0: S 0 0%K00 0  %K0 0 0  0S 0 S 0@S0GS0S 0S 00S0 0S 0?0S0 00S 00S0 0rS 00S0 0S 00S0 w0^S 00S0 l0pS 00S0 a0S 00S0 T0S 00S0 G0S 00S0 :0bS 00S0 /0S 00S0 $0S 00S0 0S 0 0S0 0 S0 0 0KH-M00s 00'c?K0S 0 00c?Kp.Ke?KfK0S H0 <00 1(14 1 0 00KĖH-MP00s @00 00  (0R  0 00KH-$M 0X00 ,0!,0!0(0S 0& 0R,0!$0 0K 0S 0@00!00,0 L 0R+0 ?!0!!K(h8H-MY00  D0R0  00R $0R00KH-4M0 00X00 0"K00(0Stt/p1)&00!/ 0 0 @4K[ 2 1[0S 1[0S 1[K 0S0|>K0K\tH-M  0X00 0 0 p0Kh c0p0 `0l0 0h0K05020g0K`0d0K0f0K0e0K0c0K0 p0K s0S0 Kp0K0 00K0K 0 Kp0K0 0<<߿0K0K 0 0KH-M   lk 0 Xe 0 00S 00S 0  0KxH-,M( (0X00 ($0Sm 0 0K 0S(0 %(0 %(0@0000`\!0j(0 SB(0S? ($0E08#((0%08#((0%+0 (0 (00S)  K 0K( 0S (0  00 0(0 x0 (~0S ($0 ($0KSK-xM 0K0Sp L$0Sm ,0!0$0 $0S $0 0 0S 0;;S 0 ?!0!!|0: S 0"K0!, 0"0"P 00@ 'A$*>$0"lp 0C@S 00H 0 L 0 P 0 <0H <0 0 00KdK-M  0Kt0Su #0Sr '0S 'ZM 06''\3''00`|!a'0 0 0 S @SL S;"'K ?Ϡ Ϡ 0;0 *K 0d`t 0"0"Ϡ Ϡ 塌 0C@S 00H 0 L 0 P ,0!,0!ddd d01"s0 0 #0#0KhlH-M   \ 0 H 0 00S 00S 00KH-M K0K 0S p 0Kp0?<߿080 K (0b0K(0KH-M 0S```$`4!` *00 0S 0 0 00S * 0X 0X0S 0X0 0 0 0 ( 0 , 0 0 0 4 0 8 0S 0 0S񟗞ꄳԱ\̲x@h$Գj0S0S0S0S~0Sy0St0So0Sjl0SexT0S`q0S\k 0 0Sg " 0 0K 0s\ 0m0S000K00[0#0S= J\0S8CU0S3<0S/6\H0S*/DA0S%(@(!%# 00X0{00uq0K(@Xt0LH-M 0X0 0 0 00 M0X0I00E00A?KH-M 000S 000 0 0 0S0 00 0S 0000 0S0KH- M 0X00 0,0SK0 4 00,p0SA00 80 0 0S8 U0S&  t00 0S0S0S00000T 0$0S 000 0SKaxH-M 0X00 0*<߿ 01 0 00s4Y00X00 00 0 00s0@D00C00P 0$0S 000   H $0 , 0 , 0SL0K- M 0Ћ/H-M 0X00 040S 0000S00)0S0@00000 0B$0S 0KxH-M 040S 0K0H- (M "K 0!/ 0 0  01 0S 0) 000S  0  0X00 0!,(,B 00!K!K00 !K!KQP00 K0cdeH-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K F0sP00O0  pT #00 0@S00S 0K{|l0H- 0M( , #K(0X00 0 0 (0S#3(0!/ 0 0 #3 3R<(0 0S8 (0"000S1 K  0(0B 0 0QP  0 0 (,#K` 0S 0 00$,00(S0S 00(#K0S (0!0 0 (0!0 K 0S&'000(  p"#00 0S SS S @S 0d"0a!10Z0 0 00 0S 0,  0R 00?0S0 0c0 0, *<߿ 0,0 20S@@[00Z0(  p "00 0S SS  S @S 0|0 d" 0u0<D 0 K0l<H-(M $ 0S 0$0S 0 0X0 0 00 0!00 $00 0 0K 0s000  pT E"00 0@S00S 0Km\0H- 0M( , #K(0X0 0 (0!/ 0 0 #30(0,0S (00`# "0 S 00" p3R?(0 0S; (0"000S4 K  0(0B 0 0QP# 0 0 (,#K:0S 0 0(0!0,00(I0S 00(#K0S (0!0 0 (0 4 (0!0$ K |0S&'D00C0(  p!!00 0S SS S @S 0YQ!0V|`x!`10O$0, @$00 0 $0 00  0RF070S0 0c0 $ 00$0 *000(  p L!00 0S SS  S @S 0 !08< 0H K0!ttlO\{H-(M $ "K 0X00 0!K 0SXXX!X1% "K0S 0E04 K 0S 08 0!K)0!K P0 0!0  00 0S 0$ 0S0 0!% 0K 0!KK ?<߿P0!KKhH- M 0X00 0050 0 0S0%?00>0  pp 00 0S SS S @S 0L 0 0K\l\H-M 0S||| |0000S hXd X0w0,0S 0 0S00KPH-M 0Sttt t0R000S `P\ P0I0,0S 0r0S00K@- M0  0K@0 0[0000S   0R00Ћ/H-M /0S 00 0 0 ' ??  0cS000 00S0000S0000 000S 00 0 0S00S00KH-BMM00 !100 0S0[">K g0SO ">K _0S-G2>K0S 1@2>K@0 C1 K 000000S A>K 0C0C A2.KA>K 0C0CA>K 0C0C">K &0S "K` K0K K2K0S 00 0KtH-M d00 0 00 j0S0000 00S0K萖H-M000 0S40A 000S- 000S(0.K 00.K!>K0 00!S 00.S0/ 000 00S>Kv"0 0 0S0KH-t]p[lYhWdU`<<߿S\QXOTMPKLIHGDE@C0 $0<HT`lxH-y0S-H-M0 0 0K V00 0S00KHЍ/H-M  00+00 0S0 00C00S 00C 00 00 0 *0 0S 0 0S 0 0S 0 0 S |0 000C000000S H0D00 008 00 0 0KdH-M 00 0000KH-Mx K 0x00 0S 0*K G>K0C O0SG.K Bt0K_0S K\0K QPK0 ?K 0S>0KtH-MKX K0S D K0S0 K0S 00KH-pMp l0Kp0S 0 \0: S 0$K0KH-M u20S000 0000 0 0S0 00 Y0S00KH-M 0SHHH H000040S00K H-M 0S 0a0S 0040S0<00 0S 0000 0S0K H-(M $ ( 0X00 (00 00 00 $0 0 0 0K  0S00Ki0H- M  0S"200!/ 0 0 TDP"D2o0S000b,0S 300 00 0 000E00 0)<߿ S0f0K #000! B 0 0*K0400S 0"SR,0+0*K 000! B 0 0*K0000 0 K @ 0S 0KT0@ Y0 0K O0S00 0K0 K  `< `0 S000 K03 4 PH-M  0S00K 00 0 0K 0KH-M @000 K 00 0S0S@0! K000 0S@0d 0K 0S00 0Kc 0[S 0S0@0K,t@H-\MX X0SLL.H6X00S4(0&$6D0KX+0S D0@X000T:X000D0D0 X000D0 D0S0_0@0 D00<0 <0S0RD01(080 80S? @540 000 000%40,0 0(0 B(0S 400K00 ,0!<000S"0!<0@00X(000!80@0000!<000S0!8000S00K000 D0 R0[0#0S(00(0 ( ,0R:0(0 X(300 0S{ (00C!<000S](00C!8000SU 0%KX00(00 0S 00 0s L0K  0ST0K 0S @"00s KX00!R 0%KH00!QP"0"%KQP(00C!<00 X0Sr00q00P!(0h3<߿(00(0 D0( Rt0$0 0(0 1(00C!<000S#(00C!8000S $0S D 0100$0 $0S: $0 $F $0 1( (00(0 D0( R$0S0@0 $+0 C$00 X0000` $0j0 S0@0 $B8:<8@0KD '@BrXH-MP00s @00 [00  (0R  0 00K茖H-M 0S000 0S 0S888 80 0S00K -M  00,00#408 00#848#8 00#<0S 0a030C!000,030C000#408 030C000#848#8 030C000#<0S 050 0 00 % 0!000, 0000#408 0000#848#8 0000#<0 00 00 0 0# 0R0S 00Ћ/H-@MH L 0 0 00 00 H0S8 |4H00Sh\9 X4 040$0 $0S@,$,4XH$0S[ $00,$00#408 $00#848#8 $00#<00 $00,$00#408 $00#848#8 $00#<00 0S 000 $00,$00#408 $00#848#8 $00#< $00$00#408$00#848#8$00#<03 0 $ 04p0@0 @0S@h"`2H0H0  @0SH0 @"2t@00,@00#408&<߿  @00#848#8 @00#< L0R\H0 0 ? 00 ? P0#KK 0 0OP 00b "KH0@0"K 0 ? b 0 0 0#K#K   0H0 0 ? @#K0S#K @x d0f @ \0S@ 04 ,0$,04S@%c04,044S@$Y0*, B> @$M040000 ,00$,004S@l$;0 ,004SS00 0408#8, $ ?, 00' ( ) *0<0 ,0@$,0 p$, E>ӀK, 3,044 ?  0 0K 0,x ,0t4",044 0 0,@ , 03, (3 0,F ,004Se00$ % & '0<0, $ 0, 00C D E F0<0 ,0@$,03, $ ?,X ,03, $ ?,4 00, - . /0<0 ,0p$, 0 , 0 , E>ӀK, 1,044 ?  0 0K 0,F , @1, F> P, B>  0,0($,0040(0 ,0(40, 0 tpd(0 ? 0R , 0 TPD(0 ? 00 C,0($,042 ,0,$0K $\8XxHhH-M 0SXXX X0(,q0< 0Z0( 0K6 H-M  0 00 0S\\\'\700L 048#848#(0 "$("(  B>04 ?<߿ 0 0  E>04 ? 08#(0"$("(  044 0 004S0t48#80 #48#800 604 ? 0@P004S"0    504 ? 00 "!""", #  $504 ? 08#(0"$("(  0 ! " # 0  048#(0"$("(  048#(0"$("(  00 0""",  004S0    304 ?; 00$"%"&", ' 0 ( ) 0 * + 0p$0,"-".", /  204 ? 08#(00"$("( 1  d204 ? 08#(02"$("( 3  0<<@00A0040 0) B 0@$0C"D"E", F 0G0p +0R0\ %= 8104 ? 08#(0"$("(  0 $ 0) & 0@$0'"(")", * 0+0t 060d  0U0100U0010KCl L8HhXdpH-M  0 00 0S 00 0  0-0S0004S0 `0  -0S000l-0KT  <߿hH-M  0 0 0 0Si/00 0  ,0S0%0!  1<0 |0R 0!  1<0`@ 00 0@S00K|< HrrAaH-M  0 00 0Sppp p0~0 `0  '-0S000,0K|$ H-M 00 00K000 00/S 0 0  00/S00K0[S 00 00K 00 0 00S0Ћ/H-M 00 0 0  00C 0 0S 0 C000/S 0KH-M  0S 0S00 00 0 0 0 0R 0 00 0 0KH-M s0S000K0S000K!0S000K0[S 0[S 0[SO00 S 0[0#0S E0 00KH- M 00 00 ;0 0 0S0)0S +0  00 0QP ?0S 000 00 0S 0  00 0KH-M `,A00 0S@0 0"SJ(( 0  0K H-M   0 0 0R* 00 00 00C 0 C00 "00 0KH-M   0S0S 0 "020 000  0 0 0S00 0 00S O0 0S 00S00 0}r0  0K H-M  <߿ \0#90 00 0S (0#9 0cf0KC@B0H- M  0@0 ? 0T 1 0$0 ? 00 P@ 1 000 ? B 0 0 0 K0H-M   00 0 00 0S000  B S0KH-8M0 4 8 <0 00 80S80$SS 440S$0K40 0 0 0 8  0"K 0 00R0S 000S 0000S  0"K000S 00"S 000 0S"K< 0 000S ;0 0 0 0000S"K< 0000S 0000DS iS BS  0000BS  00 0 ?0 00 0 000B0C5S񟗍<-..d-.-...-.-..-........@.`........ -X-...-...-.-.........$.,0K00 V,0K00 O00 L,0K 00 D,0K 00 <,0K 00 4,0K 00 ,,0K 00 $,0K 00 ,0K00 ,0K 00 ,0K 00 "K< 00 000 0 0 0 000S 000 "K< 0K0 X d H-M h0 0   00c0 00 0S  00 0R:0KH-M10sZ0K7 1 10s t1 l1<߿ 0S\1000 0S41 00 zh08@0 $0 "00".[08#(08#80"8#88#(0 08#(08#80"8#88#(0  00"C88#(d0 0K 00"00 00C0 0S 00Kp  0H- (M0 4 400 {00 00 000 0S$ 0 0 0 0S 0S000   S   00c0 0 00 00 0S000 0 0 @0P030 0"000000 00 0 40R(0K 00@08#8 0"8#88#(0 000 0 0 @0P(0K030 0"000000 00 0 40R(0K K0H-MMH  00 0S0hC>K0C 0C+*;@0 C>K0C 0C<0 @0Kl J0S0O@00 0 0 C<0 000 08 K 80K .0S*80K00 00S000S000S000S 000S000S H4S H :F0 0 0 0 0R80K'H-PMP T X \0 (60sw00 B. 5 l50 5 50S50 5 03K03K080 040 000 p50S'l5000 S 00S 050}505 4 <0K 0S40S4@ KD0KHKLK0S@08#89#9|$0D0 p4 H0 `4 L X4 L40S<40S(g409#9 $0<߿%30 C3 ,0K, 30R , 30R( 30R3008#89#9t#0t3 d3, K, L30R( 830R ,30 S30 3 3 2, K( 0100 200 ?"K,0 ?` 00K 0"KK? 0"K\0S= \00S9\00 C020 $2 2 20qA?0c 1 11C!? c0100 c1 1 10aA?0c 1 1 1sC?0cx0cX!0810S8410$1@ 10 10 !00 00000S 00 000003K`0 <0K 0@P P0 $ T0 40 X0 0K@    gfffC@B  H- M  0 0 00  9 00 0SB00 S =00S 0S 0S000   S 0S 000S00 0 0c 0 0 00 00 0 0S 0KH-M00 0 0 5 0S( 00 0 0RK H-NM( , 0! 0\0 0 0  600 0S00C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$//SRQPM`-QЍ /SRQPM`-2Ѝ /@-mp@- 0P@Pp@ p0p@- D0`p/@G (0 0&  Ѐ=C-@P`pNT$ 0`Vp 0`C-@P`pT$ 0`Vp 0` *& *Z>>*SJ51:3////QO-`MSS@P3R??oS c0"C$S *x'x % SI* SI c   XXWPJ*WJ p\BpV 0 r0ЍR@oZ d($x   Z % SI<߿ * SI c  G8#XXXPJ*XJ poW g201;(   ' "Ƞ'8P0Kt:@` 0 @ ("Ƞ 8Z0@D[:j *Ƞ" H"(Q:Ppp Wt Jpq r0`0p`* pj57J;$x _(" ,8R0K(:b K Ƞ ,8R0I*RI0 Z bM\R!0-Z0@DPK0RK0SO-@ M`pP3R?oS c0"S%h H$H ( SI* SI c p m("TpG*TpG SooV~ f20v4'    K0 H #6 RI: b  0 P 6 8#(0(T PE:@d )#X  " (,T:RQ? I<RPoY6@e!%x` (( SI* SI c r@ Ƞ,Z@D*Z@D SR! Ѝ pi8Y4g%xL* ,hHS@K :@c9`H$8HR@`F*R`F@@b hT PEo RIWSK@0 0 R =) -L nonecylinderminimaloptimal@gHgTg\ghelplistmachinescriptversionalign-pretend-input-ttyghglgmg<߿sgvgagdisplays this help messagelists partition layout on all block devicesdisplays machine parseable outputnever prompts for user interventiondisplays the versionalign=[none|cyl|min|opt]alignment for new partitionsgLhghhghghghhiNUMBER is the partition number used by Linux. On MS-DOS disk labels, the primary partitions number from 1 to 4, logical partitions from 5 onwards. LABEL-TYPE is one of: FLAG is one of: UNIT is one of: desired alignment: minimum or optimalPART-TYPE is one of: primary, logical, extended FS-TYPE is one of: START and END are disk locations, such as 4GB or 10%. Negative values count from the end of the disk. For example, -1s specifies exactly the last sector. STATE is one of: on, off DEVICE is usually /dev/hda or /dev/sda NAME is any word you want Copyright (C) 1998 - 2006 Free Software Foundation, Inc. This program is free software, covered by the GNU General Public License. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %s... %0.f%% (time left %.2d:%.2d)Partition %s is being used. You must unmount it before you modify it with Parted.Partition(s) on %s are being used.The existing disk label on %s will be destroyed and all data on this disk will be lost. Do you want to continue?ped_geometry_test_sector_inside (range, *sector)parted.cwhat == SECT_START || what == SECT_END0start_dist >= 0 && end_dist >= 0start_dist >= 0end_dist >= 0ped_geometry_test_sector_inside(start_range,start)ped_geometry_test_sector_inside (end_range, end)start <= end -%c, --%-25.25s %s New disk label type?ext2Partition type?dvhPartition name?File system type?Start?End?user_constraint != NULLdev_cons<߿traint != NULL Is this still acceptable to you?You requested a partition from %s to %s. The closest location we can manage is %s to %s.%sThe resulting partition is not properly aligned for best performance.ped_partition_set_name (part, part_name)Partition number?, dev != NULL%d:%d:%d:%s; BIOS cylinder,head,sector geometry: %d,%d,%d. Each cylinder is %s. unknownCHS;CYL;BYT;%s:%s:%s:%lld:%lld:%s:%s; Model: %s (%s) Disk %s: %s Sector size (logical/physical): %lldB/%lldB Partition Table: %s devicesfreeall%s (%s) NumberStartEndSizeTypeFile systemNameFlags%2d %2s Free Space%d:1:%s:%s; free;A %s %s partition was found at %s -> %s. Do you want to add it to the partition table?searching for file systemsNew device?part->disk == diskpa->grain_size != 0alignment type(min/opt)%d aligned %d not aligned Flag to Invert?New state?Unit? %s %s align-checkalign-check TYPE N check partition N for TYPE(min|opt) alignmenthelp [COMMAND] print general help, or help on COMMANDmklabelmktablemklabel,mktable LABEL-TYPE create a new disklabel (partition table)mkpartmkpart PART-TYPE [FS-TYPE] START END make a partition'mkpart' makes a partition without creating a new file system on the partition. FS-TYPE may be specified to set an appropriate partition ID. namename NUMBER NAME name partition NUMBER as NAMEprintprint [devices|free|list,all|NUMBER] display the partition table, available devices, free space, all found partitions, or a particular partitionWithout arguments, 'print' displays the entire partition table. However with the following arguments it performs various other actions. devices : display all active block devices free : display information about free unpartitioned space on the current block device list, all : display the partition tables of all active block d<߿ evices NUMBER : display more detailed information about this particular partition quitquit exit programrescuerescue START END rescue a lost partition near START and ENDrmrm NUMBER delete partition NUMBERselectselect DEVICE choose the device to editsetset NUMBER FLAG STATE change the FLAG on partition NUMBERtoggletoggle [NUMBER [FLAG]] toggle the state of FLAG on partition NUMBERunitunit UNIT set the default unit to UNITversion display the version number and copyright information of GNU Parted'version' displays copyright and version information corresponding to this copy of GNU Parted partedGNU partedhlmsva:--alignUsage: %s [-hlmsv] [-a] [DEVICE [COMMAND [PARAMETERS]]...] No device foundWARNING: You are not superuser. Watch out for permissions.You should reinstall your boot loader before rebooting. Read section 4 of the Parted User documentation for more information.You may need to update /etc/fstab. partition_align_checkscsiidedac960cpqarrayfileataraidi2oubddasdviodasdsx8dmxvdsd/mmcvirtblkaoemdq}}}$}0}8}@}D}H}P}X}\}`}d}l}t}x}_print_disk_geometrydo_mkpartsnap_to_boundariesprefer_snapsnap%sline_length - indent > 10strlist.c %*sstr_list_print_wrapGNU Parted 3.0 Welcome to GNU Parted! Type 'help' to view a list of commands. Usage: parted [OPTION]... [DEVICE [COMMAND [PARAMETERS]...]...] Apply COMMANDs with PARAMETERS to DEVICE. If no COMMAND(s) are given, run in interactive mode. You found a bug in GNU Parted! Here's what you have to do: Don't panic! The bug has most likely not affected any of your data. Help us to fix this bug by doing the following<߿ : Check whether the bug has already been fixed by checking the last version of GNU Parted that you can find at: http://ftp.gnu.org/gnu/parted/ Please check this version prior to bug reporting. If this has not been fixed yet or if you don't know how to check, please visit the GNU Parted website: http://www.gnu.org/software/parted for further information. Your report should contain the version of this release (%s) along with the error message below, the output of parted DEVICE unit co print unit s print and the following history of commands you entered. Also include any additional information about your setup you consider important. 3.0 Error: SEGV_MAPERR (Address not mapped to object) 0ui.c Error: SEGV_ACCERR (Invalid permissions for mapped object) Error: A general SIGSEGV signal was encountered. Error: FPE_INTDIV (Integer: divide by zero) Error: FPE_INTOVF (Integer: overflow) Error: FPE_FLTDIV (Float: divide by zero) Error: FPE_FLTOVF (Float: overflow) Error: FPE_FLTUND (Float: underflow) Error: FPE_FLTRES (Float: inexact result) Error: FPE_FLTINV (Float: invalid operation) Error: FPE_FLTSUB (Float: subscript out of range) Error: A general SIGFPE signal was encountered. Error: ILL_ILLOPC (Illegal Opcode) Error: ILL_ILLOPN (Illegal Operand) Error: ILL_ILLADR (Illegal addressing mode) Error: ILL_ILLTRP (Illegal Trap) Error: ILL_PRVOPC (Privileged Opcode) Error: ILL_PRVREG (Privileged Register) Error: ILL_COPROC (Coprocessor Error) Error: ILL_BADSTK (Internal Stack Error) Error: A general SIGILL signal was encountered. : command_line != NULL'"str_list_match_any (possibilities, def) /[]? ]? invalid token: %s%d*valueExpecting a partition number.Partition doesn't exist.Expecting a file system type.Unknown file system type "%s".Expecting a disk label type.*value != NULLprimaryextendedlogical<߿Can't create any more partitions.Expecting a partition type.onoffoptimalminimalOPTIONs:COMMANDs: Report bugs to %s bug-parted@gnu.orgUsing %s (parted)This command does not make sense in non-interactive mode. command_line_get_disk_typecommand_line_get_disk_construct_promptcommand_line_pop_wordsa_sigsegv_handler ncols >= 0table.ctt->ncols > 0s != ((void *)0)**s == '\0'table_render_rowstable_render_rowtable_add_rowtable_calc_column_widthstable_destroytable_new3.0[%d] %s:%d (%s): %s Assertion (%s) at %s:%d in function %s() failed.path != NULLdevice.c/dev/mapper/dev != NULL!dev->external_modedev->open_count > 0dev->external_modebuffer != NULLped_device_sync_fastped_device_syncped_device_checkped_device_writeped_device_readped_device_end_external_accessped_device_begin_external_accessped_device_closeped_device_openped_device_get_ped_device_probeInformationWarningErrorFatalBugNo Implementation FixYesNoOKRetryIgnoreCancel8<@DHPXn > 0exception.cA bug has been detected in GNU Parted. Refer to the web site of parted http://www.gnu.org/software/parted/parted.html for more information of what could be useful for bug submitting! Please email a bug report to %s containing at least the version (%s) and the following message: bug-parted@gnu.org3.0%s: %s Out of memory in exception handler! ex_fetch_count > 0ped_exception_leave_allped_log2fs_type != NULLfilesys.cfs_type->ops != NULLfs_type->name != NULLfs_types != NULLwalk != NULLalias != NULLfs_aliases != NULLname != NULLFile system alias %s is deprecatedfs_type->ops->probe != NULLgeom != NULLped_file_system_probeped_file_system_probe_specificped_file_system_type_getped_file_system_alias_unregisterped_file_system_alias_registerped_file_system_type_unregisterped_file_system_type_register3.0<߿Out of memory.handler != NULLtimer.cnest_frac >= 0.0nest_frac <= 1.0ped_timer_new_nestedped_timer_newsBkBMBGBTBcompactcylchs%kiBMiBGiBTiBCannot get unit size for special unit 'COMPACT'.0unit.cdev != NULL%lld,%lld,%lld%lld%s%1$.*2$f%3$s,.-%d %d %d"%s" has invalid syntax for locations.The maximum head value is %d.The maximum sector value is %d.The location %s is outside of the device %s.%lfInvalid number.ped_unit_formatped_unit_format_customped_unit_format_byteped_unit_format_custom_byteped_unit_get_sizedisk_type != NULLdisk.cdisk_type->ops != NULLdisk_type->name != NULLdisk_types != NULLwalk != NULLname != NULLdev != NULLPARTED_DEBUGprobe label: %s %s: unrecognised disk labelold_disk != NULL!old_disk->update_modeold_disk->type->ops->duplicate != NULLold_disk->type->ops->partition_duplicate != NULLgptgpt != NULLtype != NULLtype->ops->alloc != NULLbios_geom->sectors != 0bios_geom->heads != 0disk->update_mode == 0disk != NULL!disk->update_modeThis libparted doesn't have write support for %s. Perhaps it was compiled read-only.part != NULLPartition %d is %s, but the file system is %s.disk->type->ops->get_max_supported_partition_count != NULLdisk->type != NULLdisk->type->ops->get_max_primary_partition_count != NULLThe flag '%s' is not available for %s disk labels.cylinder_alignmentUnknown disk flag, %d.part->num != -1part->disk != NULLdisk_type->ops->partition_align != NULLpart->disk->update_modedisk_type->ops->partition_enumerate != NULLdisk->update_modedisk->type->ops->partition_new != NULL%s disk labels do not support extended partitions.part->disk->type->ops->partition_new != NULLped_partition_is_active (part)ops->partition_set_flag != NULLops->partition_is_flag_available != NULLpart->disk->type->ops->partition_get_flag != NULLpart->disk->type->ops->partition_is_flag_available != NULLdisk_type->ops->partition_set_sy<߿ stem != NULL%s disk labels do not support partition names.part->disk->type->ops->partition_set_name != NULLpart->disk->type->ops->partition_get_name != NULL!(walk->type & PED_PARTITION_LOGICAL)!walk->prev || walk->prev->next == walkwalk->type & PED_PARTITION_LOGICALwalk->prev->next == walkloc != NULLpart->geom.dev == geom->devext_part != NULLpart->disk == diskpart->geom.start >= 0part->geom.end < disk->dev->lengthpart->geom.start <= part->geom.end%s disk labels don't support logical or extended partitions.Too many primary partitions.Can't add a logical partition to %s, because there is no extended partition.Can't have more than one extended partition on %s.Can't have logical partitions outside of the extended partition.Can't have a logical partition outside of the extended partition on %s.Can't have overlapping partitions.Can't have a primary partition inside an extended partition.part->part_list == NULLped_geometry_test_equal (&part->geom, &old_geom)metadatafreeextendedlogicalprimarybootbios_grubrootswaphiddenraidlvmlbahp-servicepaloprepmsftresatvrecvdiaglegacy_bootUnknown partition flag, %d. %-10s %02d (%d->%d) ped_disk_printped_partition_printped_disk_minimize_extended_partitionped_disk_get_max_partition_geometryped_disk_maximize_partitionped_disk_set_partition_geomped_disk_delete_allped_disk_delete_all_logicalped_disk_delete_partitionped_disk_remove_partitionped_disk_add_partition_check_partition_check_extended_partition_partition_check_basic_sanity_disk_check_part_overlaps_partition_get_overlap_constraint_disk_raw_add_disk_raw_remove_disk_raw_insert_after_disk_raw_insert_beforeped_disk_get_partition_by_sectorped_disk_get_partition_disk_check_sanityped_disk_next_partitionped_disk_extended_partitionped_partition_get_nameped_partition_set_nameped_partition_set_systemped_partition_is_flag_availableped_partition_get_flagped_<߿partition_set_flagped_partition_is_activeped_partition_destroyped_partition_new_ped_partition_alloc_disk_pop_update_mode_disk_alloc_metadata_disk_remove_metadataped_disk_enumerate_partitions_partition_enumerate_partition_alignped_disk_is_flag_availableped_disk_get_flagped_disk_set_flagped_disk_get_max_primary_partition_countped_disk_get_max_supported_partition_countped_disk_get_last_partition_numped_disk_get_primary_partition_countped_disk_checkped_partition_get_pathped_partition_is_busyped_disk_commit_to_devped_disk_commit_to_osped_disk_destroyped_disk_new_freshped_disk_clobberped_disk_duplicateped_disk_newped_disk_probeped_disk_type_getped_disk_type_unregisterped_disk_type_registergeom != NULLcs/geom.cdev != NULLgeom->dev != NULLCan't have the end before the start! (start sector=%jd length=%jd)Can't have a partition outside the disk!a != NULLb != NULLbuffer != NULLoffset >= 0count >= 0Attempt to write sectors %ld-%ld outside of partition on %s.checking for bad blocksdst != NULLsrc != NULLped_geometry_mapped_geometry_checkped_geometry_writeped_geometry_sync_fastped_geometry_syncped_geometry_readped_geometry_test_sector_insideped_geometry_test_equalped_geometry_test_insideped_geometry_test_overlapped_geometry_setped_geometry_destroyped_geometry_duplicateped_geometry_newped_geometry_initconstraint != NULLcs/constraint.cstart_range != NULLend_range != NULLmin_size > 0max_size > 0min != NULLmax != NULLped_geometry_test_inside (max, min)geom != NULLconstraint->start_range->dev == geom->devped_constraint_is_solution (constraint, result)okped_constraint_exactped_constraint_is_solutionped_constraint_solve_nearestped_constraint_doneped_constraint_duplicateped_constraint_new_from_maxped_constraint_new_from_minped_constraint_new_from_min_maxped_constraint_inita >= 0cs/natmath.cb >= 0<߿ align != NULLped_alignment_align_nearestped_alignment_align_downped_alignment_align_up_closest_inside_geometryped_alignment_initped_greatest_common_divisorfs_info->cluster_sectors % frag_sectors == 0 && frag_sectors <= fs_info->cluster_sectorsfat.c0fat16fat32fat_set_frag_sectors"X#hfshfs+hfsxJFS1jfslinux-swap(v0)linux-swap(v1)swsuspSWAP-SPACEUnrecognised old style linux swap signature '%10s'.SWAPSPACE2Unrecognised new style linux swap signature '%10s'.S1SUSPENDUnrecognised swsusp linux swap signature '%9s'.< h  linux-swap(old)linux-swap(new)linux-swapext2ext3<hext4nilfs2NTFSntfsgeom != NULLprobe.cdev != NULLParted can't use HFS file systems on disks with a sector size not equal to %d bytes.hfsc_can_use_geom (geom)hfsx_probehfs_probehfsplus_probehfs_and_wrapper_probehfsc_can_use_geomgeom != NULLreiserfs.cReIsErFsReIsEr2FsReIsEr3Fs(reiserfsreiserfs_probe +-sun-ufshp-ufsped_file_system_ufs_init0xfsaixdev != NULLaix.cSupport for reading AIX disk labels is is not implemented yet.Support for writing AIX disk labels is is not implemented yet.Support for adding partitions to AIX disk labels is not implemented yet.Support for duplicating partitions in AIX disk labels is not implemented yet.part != NULLSupport for setting system type of partitions in AIX disk labels is not implemented yet.Support for setting flags in AIX disk labels is not implemented yet.err == 0566 7@7|777 8l888999 :909T9:`:aix_partition_max_lengthaix_partition_max_start_sectoraix_partition_alignaix_partition_destroyaix_probelinux-swapbsddev != NULLbsd.cdev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0disk != NULLdisk->dev != NULLpart != NULLpart->disk_specific != NULLpart->disk != NULLUnable to satisfy al<߿ l constraints on the partition.Unable to allocate a bsd disklabel slot.err == 0<=CCCH(LMNpNO8PQRRHT0SXQ|QTTped_disk_bsd_initbsd_partition_max_lengthbsd_partition_max_start_sectorbsd_alloc_metadatabsd_partition_get_flagbsd_partition_set_flagbsd_partition_destroybsd_writebsd_allocbsd_probelinux-swapм؎|!8u u|tL|msdosdev != NULLdos.cpc98disk != NULLbios_geom != NULLchs != NULLraw_part != NULLpart != NULLpart->disk != NULLpart->disk_specific != NULLpart->disk->dev != NULLpart->disk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 00ext_part != NULLdisk->dev != NULLInvalid partition table on %s -- wrong signature %x.Invalid partition table - recursive partition on %s.geom != NULLgeom->dev != NULLped_disk_extended_partition (disk) != NULLlogical != NULLfatntfsfat16fat32hpfshfshfs+sun-ufsExtended partitions cannot be hidden on msdos disk labels.Parted can't resize partitions managed by Windows Dynamic Disk.Unable to satisfy all constraints on the partition.metadata_length > 0err == 0VdYZZ(~ZT[[($ИxԻ||ped_disk_msdos_initmsdos_partition_max_lengthmsdos_partition_max_start_sectormsdos_partition_enumeratemsdos_alloc_metadataadd_logical_part_metadataadd_metadata_partmsdos_partition_align_align_logical_log_meta_overlap_constraint_logical_constraintmsdos_partition_get_flagmsdos_partition_set_flagmsdos_partition_destroymsdos_writewrite_extended_partitionswrite_empty_tablewrite_ext_tablefill_ext_raw_part_geomfill_raw_partmsdos_readread_tableraw_part_parseraw_part_is_lbaraw_part_is_hiddenraw_part_is_extendedpartition_probe_bios_geometryprobe_partition_for_geomprobe_filesystem_for_geo <߿mdisk_check_bios_geometrypartition_check_bios_geometrylinear_endlinear_startlegacy_endlegacy_startsector_to_chschs_to_sectormsdos_freemsdos_allocmsdos_probedvhb != NULLdvh.cold_dvh_disk_data != NULL%s has no extended partition (volume header partition).dvh_disk_data != NULLChecksum is wrong, indicating the partition table is corrupt.PED_BE32_TO_CPU (vh.vh_magic) == VHMAGIC(part->type & PED_PARTITION_LOGICAL) == 0(part->type & PED_PARTITION_LOGICAL) != 0part->disk_specific != NULLxfsOnly primary partitions can be root partitions.Only primary partitions can be swap partitions.Only logical partitions can be a boot file.failed to set dvh partition name to %s: Only logical partitions (boot files) have a name.part != NULLUnable to satisfy all constraints on the partition.0Too many primary partitionsdisk != NULLerr == 0Ľ\4\T Lx DXped_disk_dvh_initdvh_partition_max_lengthdvh_partition_max_start_sectordvh_alloc_metadatadvh_partition_enumeratedvh_partition_aligndvh_partition_destroydvh_write_generate_boot_file_generate_partitiondvh_readdvh_duplicateread_sector0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, <߿[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-gptpth_raw != NULLgpt.cpth->Reserved2 != NULLpth != NULLuuid != NULLdev != NULLmbr != NULL%s contains GPT signatures, indicating that it has a GPT table. However, it does not have a valid fake msdos partition table, as it should. Perhaps it was corrupted -- possibly by a program that doesn't understand GPT partition tables. Or perhaps you deleted the GPT table, and are now using an msdos partition table. Is this a GPT partition table?The format of the GPT partition table is version %x, which is newer than what Parted can recognise. Please report this!last_usable > first_usablelast_usable <= disk->dev->lengthlast_usable_if_grown > first_usablelast_usable_if_grown <= disk->dev->lengthNot all of the space available to %s appears to be used, you can fix the GPT to use all of the space (an extra %llu blocks) or continue with the current setting? gpt_disk_data->entry_count > 0gpt_disk_data->entry_count <= 8192The backup GPT table is not at the end of the disk, as it should be. This might mean that another operating system believes the disk is smaller. Fix, by moving the backup to the end (and removing the old backup)?Both the primary and backup GPT tables are corrupt. Try making a fresh table, and using Parted's rescue feature to recover partitions.The backup GPT table is corrupt, but the primary appears OK, so that will be used.The primary GPT table is corrupt, but the backup appears OK, so that will be used.primary partition table array CRC mismatchgpt_part_data != NULLdisk != NULLdisk->dev != NULLdisk->disk_specific != NULLpart->disk_specific != NULLfatntfshfsswap0part != NULLUnable to satisfy all constraints on the partition.err == 0,|<߿ x 0""l(t.//H03'44%|004t4gpt_partition_max_lengthgpt_partition_max_start_sectorgpt_partition_aligngpt_partition_get_flaggpt_partition_set_flaggpt_partition_enumerategpt_alloc_metadatagpt_partition_set_systemyD<#*=(;Mt?(s*K>;Hah!IdontNeedEFI(2{\ M}-@Mjy֬oceRev0eC쬢3Dh&SFH0eCmWC 3KOO3Dh&gpt_partition_destroy3Dh&add_metadata_partgpt_write_partition_generate_part_entry(s*K>;Hah!IdontNeedEFI;Mt?yD<#*=((2{\ M}-@Mjy֬oceRev0eC_parse_headergpt_probe_pmbr_is_validpth_crc32swap_uuid_and_efi_guidpth_get_rawpth_freepth_new_from_rawloopGNU Parted Loopback 0dev != NULLloop.cdisk != NULLUnable to satisfy all constraints on the partition.err == 05647l779$;; <@<t<<\=<=0>===>p>loop_partition_max_lengthloop_partition_max_start_sectorloop_readloop_freeloop_alloclinux-swapmacInvalid signature %x for Mac disk labels.dev != NULLmac.cPartition map has no partition map entry!AppleApple_partition_map%s is too small for a Mac disk label!partition_map != NULLpartition_map->type == PED_PARTITION_NORMALApple_BootstrapApple_BootApple_driverApple_UNIX_SVR2rootswapLinux_LVMLinux_RAIDApple_VoidApple_FreeExtraApple_ScratchApple_ExtraPartition %d has an invalid signature %x.Partition %d has an invalid length of 0 bytes!The data region doesn't start at the start of the partition.The partition's boot region doesn't occupy the entire partition.The partition's data region doesn't occupy the entire partition.Weird block size on device descriptor: %d bytes is not divisible by 512.The driver descriptor says the physical block size is %d bytes, but Linux says it is %d bytes.<߿ i <= disk->dev->sector_size / 512No valid partition map found.disk != NULLConflicting partition map entry sizes! Entry 1 says it is %d, but entry %d says it is %d!Weird! There are 2 partitions map entries!part->num > 0num > 0disk->disk_specific != NULLdisk->dev != NULL!disk->update_modeuntitledpart != NULLhfshfs+Apple_HFShfsxApple_HFSXpart->disk_specific != NULLChanging the name of a root or swap partition will prevent Linux from recognising it as such.Unable to satisfy all constraints on the partition.part->disk != NULLCan't add another partition -- the partition map is too small!disk->update_modeerr == 0ADEF`~,ЃD Tȓ`0@Ԕped_disk_mac_initmac_partition_max_lengthmac_partition_max_start_sectormac_alloc_metadataadd_metadata_part_disk_count_partitionsmac_partition_enumeratemac_partition_alignmac_partition_get_namemac_partition_set_namemac_partition_get_flagmac_partition_set_flagmac_partition_destroymac_write_generate_empty_part_generate_raw_freespace_part_generate_raw_partmac_read_disk_analyse_ghost_sizemac_duplicatemac_allocmac_probeIPL1pc98IPL1dev != NULLpc98.cdisk != NULLc != NULLh != NULLs != NULLraw_part != NULLdisk->dev != NULLInvalid partition table on %s.pc98_data != NULLPartition %d isn't aligned to cylinder boundaries. This is still unsupported.part != NULLpart->disk_specific != NULLname != NULLstrlen (name) <= 16fat16fat32ntfsufsUnable to satisfy all constraints on the partition.part->disk != NULLped_partition_is_active (part)Can't add another partition.err == 0dxܣ 0<dD84DLPX̷̲@ped_disk_pc98_initpc98_partition_max_lengthpc98_partition_max_start_sectorpc98_alloc_metadatapc98_partition_enumeratepc98_partition_a<߿lignpc98_partition_get_namepc98_partition_set_namepc98_partition_get_flagpc98_partition_set_flagpc98_partition_destroypc98_writefill_raw_partpc98_readread_tablelegacy_endlegacy_startsector_to_chschs_to_sectorpc98_freepc98_allocpc98_probebuflen <= disk->dev->sector_sizept-tools.cb != NULLdev->sector_size <= sizeof zeropartition length of %jd sectors exceeds the %s-partition-table-imposed maximum of %jdstarting sector number, %jd exceeds the %s-partition-table-imposed maximum of %jdsunloopgptmsdosdasdamigadvhmacbsdpc98 $$$$($$$$0$$$$4$$$$<$$$$D$$$$L$$$$P$$$$T$$$$X........................................................ ....................................... .. .... .........................................................................................................................................ptt_clear_sectorsptt_read_sectorsptt_write_sectorlinux-swapRDSK<߿ BADBPARTFSHDLSEGBOOT%s : Bad checksum on block %llu of type %s.amigadev != NULLrdb.csizeof(*rdb) <= disk->dev->sector_sizedisk != NULLdisk->dev != NULLdisk->disk_specific != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0%s : Didn't find rdb block, should never happen.%s : Loop detected at block %d.%s : The %s list seems bad at block %s.%s : Failed to list bad blocks.%s : Failed to list partition blocks.%s : Failed to list file system blocks.%s : Failed to list boot blocks.part->disk_specific != NULLpart->geom.start % cylblocks == 0(part->geom.end + 1) % cylblocks == 0Failed to write partition block at %d.dhxpart != NULLpart->disk != NULLext2ext3fat16fat32hfsjfsntfsreiserfssun-ufshp-ufsxfsUnable to satisfy all constraints on the partition.Unable to allocate a partition number.err == 0LddtlX|HPptped_disk_amiga_initamiga_partition_max_lengthamiga_partition_max_start_sectoramiga_alloc_metadataamiga_partition_enumerateamiga_partition_alignamiga_partition_get_nameamiga_partition_set_nameamiga_partition_get_flagamiga_partition_set_flagamiga_partition_set_systemamiga_partition_destroyamiga_partition_duplicateamiga_partition_newamiga_writeamiga_write_amiga_find_free_blocks_amiga_find_free_blocksamiga_readamiga_readamiga_freeamiga_duplicateamiga_allocamiga_probe_amiga_read_blocklinux-swapsundev != NULLsun.cCorrupted Sun disk label detected.cyl_size != 0bios_geom->cylinders == (PedSector) (dev->length / cyl_size)GNU Parted Custom cyl %d alt %d hd %d sec %dThe disk CHS geometry (%d,%d,%d) reported by the operating system does not match the geometry stored on the disk label (%d,%d,%d).The disk label describes a disk bigger than %s.disk != NULLdisk->dev != NULLdisk->disk_specific != NULLThe disk has<߿ %d cylinders, which is greater than the maximum of 65536.part != NULLufspart->disk_specific != NULLped_partition_is_flag_available (part, flag)Unable to satisfy all constraints on the partition.The Whole Disk partition is the only available one left. Generally, it is not a good idea to overwrite this partition with a real one. Solaris may not be able to boot without it, and SILO (the sparc boot loader) appreciates it as well.Sun disk label is full.err == 0l ( $%|&&0(|*d+.p/H20++,22ped_disk_sun_initsun_partition_max_lengthsun_partition_max_start_sectorsun_alloc_metadatasun_partition_alignsun_partition_get_flagsun_partition_set_flagsun_partition_destroysun_writesun_readsun_allocsun_probeinvalid argument %s for %sambiguous argument %s for %sValid arguments are: - `%s', `%s'write error%s: %s%sPOSIXLY_CORRECT--%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument A NULL argv[0] was passed through an exec system call. /.libs/lt-literalshellshell-alwayscc-maybeescapelocaleclocale $"`'%s (%s) %s %s %s (C) License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Written by %s. Written by %s and %s. Written by %s, %s, and %s. Written by %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, %<߿s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. Report bugs to: %s bug-parted@gnu.org%s home page: <%s> GNU partedhttp://www.gnu.org/software/parted/General help using GNU software: %smemory exhausted/proc/devicesBlock devices:virtblkdev != NULLarch/linux.c!dev->external_modeCould not stat device %s - %s.%u.%u.%udev->open_countCould not determine sector size for %s: %s. Using the default sector size (%lld).dev->open_count > 0dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0PARTED_TEST_DEVICE_LENGTHUnable to determine the size of %s (%s).S_ISBLK (dev_stat.st_mode)Could not get identity of device %s - %sGeneric IDE0Device %s has multiple (%d) logical sectors per physical sector. GNU Parted supports this EXPERIMENTALLY for some special disk label/file system combinations, e.g. GPT and ext2/3. Please consult the web site for up-to-date information./sys/block/%s/device/%srvendormodelError initialising SCSI device %s - %s%.8s %.16sGeneric SCSIPARTED_SECTOR_SIZEThe device %s is so small that it cannot possibly store a file system or partition table. Perhaps you selected the wrong device?Unable to determine geometry of file/device %s. You should not use Parted unless you REALLY know what you're doing!typename%s %s%sGeneric SD/MMC Storage Cardpath != NULLDAC960 RAID controllerPromise SX8 SATA DeviceATA over Ethernet DeviceIBM iSeries Virtual DASDCompaq Smart ArrayATARAID ControllerI2O ControllerUser-Mode Linux UBDLinux device-mapper (%s)Xen Virtual Block DeviceUnknownVirtio Block DeviceLinux Software RAID Arrayped_device_new() Unsupported device typeError fsyncing/closing %s: %sError opening %s: %sUnable to open %s read-write (%s). %s has been opened read-only.buffer != NU<߿ LL%s during read on %s%s during seek for read on %send of file while reading %s%s during write on %sCan't write to %s, because it is opened read-only.%s during seek for write on %s/proc/partitions/dev/%d %d %d %255s/sys/block/dev/hda/dev/hdb/dev/hdc/dev/hdd/dev/hde/dev/hdf/dev/hdg/dev/hdh/dev/sda/dev/sdb/dev/sdc/dev/sdd/dev/sde/dev/sdf/disc%.*s/part%dp%s%s%d/proc/mounts/proc/swaps/etc/mtabdisk != NULLlooppart != NULLdisk->dev->sector_size % PED_SECTOR_SIZE_DEFAULT == 0Error informing the kernel about modifications to partition %s -- %s. This means Linux won't know about any changes you made to %s until you reboot -- so you shouldn't mount it or use it in any way before rebooting./sys/block/%s/range%ddisk->dev != NULLUnable to determine the size and length of %s.Failed to add partition %d (%s)%d, Partition(s) %s on %s have been written, but we have been unable to inform the kernel of the change, probably because it/they are in use. As a result, the old partition(s) will remain in use. You should reboot now before making further changes._have_blkpg ()x`linux_disk_commit_disk_sync_part_table_blkpg_add_partitionlinux_partition_is_busy_has_partitions...dm-ramlinux_sync_fastlinux_sync_do_fsynclinux_checklinux_write_write_lastoddsectorlinux_read_read_lastoddsector_device_seeklinux_newinit_genericinit_ide_device_probe_geometry_device_get_length_device_set_sector_size_device_statgeom != NULLaffs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu Pralloc = %d, Reserved = %d, blocksize = %d, root block at %llu %s : Couldn't read root block %llu $TDt4daffs0affs1affs2affs3affs4affs5affs6affs7amufsamufs0amufs1amufs2amufs3amufs4amufs5_gen3<߿eric_affs_probe_generic_affs_probeRDSKBADBPARTFSHDLSEGBOOT%s : Failed to allocate id list element %s : Couldn't read block %llu %s : Bad checksum on block %llu of type %s %s : Couldn't write block %d geom!= NULLamiga.cgeom->dev!= NULL%s : Failed to allocate disk_specific rdb block %s : Didn't find rdb block, should never happen %s : Failed to read partition block %llu amiga_find_partamiga_find_part_amiga_read_block_amiga_add_idgeom != NULLapfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read boot block %llu %s : Couldn't read root block %llu apfs1apfs2_generic_apfs_probe_generic_apfs_probegeom != NULLasfs.cgeom->dev != NULL%s : Failed to allocate partition block %s : Failed to allocate block %s : Couldn't read root block %llu asfs_asfs_probe_asfs_probebs != NULLbootsector.cgeom != NULLFile system has an invalid signature for a FAT file system.File system has an invalid sector size for a FAT file system.File system has an invalid cluster size for a FAT file system.File system has an invalid number of reserved sectors for a FAT file system.File system has an invalid number of FATs.This file system has a logical sector size of %d. GNU Parted is known not to work properly with sector sizes other than 512 bytes.The file system's CHS geometry is (%d, %d, %d), which is invalid. The partition table's CHS geometry is (%d, %d, %d). If you select Ignore, the file system's CHS geometry will be left unchanged. If you select Fix, the file system's CHS geometry will be set to match the partition table's CHS geometry.FAT boot sector says logical sector size is 0. This is weird. FAT boot sector says there are no FAT tables. This is weird. FAT boot sector says clusters are 0 sectors. This is weird. File system is FAT12, which is unsupported.Xt~"tThis partition does not ha&<߿ ve an operating system loader installed on it. Press a key to reboot...MSWIN4.1NO NAME FAT32 FAT16 is != NULLThe information sector has the wrong signature (%x). Select cancel for now, and send in a bug report. If you're desperate, it's probably safe to ignore.fat_info_sector_writefat_info_sector_readfat_boot_sector_writefat_boot_sector_generatefat_boot_sector_set_boot_codefat_boot_sector_analysefat_boot_sector_readUnknown error (%d)Unknown error %dCopyright %s %d Free Software Foundation, Inc.0 <= strtol_base && strtol_base <= 36xstrtol.cxstrtoll/dev/urandom/dev/random/var/lib/libuuid/clock.txtr+clock: %04x tv: %lu %lu adj: %d clock: %04x tv: %016lu %08lu adj: %08d /dev/null/var/lib/libuuid/request/var/lib/libuuiduuidd-qT300/usr/sbin/uuiddR%<߿ \X@XQ $ (g(L  |T(444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444̒hijj,j@jhjjjPklkkk\~l~~Pdh$X6Hx|Чl$PDTH\̓Lplt,X4\<`d|    ̪Ȫ (8 0P$XhT\P@X4lD3?<`,ط<`,ܼXLH048<ȖHLP4TXX|\`ėdh0<߿lp0tHx`|x\ A/aeabi%ARM926EJ-S ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.*<߿ 4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v1?<߿00(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.<<߿9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.comment (($ LL@! ) TT(2 ||;$$644AȚ`G(g(M8g84Upl l `lx}ȒȒ DPp0)<߿ Գ<߿sttyH9Y8Y8YbusyboxipH9Y8Y8YbusyboxrmdirH9Y8Y8Ybusybox pppoeH9YH9YH9YnELF(|4hk4 (444fffff f f fQtd/lib/ld-uClibc.so.0CG<&?C'#961;0EB$>8:*(!5A."3 @DF72)   -/4+ %=,ċЋ܋~T 2$Ygh0<<H[T`lxRgfgjEčp،Sq:h|P  ,8CDwP\ht`gȍhԍK Lg6-g h(4+@gLXdpmemcpymallocabortmemsetfreelibc.so.0strlengeteuidsetsockoptfflushstderrfprin<߿tfputsfopenvsnprintf__sysv_signalgetgidbind__errno_locationgetegidgetpwnamreadstrerrorseteuidsleepputcharrecvsetuidexitselectmemcmpsyslogsetegidsendsscanfsprintfioctlsetgid__uClibc_mainstrftimefputcgetpidstrncmpstrcmpoptarg__ctype_bstrtolsocketreadvstrncpylocaltimeopenlogstrcpygettimeofdaygetoptfclosewritev__data_startgetuidfwrite_edata__bss_start__bss_start____bss_end____end___endg gg9ffffffggg g g ggg g$g(g,g0g4g8g O +V9O<߿ O΍ ,*?OK2@ @ *$G0S `<\0 PPP0PS ̝P  > 1! 0΍"1 0`PB?Q  @  ( RH  0 >"0S (\4  P.  1 R , xP ><.ā| P @A0 @$z p @  ;\q 0O ^g, 0P 0_$  0P 0W@P , @ɾ@ @P[ 0 @#dv @ @, @UO-M M@P/`VX 8 0@ $. wtp@ gÎ0@ `@ ,00̍(0D *  @Up@ A@3Q3((((t(((((((((T, h(((((((((((((\d((((((Н((ĝ` *  @p@PU @WP@T$`C PU+D@a\ЍۍL @P  @ \0P0 PxuDP cDm@P [@e @X$P R7\ 0@0 @dPHP >HH T E @d@adP  ,' @ @edQ11͍ @. 0yPˍ5' @@0 >0  @ 0[Pc<߿T,3?O@RĀ4 8,<1 S#< 㺂 3P0  ,P ݍpD @ =BOp @ Q @` @\| @X @T @P @L @ 7@-0@"Dt@Q 0S ( @ O-@P M` R0S wp@ PYEeV00 x @ WPU4P Vʀ @ 0PU$ AP V@ <߿ 0x  @P1UVx @0 ʀ @oPkU@ @ 0c VN 0P @Q LPU<V9\& 0 @J.:PU*V&P0U.0 Რ@ P UV0. ᾰ@PU.  P VX Ѝ  0@_.x  @dR<#P8D 0@2 ЍOO-PQM@q U`u M8=b0A4O4/<Kb, 0 @  0@v70@ Rs @ RR   @g0SQ S\ Sx S  0@ SH ZeS @ 0밡 't@ w0*dv @,  @0 p ` (,($p,`  "1$#Ă| Qߍ @0S  0@W  0@P  0@I @S S  0@9  0@2  0@+7@-0@@  @  @@A-LADMqp`Q] P@  0@G@@@ @ 0@ ЍA= 0@Q@-@M 0@ 0ЍE-0p!Q:\>5"dv`V?V@$0P pP TuP V P0 p~PP V P 0@8/jV   @ #"@  @  @}E-P0M  @ <߿ n 1  x@ (4 P @ XP  0 0@@6 Hpr`  PV `@ R PE uP`U@ `0EsPPE uP @`U@H/p @X @t@$80sЍ0@-M0 !S> Ѝ01! S@*1#4sQ @Q0P Q0 Q   mP 1 0.\Q Q P0( S*Q Q0@)P%S ^" :8 @Ѝ0@ 0 P@ PL 0P@A-0@TJ@TO D5,Ą|\+\@p$P`0pP Tu0P\"P'P0T4uPs0U` \U `@0g S`@ @@Z  @@R  #"@@D  @=@G-@QMpU 0S g`@  X<$,`/OĠḑ@4 ΍V?O "  PvPW _(p *":?O/O(ĉ㽞p}  P0sp`Q 4#Ď|  ` 0SDH4$#Ă|`Pv`(^ *v0#Ď|  a 0\'bb $,Pu`4BO&0n P?@P *  @ @@\ @ލ @5"j *oO[΍_>/OPP`w-0@-Mύ@P 0"*02:ߍ0@ Ѝ/8@-<߿P@P 8 @8p@-P @0Sptp@S @V@P PjPUp @-@0SZP8P @I @D @-@0SBP P @1 @,8 0@  /R0-' @8 @0SPB@ P@@@ $ U @0S@ @$@ $ P0@0SP PPP %@ @@@ $0/O-M M*@P hP`@0S 0D@0R T+ S @DQ T# @DP0T S D0 @#\0S S@D#^0S#\0@T0 Ѝڍ0S0D> @}Rv ~Ri 0S} 0 " 0PS) ~S.  RC 0#0Z 0pPS0@J}S. ~S!  UR3 0#00PS0@D}S  R3 B  R- B   @(@  R B d @Z @U @0.@F 8@yP@p@p@-0M`@P  `0`P V  FЍp Q X@L@@ p@@y@- PQM@ Ѝ FB0PE-M PM@U pp@PPS `  p%7 0@<$/O@4?OĠ ΍ "  P,<߿\BO&0n P@P *  @@ h@ߍۍ.b */=/O Q":?O_+ & `v` 0  x`70@ V<$/O @4?OĠ ΍ "  "ڰ @  `7<$0@/O@pOĠ  "  P $'t PZq  prO-@ MMP p5PuPU p p{ j   `e@<$/O @4?O Q,Ď  Ჰ  H,0SKP .$r0 j ^OH5$ 4s ` pvP(f^ *f0$#p j Z5b!Ā`PuP$BO%0^ `@P *  @@ m@ߍۍ j5 *Q/O":?O_+  @D PpuPpPfp@-@MP` PP ,0SЍp @ KO-jM M$0ォ Li~PO@ p`^  \&f660PP0P0PSj㜖 ⠶2"  0pP: R @]j΍ QjƝ !4s  P  @Qߍۍ@P  @ @@iwP '0S @$  @&R P D0QD &R  '0P 00@@hl@d@ 0  <߿ @ O-iM MP㖩L}`O @ p 0 00PPP0PSi> ㌖␶1  0pP_LQ @i i΍Ɲ$!4s  P! @ Ri O0@1$#~ 0 ,p R08@ߍۍ@P  @# @@ 0P 0P 0 +eQL <@ <S00R40A-@ \S 8P%wp@ b4pW`@p0 RP0S"`V\ `@ \< Q@XD^ @R \@`ppPP`V0S  \@`W@P@- M@Pp`d 2P; \" 2\= Ѝ1P@ AP \00SQx `V ^U P  00S @ Ѝ@0PDĠ$$L%4 4 Ѝ@0Pt @ Ѝ@00Sl p@ Ѝ@ 0\ $`V #U P0P.$bΆ%$(*6  Ѝ@ @tD@U@@nT @T@@fUTQU L(@W`@U@@QT @T@@IUTQU /\@:\@6 @ 0@Pp@-M@`P 1P Ѝp@AP @0P~ ,$b΃(6!*6  Ѝp@ @ <߿ 0Ѝp@l -LRP-PPPoE: Session %d: %.256sReceived signal %d on session %d.RP-PPPoE: Received signal %d%.256s: %.256s%.256s: Session %d: %.256sRP-PPPoE: System call error: %sBogus PPPoE length field (%u)RCVDUnexpected packet code %dUnexpected packet version %dUnexpected packet type %dBogus length field in session packet %d (%d)incomingsyncReadFromEth: writeasyncReadFromEth: writeUsage: %s [options] Options: -I if_name -- Specify interface (default %s.) eth0 -D filename -- Log debugging information in filename. -T timeout -- Specify inactivity timeout in seconds. -t timeout -- Initial timeout for discovery packets in seconds -V -- Print version and exit. -A -- Print access concentrator names and exit. -S name -- Set desired service name. -C name -- Set desired access concentrator name. -U -- Use Host-Unique to allow multiple PPPoE sessions. -s -- Use synchronous PPP encapsulation. -m MSS -- Clamp incoming and outgoing MSS options. -p pidfile -- Write process-ID to pidfile. -e sess:mac -- Skip discovery phase; use existing session. -n -- Do not open discovery socket. -k -- Kill a session with PADT (requires -e) -d -- Perform discovery, print session info and exit. -f disc:sess -- Set Ethernet frame types (hex). -h -- Print usage information. PPPoE Version %s, Copyright (C) 2001-2006 Roaring Penguin Software Inc. PPPoE comes with ABSOLUTELY NO WARRANTY. This is free software, and you are welcome to redistribute it under the terms of the GNU General Public License, version 2 or any later version. http://www.roaringpenguin.com 3.8Inactivity timeout... something wicked happened on session %dRP-PPPoE: Inactivity timeoutSession %d terminated -- received PADT from peerReceived PADT from peerselect (session)pppoe%dIlle <߿gal argument to -t: Should be -t timeout Illegal argument to -F: Should be -F numFloods WARNING: DISCOVERY FLOOD IS MEANT FOR STRESS-TESTING A PPPOE SERVER WHICH YOU OWN. DO NOT USE IT AGAINST A REAL ISP. YOU HAVE 5 SECONDS TO ABORT. %x:%xIllegal argument to -f: Should be disc:sess in hex %u:%2x:%2x:%2x:%2x:%2x:%2xIllegal argument to -e: Should be sess:xx:yy:zz:aa:bb:cc w%lu Could not open %s: %s rp-pppoe-%s -m: %d is too low (min 536) -m: %d is too high (max 1452) Roaring Penguin PPPoE Version %s I:VAT:D:hS:C:Usm:np:e:kdf:F:t:Sending discovery flood %d %u:%02x:%02x:%02x:%02x:%02x:%02x outgoingSENTrecv (receivePacket)send (sendPacket)Cannot create raw socket -- pppoe must be run as root.socketsetsockoptioctl(SIOCGIFHWADDR)Interface %.16s is not EthernetInterface %.16s has broadcast/multicast MAC address??ioctl(SIOCGIFMTU)Interface %.16s has MTU of %d -- should be %d. You may have serious connection problems.ioctl(SIOCFIGINDEX): Could not get interface indexbindInvalid ether type 0x%x (PAP Authentication Frame -- Contents not dumped) %02x %H:%M:%S%s.%03d %s PPPoE Discovery (%x) Session (%x) Unknown (%x) PADI PADO PADR PADS PADT PADM PADN SESS sess-id %d length %d SourceAddr %02x:%02x:%02x:%02x:%02x:%02x DestAddr %02x:%02x:%02x:%02x:%02x:%02x (pppoe: %s %sGeneric-Error%s: %s: %.*sPADTInvalid PPPoE version (%d)Invalid PPPoE type (%d)Invalid PPPoE packet length (%u)Invalid PPPoE tag length (%u)Bad TCP checksum %xBogus length for MSS option (%u) from %u.%u.%u.%uBogus TCP option length (%u) from %u.%u.%u.%uWould create too-long packetSent PADTstrdup failednobodysetgid failedseteuid failedService-Name-ErrorSystem-Error#2$FW6etHZӾl~3"V,Gu>dɜ@ۿRdv!0&gv4DUJüXџn|ك1 w.fT@R+:dN_vm|$ÿ6H ;Z*^lO}~l .ǟ䩐 2ZLKy^hh ?z.ĕ*8FkzTHYb-SRJ\eV/xC%gz!;Wk.+eS2$F#NzK> bE-l 5 u[)4wPX|2T^tWBr8dY~),*NORQXZ@7&/$ Cy]K+93coIbDP4r!1 Al<߿{5[B0V xM8<giwndLsm #fGHUJ`'vh.p63':@,_}:?]9khGE%"ZY0(~AT{vjUp"M *&Hju Io}ny=<?mia=;f_qtsa6Q4  ]l sT |  #(  ".*d 5$ CWN0TWkj]gpuН8rWt@ [4 x }(X4XM` 6w|v0@(| H v04u8hL$$ W<߿]-lD;dsh Mx< PX_4$ nD (xX ` dP !  z@ h% ]pX X v0.\ t8`  3D@B n@㜠jP 0S  QX0S RR\0p4@ <߿Q@@-E@@,MvUP,Ѝ 'P8 `@( 0@p#@`cp0 @  ` PQP @ #0  @ Q` @ #  @0 Ql @ @- M`U @1SF]8FP@@@ (1/p$0S 3/,PUH0VP@,OUT4@EpW  E@@@+ q P ppP 0PS pP4m@]8FP@@@`rP0S x<@P0eP\ x @Pddp@-0F@@P80S  @8 P<6p@{@- @ .@E-\M@p`00 P0* R VP @PP\ЍPI 'pP P @\ x0 @ KP@zP?<@@]`]P@(0S 3/@pPP  <74 @ V`V  @I>0@ p 3R 0@-8F@@(#43 M@ @0@,P@,@PP H @Z Ѝ0@D,@ P,P Ѝ00@-J@@ M0S Ѝ0h@ ut#43 @0@@0FzP@t@@@PP H @+$ @P @" Ѝ0@D @O_Dd0@-E@@M0S Ѝ0[PP:><@@P8& @,0S0@QP#0 @ @)P @ 8& @@,0@@S b0@QP  <߿ @O=0& @@0@-T@P@ M@@ MO#3 @0@ @O@@ T Ѝ0/ Ѝ0@Q0@-@,50@D RHG0@-@D0XSH=p@-P@0FO$@@ @`<`D0SpH(8@-P0F@@@O' @P<PD0S8H4%0@ @A-M; P\ 8VpP@0@@DpT `@ QP 3/(@T PN70@@T $% @@P 0040@ R $@@@ @ @0F@@X1S(,50@^ $ @Ѝ  @@Ptp@PU ,50@^060@XaV  X@8V P@ D@P 1p  bR0l0 S]c00 0]]=0C ]0 PxO-M@@pPP,PP 5p0@SpP@-Pp]dhP@`@'#p30  @N@ @ @ @ @i1S }03/0S7tgpL`@@q3 0pkEPL FPI JEPD , @ @0S 3/~p@\PYP  ;@OP# _;j`1S PO80S 3/0S0S 3/@0SJ@@P|~V @B0iO@@m@ P` @@ k $0 @ @3N@`V@Q7 U@P $%@ @0X,@ @PU3 <߿`#0 @x` N @@9 ~h! @`, $ XP$QP@ TPP% TPP00@ T0Pi@ @ TP[P P@ TPPMZ P@ TPP? TPP3 TPP' TPP  TPP TPP  TPP TPP TPP TPP TPP TP~P TPwP TPpP TPiPu0& 4 '4@@D4@TL 8@@UD㴭dH@$=%㫊 P@@@@`@@,@0@ @@㪊B 0D 0L( 0(,0 P H((D000  R 㰝8@@ 2/P(@0 bj (@ 1/0PY@\@($㔔 j|$@ @@#L$0P@ 40@@$0g`,@8b l"@< @ Z 08@8~M<  @<  000S @ZP PX ! H$R 0 S R0S0S$ RL0^,Qj,PM{P0 (2/ 01PN \F F0 2/$0S 3/^ ,P,0\4 - @0S S+0X,X @4 `1S 3/X \ @ 0 ^<߿lQ  ^ 00S8V`P@P QP H@9K@T l @1K@TP Ѝ0CQC8< 03/0YJ@@G@<GZw t@_@^ ! % R R # #2 RR01S3 pğR 0S+ R(^ 4A?;BY 00SUN 0SUd^2 $ QU0S ( RUQ ,\U R, U00\Uv R 0S 0 ^UQ  ZUP  R; - U7P |Ѝ^0S  0(( 4R0PE`0S^U R^ # PPE` $0`U R D ;7<=08 @A:$B`9(>,?P 0YR0 ^PE`GPY%0  ^4(QPE`(E PI^y0PE`,0B R^ ^kPE`UPIPE`0F^RPE`O^U,O bP@PH3<߿ R3 .PA@ R%`/P/ 0 `/ Y!/0S R0 0`F R #2 PPPE `$Q0  4\PE`^?PE`U008@-P@^ @4/8u8@-@8?]PP l5 0@ 8 @58u@-lD@ @8 @QO-$M@T Pp`dVV000D0G SD@ 4/ @4/ W`FPCwp0w ``7: V8pVW3 0`p@ f4/ JRux0LLLLLLLL$Ѝ@@!4/V 0S VppW p @p4/VWQ PVit`g@P4/iVp P0@`Fć t$4/V@4/# 0P$R #b R{T@4/Z*0S S(@P4/Z` @ P4/ZPU  P @4/ `@4/Z P@4/Y ` VV0N `xV 0Fs0PS 0 ` ` P \ @4/Vx@P4/Vp@P$4/V @@4/ PR] @4/Vh@P4/V0@4/ % P$ R<@4/tVr 0@ $0dP$4/dVb`@P$4/XVV`@P&<߿4/PVNT0 @~S@4/ 0P<iS}  vL@4/0@4/+ @P4/%5-0@ b1P `V `@@@PETPP`V PPPP@=`#``@@P `V `P`%pP@?`pP+p@pb`(P%TP(@@ P `@ @@@`V PpPp`#pP@p d` `V @@@@ `V @@@@ `V `@@@PETP `V @@@@`V3 `0aQJ @@Pv `vs PpPp`pP@p d``VaPo @P@#`P@?PP`c ```-@@@,@@-P @.P `@PL-PU0aQ/@-@Ad@n@450@@*  /, `450@@-AM 0    Ѝ@;A-2`4@QAle%  @! `@`, D8v@p@ Pp  @@@p@@9@0p@@@@@@ @`450@- B M0  r p Ѝ@-A M@ PQ@D\P QA  ЍU6%@ @!0S Č 0 $Ā\L 70@U0  S @0S4 0S/ P(\ 2/@?p@P` rq#PPPRQRP Œ ,Ġ Œ @?H@?-<<߿ &p@-G@@P0S`$M@@/0\ 0 0@g. 0$ ` p`@ Q  T$ T0YY p@i ` KR`'& &`%|$t"P$$$t"t"t"t"t"t"t"t"##T#X@4 X' X* <Ѝ\YYI0 $0,- P Y0|030p  R Y r3  0  Y p 300 0Y0|030\ Yx0 ,00( ,0\0 $(00$4  P0 ̠  ,(  Ġ04,(04(0 Y | 3 =%0  P> 0p? p %00 +p0(pp((0' (mY$\ # 04S #" S 0  Y  =#0H Yr3 p 0p Ă 4pV  p(pppp   (  $  0(0 Yr3 04S10p pp pp0S[X  l @` )<߿@@q g _ R  0 0 p 0 YRw0S3 =0#p  0pp ?#000Y\R R0?p #pp0C0SS  =#p0  pp00z0(A-plEe@@`@RQN@` D $>0@0S0 0 0' @Q 860@P0% @A&`450@ 0   /j@-D@@`45 0@MAR\ Ѝ@C  Ѝ@- 5@-G@@MP%R 0R Q Ѝ Q1 Q`%@ 0pu`q`r g `@,,|,Ġ p  Q0S @%0@f<t@G<@Q<@$5 0@ 70@ R/G-UP@E@@rqP@0S 00S 00SCܥ. @Q `V>8m@`@0Z C\9  R+ 0  pHL =D0X` [ , Z [ Y Y p4$ (,0 Q  R! 0` P 0S Z20 ZPJp` Qq Q8 R0C0P RJPQ[mQSS|RmP U 9`P` (,8pP@D @> =T@ @4p$Hp0LX\XQ QQi SQM`pp` !* Z@p`p!xl' ` V pi`QhSQ` ` !l( X @p`hqTpPЍ/ [ ;, [ [2,[ k P$ $ ) $ +$ l, $h ($Y[ @([,   ZXY i$Pm$ ,p ,7X-X:4$ ( ZQ 0J`Pr044#, O-DMP @ @VP@`@pp|"`pTP@         (PP 0$ `T0 SS@cpP] P7 P P 0tp@0S00 Z P`Q  `TA P; k*P(,0S00p3 0 0 , ,p 0$t$"̠x ,'Ă0p$W= 0p0 0p,,  p,$ $"̠""CC  0Si 0Z & 2S"$p Q \ R P  ppp$@@`<!(4###0Pe `PDЍP 0y0S0p3l0 p$0 pp 04#̠|< ătW W $0SP 0ppRXSG0SZQ ZI`F 0S0p30 0 ,p00$0p,p  04  ć0p 444#| ,px,<'ă 0tWp{ W $p0S}\ 0 p0  8 0  8  , $  4 $ ,p$$"| , p'$4p $R pW $ R0S 0p  p0S 0W0WW $-R 7R 3<߿ 07 0  Z 0bP $0S0 000p03 0 0W$ p0pp R$0 p 0 Z 08 Z 0p8``0"@ 4/ @4/Y`pJ= 7:Y5Wa  W`ʐG@  4/ZY @ 4/GPڐ @4/0@ 4/jQ h|p@@!4/W `W&  W  0W pJ@pc4/0  /'@4/ @0S   0 ' @p4/  0 '@4/t@@-B0S  R 000<߿ 0,\H@"0008@0@-@S# p@-@Pt@R0S Q p@P @\+# i @U+# Mp@-GP@@`@4  ?#0P p@86A-g@`@P ?0#p 00pCP p|  0     680@ 8$P0$00@-@S$ (R@ @*# @t70@@-B0S0S S, RH@0@S  t' @0SS00 , R/H@/p@-tWP@BP P0 $ SSpp@cRO-M0P@04S R `tG\@@ rC \U \ Ѝ\P Q 0CS  @D*# 0SSO SV P ??Oh0J S 0  Bb   R P 0  P6  #  @,QH@\P Q CP  @) @ *# 4= 0@4= 0@ 0# @0 SS   //QO-` MPp$ @DTT000BX@5/ @5/DXXwwxwxw@ Ѝ@@!5/@5/  0%Y  Y@5/Z&    @`5/ X%<߿ V  @5/ X  @5/0@ 5/ X  @5/ jL 0$Y I @`5/Y Y  @5/X`  @5/` H@5/X`70@@-A0SS S  R x @ R @,Q x @E-@`WP@ pp0=# GĠ@ 0 0p0`  3 @00 <0<00S/E-@$`WP@( pp0=# GĠ  0 %0p0` ( 3x 0@0 8080@--@ ` A{ k{'8 pw0[%0'0zW$p&'@ AWPGP{&k* U  A{%@W* y A{%P r A{&@W :0o@0@-@S70@@-A0S 0S SpS0  S@@-A0(& SSQ  0@-@SS8 4R@B,@(# @(p@-R@@Q0S# P# p@A-@M`LP0S.P*JX* p /@0 |"AS"@^ C?ύ P"0P? 0SB 0`<S S ߍ  X @,$ C?[C,fꃏoY C" @X@2' @, &<߿@-rWP@`A 50  a400 0QA-`MP" /  @ @'w p@x 0=#HĠ 0`%004 U2܍/3 @0@  @'O-M@A\%\ ߍQ} Q~ S`PPJx @U1 PC㢟@80@ ( Q|L0WPL &P , C@&  #  V❯ %C"?$  ;    jP,\00Q 0# v, R x @0C@&@&>z;wR@- M0p@0p4SR RG@@ Ap0CaRTl ЍP @0+0S @ \&D@&# Ѝ@v`@ Ѝ@i& Ѝ@k Ѝ@# R R @00S @ 1&#  Ѝ@3vE7F+  02A0/NI 00/-x 0jMV 8M pNP@  ` @`L 4, b*p tB0 p (ǂ,n aL p  `$ (jp寿|O `  p$@p* 茊D @` p ` fj0J p  p  $džFO p  x k(yF p  p'霋D+H ){H, ` O`G 0pj ' ` p pp\)H pw 4"` F `fe8!  ̆<-O    ayJ !p ഹD!3<߿  4'befOp`  k@ @L pp荋Q^B  p `᪗  ඙N ` $ ]pb)/vM`  kƂSD@p `  `뽌㡈Mp` `(kᛋ  gN p  b  B `p   `f 7L p`, }  O `  kZD  aɆ J 0ap# ,O   `-ْoF  p ` k|*}Hp pB$plɆO   ap,qH 'p !g~"!*-F `'j (  OlȆ &  "4 D*$J, *(p/ g~+D ! ( ``檇໖O `' & pl b(nK*`( ƎᔂB "` p!ghjN)p, `,`zM (`,  mb(d@' `,9 Md" )  lΆۖN&  *pzࢯA, (0 ea଄L ' *`D$)O P`( lP*D @`(pPg{ৃ@ᔋJ` @*$`9P  \O @$P %i[eF@ ` P&,l @ HP `%` p}Dg{POO@`*4PѝᄕH @ `$` O^%_F @`P*l͂@,OP %` @ pg{J P `)@ࡁ PD@*`( ^%SWO @ `$ 5h͂P:K@ R `p$i{0ZB @`P $c  @kNP`@% P `@5Pp p08Ѝ/0O-PdM@!Sn 1```PEU p 0@S"0<߿ " &*.0 2p( Ƞx # ̌'0p,+/p30    |0  pp  !$0% (0p)4, -0p 1 ( t4,0$08p>BF6 J0:Np(7 Ƞ;x ? ̌C0pGKpO<4 05<  080 | p9p<@0=A 0D H4pI EM LpČ< H0pL@DPTRV SpW 8PTQ |U0  Ď4X\00/dЍ!0O-\M@ !7R8 b @P0T*.p&`2 X0 ("h ȠP ,#8'p <+P /|`3\`PP ̆0$` T!%4 `(p) - , d0 1pPP 0 ,$$`(0 FJp6B`N X7:0 (>h; ȠP ,?8Cp <GP K|`O4\`5P 8P ̆90A T@`=4<`DH dp E I LMp4P T80 <$@`DHPL  X0P,d,.| `#`3bYZp[]^ p_papbpcpf`epXP\g`d0\Ѝx b,80@!\0PQ S0/80@p- @T@ 1SF R\0S0 p/R@`TPPVPU`Pbx`FU`V RO T@ `V R`V`V`UPU#%<߿@ B0 0\ R@Q00*0S0S RP\ R@00Qr3R\0S R@Q00 O-h`@$M@ pሠ QT 0 XT X ^:  !RT^R T  ^T RZ  ^`T Q   0`$Ѝ^ R/ \ xLX\^; @DpQT\6 Q  P 0Qp@D0P@D`P@DpT  @^  p@D^XXp@DA-M@ p  P`UL 0,SM  P@S4U2 0FVS&DTP"VT00 (VBp @ `T6d80@@#@ @V 0@ @ Ѝt@ @\`S@) 0 @P S @0d( @p@$A-M` p ; @PT: 0,S;  @S,T* EUR L\PU8p80@P\,d @ #@ @\ 0l Ѝ< @ @0 @  0d80@p@0,- M0S R 0C\ LLh@ Ѝ" @@ |$?<߿ @p@Q! 0\ " @@ Q \ 4@@"S00 @d@P" 0 @8@,4 @@"S00 @40p@-PM S  N@@1 T @TЍp N@@1 T  ` 0` 0@ ^0ATTQO- M@P) `XX000pBW8@1S  @4/ @4/H`W $$$$tt ЍX' 0SpX"J@ 4/W0pJS @ 4/ZpJ @4/p J@4/ZpZ`iX XZڈ4@@@@j4/0K pS#T<                    Ԥ ԤZ  @`0"4/V* `@`4/ WV   ` @4/ @4/ W`@4/XwZ  Zpp0 lZ0 @. [ 04/ R @4/ R`,@`4/ @`4/@4/)~S? 0`i0@`4/p@-P@ Ad$,80@p@A-,HQ`@@Map0 S Ѝ$P ! ~p@!T0 0T08@h@ЍA0 r H @0  qTTA-`pXP@p@ Mp@  > 0@Q2 R 0SKQ80S P0SЍ0P  0!P   0!P%*<߿ )0!PP 0P!PPP 0P!PPp@-,Q`@@Q0 S  #@v80@!P \^0S  p@O-鈈@pPአ A0S:` P V 00# `0S V  f `P V  S `VG0Pe0P] ^ Nr0X 0 0!P`0`` `S xA % \Lq0 0x@ 0 P`P 0S  V `?Pe0P ` 0 P?0 P  `,80@.@- @Ad&#,80@@#`,80@A-,8Q`0@@Qp`n V V R8 0@\^0SP@AIP Q@AAG-1`,H@@p!L@@,Xpd(0 @@P@1|Xp`P@1000000100000000 `00000000000000000100 @00000000000O-H@@$M0`p ㈀ 0Q00 0就RV ^P PV@T @ R   0就@$ЍQ^* @Q^ 0`F^ PVQ^`F  ^Q&)<߿q@Q@Q-0 M Q Ѝ0 S  . @!T  P @T 0p@-P N@@T0 @0 T0p@!@-ph`@DM |XP@@A!0pSQ R \'  @c@  }\ @ DЍQQ@P0S C@<@O-$M|@P@ d(  @0@T  0PPPP PPP Pp㺀T$ XX0 CRꀵijij`0V0W  p0jSP@`X`q3 ZS ` RS 0#2⸀P Q``x @  U `X`0s30``ⶀ 墢Zt Zl`` Ut  RVP ]X0s30 U 0UP` X0s30y U 0D S{W W k 0$Ѝ`aWV  U  0jp] `P @ k0 SP @ 0`<0SX`P@ @Pp XH?` 0;W90  0PP p@m R=`VX8`B0CPsP@ R`/"P0 0   P@D j0t@@P@P'<<߿ p@`  00@P `Ƞx0L0V 0j T/@-p|` VPP` xN@@0 0;P@:8@-PV@P# 50@\ڰ@ R  0 S @8^ ^ 0 S 8@ 8@-XM@, aP0? @ XЍ@86 0@p@- M@Po X@PU^ xl@ @P4  P. P@\P Q5 P@< "P R2 ]P@@  P@ P܍p ,@x@a ,@ @ P @ P@P@D @@v (<"  <S P P//8@-P@Px@Q0S 0 QP8 x>0@^  0S@\ 88=&p38P@-@TO-MMP H,0PR 00L P L̝nN ` 0 P p| PU X9 P4 *P PU  0 P}<SLT .`PP@T` @Pp@'pL<S @H̝\ <0$Ѝۍx*WJ p  0z P \U(*RL R Pp0W  0a P \UPU @PK +^pLpP 0 D P |W pP@{\pA@\h(<<߿ Qqp^  pP ) R +\U0 pK  /Q +AXA@PP A6΍ A> PA@C\) P` ^TW Tp3x>@-0@AMMP0S @3/PЍۍGX@@@`P! p( @ @0 ^ @@T U ,e+@-x~p@MP0S 3/PЍGX@@@`P3 @+ 0 ^  @@@TP 00-S !S0 -R !R 0SU @P g@E-0G`@@XMP@VpPB U1 0S.P 0X@FP@D Q 0-S !S0 -R !R0SZ 0P0V 0S`Q @Ѝ Pp@-xN@@5 0@aR* @P" 8VP@x>\0@%  P P1 0Sp@ @ \0{PppP8VP@x>\0@,  @ R  @ 0@^[P  PO-x@,M 0 @P + P 0 0@S 0 S0S 0S ,ЍpÿpP 0S   0S x>0@PU @@@I/`P`  $ ׿ @Rq$ 0+S Sw `0wP  Ry P 0Sv ߿V /p ))<߿ R6  )<y  ,40q3C PU; @H@7Pk L@1P 0`!V@/s`P` RH* < ,0Ď ) ̎! P @*PU7ꈰ  @0$00x 0V ,, !$ <("ā?J{@ @ 0^ p @@BQ X  1  NP ^ \6PPPPPpPO'O-AM MpDY @0SB0GX@@P@TPN`PB sA΍ 0A΍@C@BT.Y'P 0P ,⎿ P@ P T+%@@Ѝۍ @f,@+ $V@T@-GAMX@@ M0p@4PP0 `A΍4+ @A΍ @0@PQ +߾P @P ׾Ѝۍ+;$@@@x>0@  @R /<@,x@-@@$0S @,㬾\@$ @ @-@$5 0@ O-M Mm(0 @p7@Ǎ}DǍxNtW@@X(0 @Q(4=0@0\ m 00@ Q  PQ Ѝ0xN@@ ,@@ @ R ,@x^ P@\ lU P@ 00S  P 0S/P\C @ @ ^ 0lp3 0  P 40@^= Q =@TPU X @@ @0S  @ @ @ @x>@-0@@AQ@t @x@Qp@-@0SpxN@@DPU 5/C\ @p@,Q  @ @2:40@@ P ,P@-M  @P x>0@H0S 3/ Rt @0ͿЍ@ Q bR+?<߿ t @m@$5@0@ 8@-xN@@@PU P@P8$%=0@ @PPH0S$ 3/ Rt @0ᒿ@ R @0ሿ@PU >0@^ @PP@P8p@P@ A-hM$ P% @T" t HP@#0 @ ti: @0@p@`@  p`@P [x>0@LhЍ(P#0 @ @x>0@P LRT R/ P @R/T R/ P @A-h@0S#U P@@T- x~o p@0S (P 0S 3/Q @ @@T P<@AJ,P . @Q@\Ax~p@@-€E@@ !0SxN@@xN@@P wI00@xN0@@PT0PLQ P0@L# p@-QP # Q xN @@@AnX QXpp@xN @@AX QXpxN@@$0S AX QXp ,@  A-#@ Q@ # Q  @A;pYS`1`#P@ 0  @簼x@1X pWXpAzpA-U P@re0q`@@`S ! R (P 0S 3/0Sx^P@ 0S Q^?  y00S*`V.@p^\ @ R9  , A@ @`,X`QVX`A$ A @`X`  @``l50@ R Q < @l@$%  @0$0mP @OPG-x~p@ `P0T S) U P@@T ! (P 0,%<߿S  R 2/0 S@0S 3/@T @@  Q GL@T P@@&O-@p`( R) 2S Rup eP 0StXXlX R @ 7/(@ (@] 00` @7/ @7/  T@ 7/ZJ ? @ 7/ Y 0 ` Y jj @ 7/ PʵS @ 7/QQ  @7/ ,  @7/ @7/X00@L @ 07/  07/@ 7/h@Zs0 3/m|@7/h @7/b8 @ 07/[p@-`P@5/@ +@ &>0@@T  @T @ @E @@0Sp4 0Sp8@-PT@P >P0@  @8@>@-0QQ Qp30 3/O-ԤԞ㰽% p@@@@P M @ 0S H@@(0S  `P  ЍP D@@(Q  `P @T@ @`V (^  `P 0 R @P (`V  `P 0S E @@@4@T R (^  `uP 0SPU`8@-@PzP(@0 2SB P8880@P/5P/и@-@0S 04@@@$% @0ҷ㍸-0<߿ @-@0S 0@$%@ @{8@-C@@PV00S .S {,`@@s @ @l,`@8-@-MMA@ 0$č @0S @ Ѝۍ@Ѝ/0& @@@ 0qA-/@CP= P㛷`P$ X@÷P- @㽷pPD $@ܷP@ 8/$%@ @U 0衶P @@@Ud@p϶P`P , @7 < @^  Z @ @㪸A-J@@`0S' i/ηPP)pP UH@@* PշUUeU@E耶Zi/㤷PPpX㚷P0@- MP@yQ  Ѝ0; ,0@@ @-M@ P 00ЍO-(v M `P@p@ H0S& 0 S>*0 Y6 V[@\Y< #Y 0 'Y"YgHpWI 0 SK* `0+H0`S ypP 0S8 \ @ͺW]a[ * ` (p@[# P a@QVtth\H[y 0 S*0V0 P \Px WH pRd 0 Qi*V00#P  2 qSWu  Ѝ0W0[pC p}00@\YH 0R  R* 0@[H1Q.3<߿  R* 0 @R H1[o   R{*  0 0 0 0 0DHP 0 S:wH[ 0S *0Q,eaxP 0t @ pH0SR 0 ST*0 ᱰ0 >0@ [7@H^B 0PD00@ +00@ S70@H 2R00Y00n0ߵ0w00I00^0 0g˵p `῵ἵ 0$ `G-4M@@@0PX @Mpe @ RJ @(@D  "RVE ЍdV R; 0@@0  0 @P'  * @ZL  @P R$TDhZD@  d`@ dRڤ@ 00+  @S 00C\!\d Qb 4(QR@ 000P  +  @00P000. R2 @@}R }R  " A"y  @@m\P @Q-  @ P A  0@ 0P000Qu}R @Pv @ @" @@$! *\h}R Ph   " @$, -  @@  @@wQV@TS @QP PLA 0P000?\C RO @QP-  @ P9 A  0@ 1<߿o0P000(@ "@@P "P @H-  @  @/  @@-  @@ @  @-E @@0S( R < Q 8A0S8@-E @@0S ( R < Q P8+0S] P@qP @BT = @@0@@ 8@-E @@0S ( R < Q 80S@C %@A- ˮ= P0@F 8V P@ - = @@@ @0@} e]Q@p@P@@@@ \ 0 0@/R/?@-@`p᫮TP P: D@00D2<߿)p@-P8PN@@`_ ,ኮnp?@-P`pီP@* ` O-pAWlM, (F$@@@$@< ,@4 R%R 0%SSP *P`UPpe  @R  0 0S *S  $`@@ @0`C0A@.S `BC6Q񟗜 TTTTTTTTTTTThTTTTTTTTTTTTTTTTTTTTTTTTTtTT <( P<[PP 0pF` U`K60PE p p.6[p tڤ6PI  I"6VP0p(0S SExEPL0L< `e dP TPᡭVP`TT@f@fT0SDpd p R 0S 0 SW`` H pfW@,0,c,00lЍP @ 0p`qS@@᩟PV0[PW \M`-0$S pW` pG0CCS \ T W pGCQ1t\P4 P<P( [PP8UX 5P `F<0 PZ0i5V&P$Fp\`p0U\`|@ 0V`@\pDw0PT < @ #̠ PP<.4 ă\\,< DP5V ]0F S0 WpW#B@ 0pG0SI Q  Q WpW!B@ pG0S5 W BpW@ @pG \0 3<߿ W BpW@ @pG0S \WpG%pG%Sl +P Y<  ( 0 = 0@ /@P >0@ \ R  ///0"0@!@-@P@ڄ@/00@1  /@/# @0S 0S//E-PP@p R `*b`@*X0@@0@P DP@ P@ P*0(M *b@0@-lO@@\M(0S. @Q / @l\!N@@0S @PU \Ѝ0h@P@P `P@($`?@hd/@-O@@\P0\?>0@-0@ MPK@D P@內P Ѝ0ب0S @ @-^P@Dn@@0`@>L 0gpPPQ @p@>L pMpP-@ M0S $ @P@@D 6P Ѝ5<߿ 0S (@A-_P@w80@xMX`Pn`@Xp@0@@ @h@X@\@l@p@t@  P0TxЍ@T Xh80@@P ` `H`a# n `@  P:@Q tP Q @@.*Q h@%n `@(4" ,0  弦P?p@-0@ MP/R  BRP/ Ѝp@0^@@@ @P@@ @ `@@@P  ᓦP1 ቦPߧQ @֧Q @p@- M@0^@@@ @P@@ @ `@@@  [P RP@P? P/ Ѝp蠧Q @ꕧQ @?p@-0@HMPL/RHЍp@`D Lo00 X 40$P> 0@S PiQ @WP@-O\MP@@`pT 8_ X/h80@R@ pP\Ѝ=@P wP Q @1(P,P0P4P@-O@@P?S8/RL/?0@R4@L/?0@RP0@-tM@l P㵦  @Y> 0@ 嚥P<(  tЍ0@@-> 0@?Hㄥ-M@M D 0uPЍȦ0iS0@- MP Ѝ0NP@@RD YP@0S $ @QR DHPTD APQ h@ꏦQ @6 <߿ <@@-@P>O0@ D PuQQ@@`- M 0Q 0" Ѝ@-MPЍ>Z0@H P4S SD@@S SD@@D@@@,,@(D@@@-$M .`P!@p @ @ P@@@@@@@pw0 1@嵤P@9$ЍQ@8@@Q P@@-p$M@ `P0 0 P000?' Ⴄ@T 㲤$Ѝ@G- MP ɤP-@` @ @@ p@@@@@@`  ⍤%,<  @!TT01PCPȥ Ѝ蔥Q8@XꉥQ Qx@K@m ,8O-|M# MtwJn@`@02 .܍PnL\PT;*2۲Qj @U1[ !R @U)!R* @P , , 0@p@-@`Pp^P@TV@ p@V@@- M@PpP Ѝn?0@`@WD 0OPU W ' @P gW' @P!Q @@)0@-P$M@   @g@0S> 0@" P墢P$Ѝ0`@0@-@ M0S Ѝ0NP@@=D ᇢP: D倢P@! 40@ʣ R x@@@-@@ M` R Ѝ^;P@D OPt0TKV @iS;p@:D 7P@@A-@p@`PQP 0A%E-  M P P``@ RD N@@@\`0#,$0P`PfVH PPPp@,P,0d`@0_p 4 +Wp. ^`P@,o`r 6(V Ѝ@,PN@@d `@0R D@00*p PU p@0#"0嘡P0S L@7Hh"刡pp@ (@@P|8$"DvPzpH +pB >0@Z,o@VB n`@  0S|d `@:D IPq@ʢ#@!=P0uꑢ0S) @%8<߿NN@@,P5 R' !@pzQ (@.n`@@ R;P,^ b\ @P=t@X@T(@O,@K+PP@-@0SN@@ =P )00 S @@N9P@@Ep +?p@ P  @@@O-< dM@ 0 `P;\P0H ᖠP4L@H) @\0n10 D\0僠PkPk @0` ᆡ0PO  00PGdЍL@tpE) @p0``1 ạ`P Qp峡Pʡ@\! L) @p0P  ឡ`P Qp嗡P  W H @j @dT @^x @Y8@-PP@/ @@0,OS PjN@@@008N.B@@CPJ > 0@P  ^p> 0@' +Up! Pp> 0@& +Gp # P4V$H @幟P&. @h8  @)p> 0@@ @ @> 0@P ᢤ(@p @?@-0@ /R@ \H .( PƠ0S @@PO-M``@ t@@p@T ^0P@`@d@^0 p@t@7x@|@  tAPJ  t:Pxw@@X/RJ9 <߿ 0 t0)PuXw( @\>@0S$ @^ ?0@QT?S Z , @P u@P ( @㚟P H @Vრ . 0T? LQ9 Q h@EЍ^Xh@0  \000 0Pp!"(0,0$0%  ʞP Q  @Q @ @ Q @00# <04 80A-@N@@`0PpS)U  @Q @PE0\4S Sp PӟiQ Q Q Q Q @At @U| @AA-Mp`ጞ@ @џ밞PPF 0T -ㅞ(P6  , P nUoOS ͍@Rt @(@T 70@PRQL @c  @㑟ݍ0\1,L ( Ҟ -@-M P`@ pT 0  S  .P Ѝ0 0A 0 S .^ ! 4E-e KM@@`@ M@ PZC 8P"0C΍@O@@0T4T属4$Ϡ@20@@8ĝ##0$0X?!P XD @\QR LЍۍ ` @0`_`h?d# P{p@ D ᇝP4' ၝP; P pttPF_P@!>Ec}C$ 0@-[dhDt\9lZ5D@͍ B>  0P@,# =P&,ž( @:<߿  .PD@h. @ {᪞lP.` @dh?PPll$@i,喞(唞a4QQPPR@-O4M@@T P 5 D\/-P @;S`5 D p@+1`Rڸ˝0P04Ѝ<;0 0008 10(04 10 (00 10,+000D$A-MO@@@XP@㷝P \z 0,8;0P5 D04@;<[ϜP< 5 D,k@ P@[ppP`P- @cP,k@Q@[P U L`E[pP @PP @JP $@T%_@P@T Xh@0 \00000 0$0>0@ p֛P 8XЍ2(0,00040 Q T@0@-\MPP @P@ 3 HќP ,  R@\Ѝ0@@E-@@@`0S^^~P@P NP10SX^ P@u`PS $ @\ -P0P S S S @Qꯜ0 S S S |@0S 08@-00@@T^P@P@,P ;<߿ Q @8@eP@ @P @8@p QT@-PCMP@p@ `@ <0 @\PCߍPQ @XA-@M`p@Pz_P@ ?S `Ÿ W p00.K. ;  "l' @ 0s> SZ s;0pwp@Q . @ 0S QQ QN 0S@᧚pPN  P5W t @  @Ѝ0@^ l' @0s ! >0@ R $W 0 0 W  RQ @ p 굛0S @ pW ؚ@@PA-@`0S*PNP@@@$ @0S9 `^`P@P峛?`0@,Q $ @^<DPY@\APOP@@@ ,R/N@@ P #$!0Q008P8# P&  P r bP8`V |@&N@@pyb'Q d@\ H@@4@P@-@0SN@@ P3P/P+@oN@@%O-MM~p@.2=P  <\務P L``VP2RQ @VsU P @Vj @P\C @Vb\ P  ZP+9#  OPP)TB* ( :㶚P @@@@i ' LL<<߿ LL.Pk  `"   P.  P̝ ) 00 _QЍۍ@V0 0  Ps  n  Ph 0) a P  ӘP^,Y  ȘPS,P)00x M @PA-O@@HMpL_U HЍ`D ᴙP P0P$ 0pP2  4N @U 变P P@4L_P L@kP @P( @P h@ǙQ 4@@PA-F@@MP`0S@5/P p@ 0`@`P5/Ѝ8@ 0p@ 5/О֞A-`> PA0@`P0 ` `D20SF (p@_S+.51,@  0S% _0S0!5 !p_0S0(5`0S  _S{!u /V 00`0S @@`ܞO- M(60@  ! p + ,@P@r{ bx wpv`%Rz,‡$B!b P@`p0L P7Lp:Q+ pQ"]FP@@@`^ 0P@ V 㽗`W 60@V`0Ѝ0@t0p, ,@ P @  r{ bx wpv`%Ry,‡$B!b P @ `p0L P7L  ppQO- MP=<߿@&` XX000pBW@5/ @5/H`Wiiiititi Ѝ@@!5/X$ڐpH@ 5/WpZ  @5/ HpRڐ @5/0p@ 5/gP`iX 0S~S@5/ 0`iXp XZ@j5/0G pS jlPm\l\k<߿  @ @ 4Ă Rq \ЍPUJ@\ @^0@Q@ P @!^0@"Q@# P@$PE_PUJ0\P@=0$ R@ %0 ^ @ % Z@%0Z0PS{PUJ @R500SS m0@0W0A-O @@M0S  RJ0SP ЍP`0P444P? 0@\&  RJQPPP P!P"P#0P_ P@\& $ 忕 A RJ`0p^V``P$\3%0`P^+0SR? 0@P R QP RJ 4 S{Sy r3w%0PXq%Xl0P`pA-O @@P0S 0  ` P`(d`? 0@X  pp`pPp  !``"#0o `@S? 0@P%0$P p$0S Q $0S $P0SP $? 0@Pp@-O @@P`UPV`P $ P? 0@Rp5ppO-KM 到B 㘓#0 @  p@Bt #@ @0  :0 h S T0a h`@ N @@P㱔JύHPPJX T0C HP@ @㞔0J?<߿ ,,p@J @@|耍 p Ƞ"  @T1"  @@1 >0@ @@ 0<   p$(,`0P48@D@@嚘KߍHPH@Th`hQh`@ T0HP@ T0@ @ V. 4,6@-0@@H R+H/+ @@<0 A-n `@@T0PST p@TQ T > 0@X( 0帎 @S* PQP R$\!0SPQ R>0@\ `TA긎 @ 0S00  0@R0 S @P AS* P. @^ @@Axx60@P HP@P @k+@A.О H֞O- M`X Pp@` X 8Vx@0`VBJ` P@0CS.T~}}}}} R0 `T^,`P0S Q R^P 0S  寒P V:@D 0@P`VJPЍQT 4S p0R \00\P bTQ0b 0$ Q  ` \@T \\ 00 \  @X 㪑R  \ @-@ 0 | h T p`PO- @$M@ X 0ZT/  ` / ` P@@ @  T \\@l 0 p@)<߿A^āD4tp@0Z0S `U  R`T PZ+ R(> 0@Q\P Z | R0S ^ \Q R00`9`i `$Ѝ\0- 0S0\P^ R\|" \~3 0Č ĞfX CC   Q00Z~ Zt S00m\i\d L0\`0 0卑0 l᳐ 0 0ZXP Q\F0^ $ 0@0TR-T0S3 0TT00R< 00A  0 S. P(#<0AA.$ A00AT0"r /S00 ` ` ` \:  0S 0  t0P0\ L0ڐP0 P'  u}0 6DО ,.p@-N @@0SV`^  P@0 SK> 0@P`` `0n `@S\^  R Q0SG\^ R Q0S\0T`> 0@^T T0T0  @X @忏pQ`^ P@ R Оp@-`lM@Pސl@ @ߏP  @Ӑ@ @ԏP (@Ȑ(@ @ɏP t@㽐t@ @㾏P x@㲐x@ @㳏P @㧐@ @㨏PU  A<<߿ @U< 0SE :S.S5P@R Pg (@0Q= T : " 0  dR `Q@WAq P`UWPE@.Q:Q\Q Ѝp@Q7A@U7PE0A00PE@0S\P mP 0S..(.Ġ @P00@@|@yG-`0S- RM .p WTP@@&1 @CtP R P:@!0 @@ 0eaP\00T0S @S S!Q:pP@ %@0 @DDă,L 8 ̄#445 @l@SP.ppS w#p@ @C.PpdWp@-MP`@P ᚏ@ 㫎0S 0;SSЍpO-UP@dM 0SE5@@0@ R"U8F@@@@UPT  0:dЍE@@ P @1 50@R P @R`q V@P G0h Pp@` %9 @0@H `Rv /Q0S % @ f`8.@ @50@QZt@H\P0H`cP0T` H[ `@ @`V \ @N@X IPl\ \PPO 0 EG  @7$@@_ 0,.SP /Q -厠 ^0xf&0  @0`r 0B?<߿  j@ (0 @<@@H X岍P f R L&  @\0 88h<0 o040 Zr \ ~m@)` ̍P pa vp@-@0SplE@@ QP P860@`lUP `P@p- @QpP . P-,`p@P( P`PqP!%(<"T4 P # `lJʠ\ # L^ # ##Ġ10`.0,`-0`/0`-`BV$ PV0FJ JJ 0\  V 0(r燠p,  ⊡Cp V@ 0kD:9/ P <60@P Q/ R/ P@/t@/@-@MpЍQR 000 0 ៍P   s0qp@-@MЍp@0Q Pa1 S S 0C0 P1 @-@PM  a@*ЍP /qp@-@MЍp@0Q Pa1 S 00 0P1 @-@PM  (@ЍP /@-@P P &p P P 0s 娋D ᑌ  00@-@dMPS*p  40SP 刋40  P 0^  0PƋdЍ0E-@PpP`V  v  ឋPC*<߿ P008@-0P@p  96BR 8P88@-`PpR@P 0 p 00@㈌A-@Q Mp$ @PPQ ` Q$@P-@Q&  0p@d' @ ЍQ  p 0  `@@O-PPPhBPx@.M㟉PxPp8 @tt0(P`ZE-@PpsP`V    GP qP00G-PP@M N 0@? 0@"QP? 0@"QP]`P@`Cp Q M@@40@@ Q+ M@@P@M$@@ @`l@4Ph`@@@U<@M@@up @-@@ ֆ |? @0@" 8G-M@` (p Pm5 4A/`6b  a0刀X4X^H^ 0S*  0HP 0 S*H0H0S 0S*H( 0HP 0G3<߿  S*H0HP@ 0 Sg*0H^> 0SH*`0W H0S7 0 SA*I0H\3 0SC*0  0M^ᰃPЍH0S8 0S(*  H0P+@:"IH\ bI^ZzV RNHPgH H0SkHHPoHrH 0ZH,jH(\O-_ML@HJGDA > ;852/ ,) &# T @SP l@ 心p +㸃p L㳃p +L孃p H0L@S 㤃p +H垃p8 @fZox p@ `@p@PP` H Z [8? HP[ 0 SS*@@0 HQd 0PSe*sxpp`0HZR 0 Sf*0HQA 0PSU*pqGd`0H0S1 0 SE*p0tH^OLPpHL"p2 `QDT T @EP`$@ p `PX@ B<4(,0 00 0R0SV{  [΍Wg  [΍8 0d`فPj@ x @0S4<0  1^ύ 0S00DS1  X H(P(p`( ^" Q8  0X ,ҁP, ``,$0H3<߿ 0ㆂL 5@0@ R@m$X ^  2ᠰ0S d\ \ @l4 <s0P 00s 0^ ⮂1  bVjl!\{X1bKhk{h[{5{&k: / S S y 40<S L@^.|`P| ^Xl@ 21   -0 @-0P  - @ 1^ύ,  0S/ ^.@NpP?x 0 PQ 00 '΍ @0P 0 @(0( jHP0S SS @1 i,P 0Sw SS @ c c|ꡁpW5 W Wpp0ȷ@(0ꒁ`V V V``  @ `Vlg`@a ΍00PA `@, 1H喁pWS 0P3 T70@(0p 1`$0.A0ȷ@(0@,~ȇ@( $ p`- @00`,  ⠲ 1gg`@Tp(`` 1p$c=0@,0 ⠂`1P`'T @( `p 1$`N  dPd@k4@Rp܀pH׀LҀsỳs1spp@ ,d @A@# @8@-@`NpP P p l@ lGP@@@ @㭂؀ . @ @(0嵂 @lW}P@p@帀y0P I&<߿@3@P @ D yO-j`@lG*@@M@0 0 00R0DP lWP@@$0 @VP @$UP@ ^ @P up@@ 0@R00, 0Sn 0"㨭 @@㠔 @'@p#c^&  @,(`(0T @@SV`  `V`0r030` @V 0(ST `@@( 0`ppl @b (+P\(Pl70@Y((~PS(0@ (RB Q? y80l @S D R% ~PR~PN80 MPQ Ѝ蠏 @ d :0PR  ~PKYZ00E 0 ~p0 :   ~PZ[t0 x0 嶷$~PBP @m80 PP }{ Q \H^$ l@p =0@Q0@ RHl70@P Qp 0S R p P# ^ t? P0@#0 @ @ ㆀLl70@P ^W P > 0@@(W0@ R& Q# ~p@ @~P~0` @@S Ps ^p Rm\ + <Z,4P{D Ru (Pp(0 WP~PX @(0 IP @(0  >P^0Q? @nm0 /P'J%<߿(~9H0S7l @q @@k8 Rq( @*P p@p _} ,4 @^$50@P~ P5 '~P  P @? @:| @300(  @+:0 0d  @#P~|L @wp? 0@P/QZ}l7@-0@4 R 08P<@T0@@0S |P }P *@P  @@}P"P}P @@$ @} @0S/f3 E7F, v0N0(I2A 000000000/-MP@ `x t0`p  |0 0p p ` `px`Π l t``Pp ` P Pp ` P @@p P@xJlP t4``4P`| $p$` P p ̊.x(t(`0P0p0<,p p,`P @@J\ 8Pp 8`P lX0` 0p T `P .|F ` 0P@ $  @p H`P   @ T @ ., $ P , `< (p 0p(蹠L!4 Dp8P+ !  ` @0 `)!P$Z ` %,@!P % P[@!` 0 %!` P (@%pP^!@ % @!` @&`! PpX&`% &P `@`P%!@ p  (80Ѝ/RA-P@M0S @Ѝ0S[ İ0 Rr lap@@V@pd0:P 0V:0V*?Q:? 0 Sp \ S S @b0x@S7Vw`n @ C%0 p`@ ?089p:`;@<=> B00<@yp@gpΠ@ W|0c@G ,0`08S`@y}zp@-P@ k 0!̠!d!`  ""Ġ"(   ""Ġ"(  ,,,,80 pp@-@@@PUyRyOyLyIyFyCy@y=y :yL*<߿ 7y 4y 1y .y+yp@'y ?A  1>  c0l1/O-EM, d        #  *  1 !0aP\A s@RA @VPC@B@PB @Aà4pVq$@PAŰ֒VR|PPց(@`SB0аpSrRƐǠ Ȁӑ`Shp`l@  $ 4p `@PP1 (0p !̠宣txps``PS@01QQҒ(ґ8ӒHSLӑPST@0à^ p^rނڰѱRېݠހ $R@`a P^QX@@4QRD<ܐpS` P0@`Pp @(48`$<`P@PDpHLp@P@` Pp@TX\`hl p`tPx|0 aQ6x,0P`pUC祓(p@@0s֑ V,ՒUՑU礣 $TԲ48TԱ0VC S>C S=C  S=C S %sModem hanguprcvd %PUnsupported protocol '%s' (0x%x) receivedUnsupported protocol 0x%x receivedUser requestConnect time %d.%d minutes.Sent %u bytes, received %u bytes.Waiting for %d child processes... script %s, pid %dSorry - this system lacks PPP kernel support OSI Network LayerXerox NS IDPDECnet Phase IVAppletalkNovell IPXVJ compressed TCP/IPVJ uncompressed TCP/IPBridging PDUStream Protocol ST-IIBanyan VinesAppleTalk EDDPAppleTalk SmartBufferedMulti-LinkNETBIOS FramingCisco SystemsAscom TimeplexFujitsu Link Backup and Load Balancing (LBLB)DCA RemoO)<߿te LanSerial Data Transport Protocol (PPP-SDTP)SNA over 802.2SNAIP6 Header CompressionStampede Bridgingsingle-link compression1st choice compression802.1d Hello PacketsIBM Source Routing BPDUDEC LANBridge100 Spanning TreeLuxcomSigma Network SystemsInternet Protocol Control ProtocolOSI Network Layer Control ProtocolXerox NS IDP Control ProtocolDECnet Phase IV Control ProtocolAppletalk Control ProtocolNovell IPX Control ProtocolBridging NCPStream Protocol Control ProtocolBanyan Vines Control ProtocolMulti-Link Control ProtocolNETBIOS Framing Control ProtocolCisco Systems Control ProtocolFujitsu LBLB Control ProtocolDCA Remote Lan Network Control Protocol (RLNCP)Serial Data Control Protocol (PPP-SDCP)SNA over 802.2 Control ProtocolSNA Control ProtocolIP6 Header Compression Control ProtocolStampede Bridging Control ProtocolSingle Link Compression Control ProtocolLink Control ProtocolPassword Authentication ProtocolLink Quality ReportShiva Password Authentication ProtocolCallBack Control Protocol (CBCP)Container Control ProtocolChallenge Handshake Authentication ProtocolProprietary Authentication Protocol%s: timeout sending Config-Requests Received bad configure-ack: %PReceived bad configure-nak/rej: %P%s terminated by peer (%0.*v)%s terminated by peer%s: Rcvd Code-Reject for code %d, id %d08@HPX`hpxCan't parse '%s' as an endpoint discriminator code=0x%x id=0x%x <mru %dasyncmap 0x%xauth MD5 m$oftquality lqrcallback CBCPmagic 0x%xpcompaccompmrru %dssnhfendpoint [%s] %.2x> magic=0x%xBug in lcp_addci: wrong lengthReceived Protocol-Reject for LCP!Protocol-Reject for unsupported protocol 0x%xlcp: received short Echo-Reply, length %dappear to have received our own echo-reply!No response to %d echo-requestsSerial link appears to be disconnected.Peer not respondingassertion lcp_echo_timer_running==0 failedSeriP <߿ al line is looped back.Loopback detectedLCPConfReqConfAckConfNakConfRejTermReqTermAckCodeRejProtRejEchoReqEchoRepDiscReq-allDon't request/allow any LCP optionsnoaccompDisable address/control compression-acSet asyncmap (for received packets)-asdefault-asyncmapDisable asyncmap negotiation-amnomagicDisable magic number negotiation (looped-back line detection)-mnSet MRU (maximum received packet size) for negotiationdefault-mruDisable MRU negotiation (use default 1500)-mrumtuSet our MTUnopcompDisable protocol field compression-pcpassiveSet passive mode-psilentSet silent modelcp-echo-failureSet number of consecutive echo failures to indicate link failurelcp-echo-intervalSet time in seconds between LCP echo requestslcp-restartSet time in seconds between LCP retransmissionslcp-max-terminateSet maximum number of LCP terminate-request transmissionslcp-max-configureSet maximum number of LCP configure-request transmissionslcp-max-failureSet limit on number of LCP configure-naksreceive-allAccept all received control charactersmrruMaximum received packet size for multilink bundlempshortseqUse short sequence numbers in multilink headersnompshortseqDon't use short sequence numbers in multilink headersendpointEndpoint discriminator for multilinknoendpointDon't send or accept multilink endpoint discriminator08@HPX`:invalid address parameter '%s' for ms-wins optioninvalid address parameter '%s' for ms-dns optionunknown host: %sbad local IP address %sbad remote IP address %svj-max-slots value must be between 2 and 16local IP address %Iremote IP address %Iaddrs %Icompress old-VJaddr %Ims-dns%d %Ims-wins %I/etc/ppp/ip-down/etc/ppp/ip-upCould not determine local IP addressCould not determine remote IP address: defaulting to %IIPLOCALIPREMOTEUSEPEERDNSDNS1DNS2/etc/ppp/resolv.confFailed to create %s: %mnameserver %Q<߿s Write failed to %s: %mPeer is not authorized to use remote address %IUnauthorized remote IP addressLocal IP address changed to %IOLDIPLOCALRemote IP address changed to %IOLDIPREMOTEInterface configuration failedInterface failed to come upprimary DNS address %Isecondary DNS address %Iinvalid netmask value '%s'noipDisable IP and IPCP-ipnovjDisable VJ compression-vjnovjccompDisable VJ connection-ID compression-vjccompvj-max-slotsSet maximum VJ header slotsipcp-accept-localAccept peer's address for usipcp-accept-remoteAccept peer's address for itipparamSet ip script parameternoipdefaultDon't use name for default IP adrsms-dnsDNS address for the peer's usems-winsNameserver for SMB over TCP/IP for peeripcp-restartSet timeout for IPCPipcp-max-terminateSet max #xmits for term-reqsipcp-max-configureSet max #xmits for conf-reqsipcp-max-failureSet max #conf-naks for IPCPdefaultrouteAdd default routenodefaultroutedisable defaultroute option-defaultrouteproxyarpAdd proxy ARP entrynoproxyarpdisable proxyarp option-proxyarpusepeerdnsAsk peer for DNS address(es)set netmaskIP addressesset local and remote IP addresses    user= password=PAP authentication failed due to protocol-rejectPAP authentication of peer failed (protocol-reject)No response to PAP authenticate-requestsRemote message: %0.*vPAP authentication failedPAPAuthReqAuthAckAuthNakhide-passwordDon't output passwords to logshow-passwordShow password string in debug log messagespap-restartSet retransmit timeout for PAPpap-max-authreqSet max number of transmissions for auth-reqspap-timeoutSet time limit for peer PAP authentication>, name = Peer failed to respond to CHAP challengeNo CHAP secret found for authenticating us to %qWelcome to %s.I don't like you. Go 'way.No CHAP secret found for authenticating %qCHAP peer authentication faiR<߿led for remote host %qCHAP peer authentication succeeded for %qCHAP authentication failedUnknown CHAP code (%d) received.ChallengeResponseSuccessFailurechap-restartSet timeout for CHAPchap-max-challengeSet max #xmits for challengechap-intervalSet interval for rechallenge08@HPX`@Linvalid parameter '%s' for deflate optiondeflate option values must be 0 or %d .. %ddeflate option value of %d changed to %d to avoid zlib bug%d,%dinvalid parameter '%s' for bsdcomp optionbsdcomp option values must be 0 or %d .. %d(none)Predictor 2Predictor 1(old#)Deflate%s (%d/%d)Deflate%s (%d)BSD-Compress (%d/%d)BSD-Compress (%d)Method %ddeflate%s %d method %d check %dbsd v%d %dpredictor 1predictor 2Lost compression sync: disabling compressionLost compression syncCompression disabled by peer.No compression negotiated%s compression enabled%s / %s compression enabled%s receive compression enabled%s transmit compression enabledCCPCompressedResetReqResetAcknoccpDisable CCP negotiation-ccpbsdcompRequest BSD-Compress packet compressionnobsdcompdon't allow BSD-Compress-bsdcompdeflaterequest Deflate compressionnodeflatedon't allow Deflate compression-deflatenodeflatedraftdon't use draft deflate #predictor1request Predictor-1nopredictor1don't allow Predictor-1-predictor1allow-ip argumentgroup %s is unknowncannot stat secret file %s: %mWarning - secret file %s has world and/or group access+ua file nameunable to open user login data file %sunable to read user login data file %suserpasswdcan't open indirect secret file %sno secret in indirect secret file %sauthorized addresses--/etc/ppp/pap-secrets/etc/ppp/chap-secrets-*invalid address length %v in auth. address listinvalid address length syntax: %vunknown host %s in auth. address listinterface unit %d too large for subnet %vCan't opS<߿ en chap secret file %s: %mSecret for %s on %s is too longNo network protocols runningFailed to authenticate ourselves to peerAuthentication failed%.*vCan't open PAP password file %s: %mno PAP secret found for %s@loginPassword for %s has expired/dev//var/log/lastloguser %s logged inPAP login failure for %sPAP authentication failure for %sLogin incorrect%d LOGIN FAILURES ON %s, %slogin failedLogin okConnect time expiredBy default the remote system is required to authenticate itself(because this system has a default route to the internet)The remote system (%s) is required to authenticate itselfThe remote system is required to authenticate itselfbut I couldn't find any suitable secret (password) for it to use to do so.(None of the available passwords would let it use an IP address.)Connection terminated.Terminating connection due to lack of activity.Link inactive/etc/ppp/auth-down/etc/ppp/auth-upauth_withpeer_success: unknown protocol %xauth_peer_success: unknown protocol %xPEERNAMEpeer refused to authenticate: terminating linkpeer refused to authenticateNo secret found for PAP loginLCP downauthRequire authentication from peernoauthDon't require peer to authenticaterequire-papRequire PAP authentication from peer+paprequire-chapRequire CHAP authentication from peer+chaprefuse-papDon't agree to auth to peer with PAP-papDon't allow PAP authentication with peerrefuse-chapDon't agree to auth to peer with CHAP-chapDon't allow CHAP authentication with peerSet local name for authentication+uaGet PAP user and password from fileSet name for auth with peerpasswordPassword for authenticating us to the peerusehostnameMust use hostname for authenticationremotenameSet remote name for authenticationUse system password database for PAPpapcryptPAP passwords are encryptedprivgroupAllow group members to use privileged optionsallow-ipSet IP aT<߿ddress(es) which can be used without authentication+ # oops: %d not %d %s %d %x??????%s %q # (from %s) %s xxx # [don't know how to print value]# %s value (type %d??) # (from %s) pppd options in effect: option list entrypppd version %s %s: %s plugin file path/usr/lib/pppd/2.4.1Couldn't load plugin %splugin_init%s has no initialization entry pointpppd_versionWarning: plugin %s has no version informationPlugin %s is for pppd version %s, this is %sPlugin %s loaded.Can't open log file %s: %minvalid numeric parameter '%s' for %s optionError reading %s: %mwarning: word in file %s too long (%.20s...)%s%s set in %s cannot be overridden %s%s from %s overrides command line%s%s cannot be changed after initializationusing the %s%s requires root privilege%s%s is disabledthe %s%s may not be changed in %s zero or%s value must be%s >= %d%s value must be%s <= %d%s value must be%s between %d and %d%s value cannot be increasedoption argumentsecrets fileIn secrets file: unrecognized option '%s'In secrets file: too few parameters for option '%s'command linetoo few parameters for option %sWarning: can't open options file %s: %mCan't open options file %s: %mIn file %s: unrecognized option '%s'In file %s: too few parameters for option '%s'call option value may not contain .. or start with /call file name%s%s/etc/ppp/peers/ttytty init file name/etc/ppp/options.%s/%s.ppprcdebugIncrease debugging level-dkdebugSet kernel driver debug levelnodetachDon't detach from controlling tty-detachupdetachDetach from controlling tty once link is upholdoffSet time in seconds before retrying connectionidleSet time in seconds before disconnecting idle linkmaxconnectSet connection time limitdomainAdd given domain name to hostnameTake options from a filecallTake options from a privileged filepersistKeep on reopening connection after closenopeU<߿ rsistTurn off persist optionDial on demand--versionShow version number--helpShow brief listing of options-hlogfileAppend log messages to this filelogfdSend log messages to this file descriptornologDon't send log messages to any filenologfdDon't send log messages to any file descriptorlinknameSet logical name for linkmaxfailMaximum number of unsuccessful connection attempts to allowktuneAlter kernel settings as necessarynoktuneDon't alter kernel settingsconnect-delayMaximum time (in ms) to wait after connect script finishesunitPPP interface unit number to use if possibledumpPrint out option values after parsing all optionsdryrunStop after parsing, printing, and checking optionsEnable multilink operationnomultilinkDisable multilink operationnompbundleBundle name for multilinkpluginLoad a plug-in module into pppdpppd version %s Usage: %s [ options ], where options are: Communicate over the named device Set the baud rate to : Set the local and/or remote interface IP addresses. Either one may be omitted. asyncmap Set the desired async map to hex auth Require authentication from peer connect

Invoke shell command

to set up the serial line crtscts Use hardware RTS/CTS flow control defaultroute Add default route through interface file Take options from file modem Use modem control lines mru Set MRU value to for negotiation See pppd(8) for more options. #2$FW6etHZӾl~3"V,Gu>dɜ@ۿRdv!0&gv4DUJüXџn|ك1 w.fT@R+:dN_vm|$ÿ6H ;Z*^lO}~l .ǟ䩐 2ZLKy^hh ?z.ĕ*8FkzTHYb-/VB* +H? `4_@LXdpq|đPБܑA $0<H>T:`YltxEA4p%̒ؒu!h ,8VDnPP g\hKt}T0 <߿ȓ,ԓxIS*("4$@Ll }X dgp|Wa ĔДlܔ6: |$X0M<HT~`+l xmemcpymallocabortcallocreallocmemsetfreelibc.so.0strlenstrncasecmpclosedirsetsockoptstderrfprintffstat64forkstrlcpyreadlinklstat64writebind__errno_locationopendirmmap64getpwnampipe_exitgetenvreadstrerrorsetsidsigemptysetfnmatchrecvfopen64strsepsnprintfsymlinksigactionchmodselectfcntl64sscanfusleepsprintfwaitpidtimegetgrnamrenamestrchrdup2ioctlstrcasecmpstrlcat__uClibc_maincloselogsendtosetenvmknodfputsgetpidstrtoullstrncmpmunmapchdirunlinkstrcmp__ctype_balarmsyscallstrtoulstrtolreaddir64vsyslogsocketchownopenlogexecvputenvstrcpystrstrumaskclearenvfclosemkdirstrnlen__data_startrmdirstrrchrgetuidsetpriorityatoirecvmsg__environ_edata__bss_start__bss_start____bss_end____end___end  V     $(,048<@DHLPTX!\"`#d$h%l&p't(x)|*+,-/0124678:;<=>?@AB <߿CDEFGHIKLNOPQST UWX[\ ]$^(_,`0a4b8c<e@fDgHhLiPjTk -L-/ƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 09`GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF0 R  / @-0S0S3/00//0 R\//\//R\/\0 S/P P P P 40 $0  00 `! p@-MM;pP @| `pV0\0P *H P:?P0@Ѝ<߿ ڍp   p@-MM pP @d `AV0D0P )0 P9 Ѝٍp   p@-Mp@#  P`V@ t@PP \ PL0 0 0@(PPT@ٍp  @-MMLP,`g!,o!,k!,pf!@0 P # 0/R  @S:, I!x, Q!p, M!,p H!@0 P # 0/R  @S:V V= 9L i/cP/ڟ- * 0@P \P @0 T@P NP @`0TVL   P wЍۍ.  A`p@-@H00D00 0S 4!P [@P P@-!G-Mo P@1 29 B  B   x@`@@P@P`E A~p  /{>`P19S.00SW&'  P    , d  ,d0  0 S00002P`PUUߍ4 O-WM4`PP@E Z@0=!  3 B@ 0Gip% p # [V? PK) S?0U/R?0l >.P H1 SW1RS@TV0SoWߍ! !!-(0@-0P  K @ Ѝ/C-M@pP$ P.Q<߿VT PPPMK ]# PU7xp 0ЍCЃp`0@4 P p`0c0PЍ`'!3! I!f!,1G- 0SPP1P1@p0`U 40PP0$0`Z X-P8Y P xP P`T0V@p@0T cP` hpO-M M`<P@3t$q zP  uP pP kPH> .0!@T`P >w]n PT4p> @P`i] tOpAj  .00 P 3\-0Q00pFp 04 4+X lThpp0bS=8 4- ,@#,0! 0p  zP0,000L< |@,@ mPU @P8@D,Y<,a$i/@P 9Y gp P @h+0H v@P T ~H*0- ( < Q@Pf*0 KPS|0  P+P@ih0  P 3\8<߿ 0)@[+oP_ 983C2 3   O;P )? 3&Ph(X(0H *P  F9$9 PB! ,$ I|($0P  0P0ƒ100pI,(0y/8 ((%<9 Q   0R R 0 /0S(͍00 ͍͍ R  200@ 0@P tP d&0!w͍0"! 023 Io8P 8dm` |T0G> 0L40P4F>0T40 X4dP@Pf g0X4 ST4S  R dS0S TP&MD P4(&0X0F0CS9ꈬĬ<%0H00%0H0(\0%5\ |\\0l%\0$0\0pL%\00 X0%00D%5"! 023n  ,0P Pd $0q]40e[!0L`LP ep@PL   `(@, jppP( D@P 4BP ppQ  :P ppI  2PppA  *P p p9  "P D. Pp8p&  P! t P +,H P   P <P4(0`(X<߿ Y00,0  0 Ơ" $ ", :#:  0`"! R0 8 VR\  `0! `0PQ0S 0SZ! PP PN h!1~m`# e<0Sf h'f="!!!!!!! !","C" `"t"""", #)#O#g###.#####$ܖ=A$$$$$$'%3%K%x%%H %% &6&d&&&2'\'}'X  ''''''''''' (h 8(P(((pT( | (h`/)R#AL80 L*@0"! 023 ,x@ P&=0"! 023 - _PP 0  PP! S0 01 $M(A0S 0 0 T1 R6   ,`P-ڄ4 <C4 0<<S „$041T@0SЃ` P0"0c0 P2 L*@42T@2L*R L*H0Sh20S! @t 2P2P2P2 P2PfЍۍ 8@' ,H,P@P8@P~8PT,1h,9ti/mPP /@-p``:V&Z#: $pF^`P@ 0@-@ 2P 0 0'P  Ѝ+l)@-@i{ @n@-@P .i>066{>077=077<߿00> 7jErAm+{>O-`4M@PU A^PP PIyW*TUR `P  P `0$ 0bPPV vi0┆ 0 P 040 40 X p WqpPAPPR9S t#cPIn`_P 0PP#`S[Uf pP P #0A d  #  PP= tP  p PP \H" 0   떯 jPP P m! 0|Z*\U[0x! / PJ PP,   D 85X( A P" P 9SpW `PUI,49S |P *9S 4 P4Ѝ r)))H) *y) *\)<*#*Y**P****59O-MT/@P`Py @(("2`s  d`  Pp150 51:!1`MYHXU 0Რ Y@ !>1H @000 0SH  =S00010@ ᳰ "Q5 wP0  P ,  P ,/@ @P @ !0pPU: ߍ#S<߿00@ 0`@+*7+h+r+}++@-1.+0 @ 00DP P=P h,\/8h2P 4,(/D(P0+++++++ / 6:0/0S/@-inGM`MPPM /F:00!104P){>  C΍LQP  0Q0 J;SD/P p,3\,/@T@ 0S , )tЍۍd,j,,,<,A-pGMOI^PH!H1P04P {>  C΍LQP  0@3o 03@P) yW0 pW`p p ?`M`02V/'P <Gލd,,, -'-/-V--O-`|M@PP PZ ZP 00%  # SR44!0 P !0 0`P p p /`P | 0P`WZ  P @ 0L`|Ѝ1-0,-- .*.G-MMcnI^`P<%<5@P0/38P j^`pP  480S upr^PM`P  480S <`{^Հ o pcHH$700 p`;S 7` <߿ +Pc 9SP  P %P@ 90c>0#;SP7 9Cc>p#0P3{>3  0  0 :#:,(؂p` Ă 06 *6$ 0"  0P9UiPC/4Vcn0`082,"038;S/P  `4b 0/P `0Q`` P /S,E`0SI cn,`8x\!0p8؛Y24 ,Pڃ@ bPp !0c~po 0`4P U~p 0Cn`c,,PUxCN@ X 8Ѝۍd,m+K.@,'-..-../*/P,c/<,0S/p@-`@P< 0 @R/  0S:p.p@-MM@*`*PP  0'/0* 0/ P 0S .S  ,0 @R/  0S: ?ߍڍp///O-MM@P*R*ZP "0C ^P 0S .S |p@P"0@0+R0SP 8*4: S$k!`% P<@TP _!0 T  5GSS-<8 `P2 Fo4!0* *40NSp SS <߿  W1#J r< 04JP  p`*0x03V0#SXk @@ !TAߍۍ///d,00=0^0p@-,@``X,,P@0 P # 0/R  @S:p/;@-SM@jpP P  P 9S9SiIPK ((!0 `PP  0L2I. 'f !`V7#Ơ.ʌ 0.*0)R l )R Xg D`VGߍ0/00000000O-@QM M`,"^ SJ`P Bk4: S #B~ ~P Q`@I,!J8(#0,  `PiI /   50A0CPS񟗔l@@@@@@@@@@h8@@@, Pp1|#pG &p04u Pp1|#pG  Q. 0pQ.tC Q>%5Ơ p؁*0"*$ 0 { D P1#H pQ  $H 2 P1#H p Q΍04H " P1#H p Q04H|  P1#H p Q.  $H P`VZ: )4SGߍۍ00/=01l)@-M  Q @܍00/ 0 0000/  <߿A-NMMLPp,,`,,1PPU P`1Ue@PL /,|`P;4* R ,B> PP0N>0d@/ sP' _ R  R   pP[ xXX N>0`H oY `bЍۍ.A- `P@,pPU  JW  D/+P_ :0!R  0 R000 p  A!A-MMK,/ 3@ \P @3[TL,, (`P8: S5 , PPچ>0hh@ P`  @PP p[/P p0W0,,2@ P @2Tu@P x" 0 PZX `P _ /P` w Pm  PRl,,, ,-Pʀ,|,, ,P چ>0h@/ QP  a|,\,d,` , PP#چ>00h8@/ /P JP9P =Pp )A@hЍۍ.. 61>11F1P1U1`1h1n1x111E-PMUMpz ` P  P  PgK,/P] P[ 00|0PT h+P X P/ <߿ 0P P  <L,,, ,f P+<@ 0 0P  ,`/P 0`0 VK\,,mPߍۍF161>11111..8@-PP eP@88@-`0@P@P80T@P}@P 0T8@-TP ,DJ</< ,,,B$0  0011 / 6:0/@-`0M0CS@0 >, p| PP00P0PS S UpߍO-mMP `@i   P Pp150 51:!1PTJZP 0Ჰ R !> J\CP$1 <000 0S1  =S000 0Ჰ "Q 'QPQ0 0Q    >  p@ 0T:ߍ#S7+1O-=CMP.M 0@p 0`p$S'0Sl $S ,g  c `N00| $P$@ Q6%S40SB %S , =  9`$004 0 0 B P($034 Q0$0 0 R`0S 0{S}xP  $ 00, $ 0B S<\  Q  <߿{>{>( D9S Z) B  uP"2 0 R   X( , ,40+SH  PB Z\\"P 0P P P (,w  ePf( ,l 1! P01jS Z0C (, 0Pt!e(p?PA bP> MPI L G2̇X{  0 0 0=0ˉ v:7Z P0lT $0y0 0  4Ѝۍ132:32e+_32333O-PMA>M  0@Pg0  ?P_0  ?PW0p  0PO0T  ?PGI>8 O/0P`p <00CSJ B"8 P0|P) p0X$1SG A,( p , , d,  , pa Ppg  (0pA P 00'0upW0'k$1Sp9,00CS34 0sP a ? P D7 0Y00   00jP 0Z@00  B"a>, 0P p(0X04p00hx004 ?PX4| ?PP4` ?PpC F00CS<  ∐P  P2 a FP 5 <߿ Y0  09 0  jP  Z@  B"a>X 0P p0XP+1S6 a,  ,40A~S00p0  0B/0<P1S{ A,[ ,1S>0030pS000 ;# P_(;pRS.  aP <<#0;E(!M8S; pP7 00P03 Pp%wa   =sP A7 P  0 p WpWp 1Sb0S̰a    I  qPpB p0Y,0S6A,40 ,  , , )P . P 0  0p `(0W$Ѝۍ333*3*-!3.32"4P4 Nr444444324420044@-@p}{n`|PPC <1SD1S`1SL1ST1SKPh1 0? C09#7S1S 0CSph 3  1S h141S 8452?5O-@Mr(ij>I{00 0PP 0S <10CSPh1 0?#0909da<߿ V pP 3Si7S\1S `1S07\17 7SL1S S0 7P   '7ST1S S07X    6SWD1ST S06D10CS" H`,} ,J0P XH"P2`0`  0 !m  -10  `Pp0S !0R  <10CS@,2 ,0P ,!80? !10 07S1S S0710CS     h141S 8" 0S ,X4 07S  :07ߍ531R53i5~5?5500/0P R* l . //@-@PB008@-{'PP P}!@P00 P8:36A-@Ppl10p`l l10`laE-@P`gQtt pA! 00 G'l1 0lhl10l000l6,6O-NMMM.M  P  +0X [;$ 0 0CS   S31%#4%(+%*\^ @ T N^@xDP:N.pxrA7@P* 0P $0(Px0(P, 0 <0PB_@ D0.G?HPI_L P0K/M?TPO_X \0Q/S?`PU_d 0 P hPp04P< 80_   *rpP0Sh 9P0 ?<߿ ,S SZ 0SW =S +S !S :SP0 S@ =S0=SP`!S0=S3P`+S0=S+P` =SP`:S!0=SP`008 P00 0Q "Q P00P 0 pP W 0FS @  ,xP 0FS 'i$ gP 0FS ( 0a VP0FS , HP 0FS h`0'05A H P `0P $ P0Z %P  P0FS 4 P  P0FS 8 P0FS p \ P H P 0P $p P<  P0P _ @P (P : PDb P0FS DHT t fP@pP TP1DP.4P0)hp,} hp/P00P ,m,u PFhPx4@ 001L p hPP X aPT @ ZPX ( SP\  PvP .P0d1 (Ph10h1` 0y< 0Pd )P  0S ${P%vPM 40S gF^P E P  0S $UP%PPM 40S *<߿ F^P   lP `a\ @P4,Ph10h1Ph10h1Ph10h1P0d1  0l1^ e 0l1PPp 0 #0PP0\ 0P0Y":Ѝۍ#P/6@666L637*#73A73^73~77774 884.8284S8q8x8888848888068+999*-9.9<9D9 J9P9U9]9g9u999A- xMp@X @PP60: S P-p pt p@`P P# Qz\\ 0 0@00<00j@`p0TxЍ99\6 @-PpHV*@@0@0@P l1`n`@00/7@-P00@PPP@@ P44 0"  0>:95:7@-P00@PPP@@ P44 0  0>X:9x:8@-P@ 0 0000@P8 E-pP@ W`Ph 0bP U`P@ @0 02n:E-`p@PjP @TZ_PX@`PP P,BG-M@@PP Ox 0#P 0S .S#S  .P $pP`)<߿ < 0[ r@ߍ::d,@- @00S T P @P ,P P : : 0R/ R/ R/ R/ R/0S/@-@PM P0 RF0S0@S?0000000 0000\#?3 RS S S S s  RS . 6 R ,C BR8 #8S@-P`@A A00A SRa0ASHP @P_0@@P0pQ:8@-@Pt@0@0dP80TS 8@-@@P , P p3::(0 \ \ 0\\S:b/e@-`|MP@PPG 0  @0@pp6@000|Ѝ7@- @qP ' 0lP d\ 0PPP U $ 0>::;-p@-M@/VP0@0/OPPP `P V 'P  0aߍp:;:@-M /, @PP0  s/Q 00 P2: S @P ߍO-MM 06@0.^.P ,  yP\P` 'Rp0\"! 0R3C A "Pʠ `Ylq c@"0g 0XhC` `V*  X," 0`@A>0< <S0S !0-P` P5>"! 0R3- A^P!Pʘ ?0Y< <H!0 08I\ <S0S 8 0PP<SCʘ,R@ʠ P P X ,0R0P  < <C400D <S@l( 0z@ЍۍT;.<d;;;8#;;;;</<!F<a<x<<A-MMpP k`n @y` ; 0 `p.g &p00 R W0#03:+ ` `,<< P0P``xЍۍ<<p;00S4\R/@-0@@T*PTQP040d0S0 -L&<߿ udev_event_runmaininit_udevd_socketinit_uevent_netlink_sockget_ctrl_msgget_netlink_msgget_msg_from_envbufudev_done/proc/meminfoMemTotal: MemTotal: %ld kB/proc/statprocs_running procs_running %ucpu.udev/queue.udev/failedaddsocket:/proc/proc/%s/stat%c %d %d %d udevd-event%s: seq %llu finished%s: fork of child failed: %s%s: seq %llu forked, pid [%d], '%s' '%s', %ld seconds old--daemon-d--help-hUsage: udevd [--help] [--daemon]%s: unrecognized option '%s' root privileges required %s: root privileges required/org/kernel/udev/udevd%s: error getting socket: %s%s: bind failed: %sanother udev daemon already running %s: another udev daemon already runningerror initializing udevd socket %s: error initializing udevd socketerror initializing netlink socket %s: error initializing netlink socket0 /.udev/uevent_seqnum%s: fork of daemon failed: %s/dev/null%s: error opening /dev/null: %s/proc/self/oom_adj%s: error disabling OOM: %s-17%s: error getting pipes: %s%s: error fcntl on read pipe: %s%s: error fcntl on write pipe: %s%s: the kernel does not support inotify, udevd can't monitor configuration file changes%s: inotify_init failed: %sUDEVD_MAX_CHILDS%s: initialize max_childs to %uUDEVD_MAX_CHILDS_RUNNING%s: initialize max_childs_running to %uUDEV_LOG=%i%s: error in select: %s%s: unable to receive user udevd message: %s%s: no sender credentials received, message ignored%s: sender uid=%i, message ignoredudevd_100%s: message magic '%s' doesn't match, ignore it%s: udevd message (STOP_EXEC_QUEUE) received%s: udevd message (START_EXEC_QUEUE) received%s: udevd message (SET_LOG_PRIORITY) received, udev_log_priority=%i%s: udevd message (UDEVD_SET_MAX_CHILDS) received, max_childs=%i%s: udevd message (UDEVD_SET_MAX_CHILDS_RUNNING) received, max_childs=%i%s: udevd message (RELOAD_RULES) received%s: unknown control message type%s: unable to receive kernel netlink message: %sACTION=SUBSYSTEM=SEQNUM=PHYSDEVPATH=PHYSDEVDRIVER=MAJOR=MINOR=TIMEOUT=UDEV3<߿D_EVENT=1%s: DEVPATH or ACTION missing, ignore message%s: invalid uevent '%s'%s: no ACTION in payload found, skip event '%s'%s: ACTION in payload does not match uevent, skip event '%s'%llu %s: error getting buffer for inotify, disable watching%s: seq %llu, pid [%d] exit with %i, %ld seconds old/kernel/uevent_seqnumudev_device_eventrename_netif%u:%uchange%s: device event will be ignored%s: device node creation supressed%s: device '%s' already in database, validate currently present symlinksnet%s: changing net interface name from '%s' to '%s'%s: error opening socket: %s%s: error changing netif name %s to %s: %s_rename%s: error changing net interface name %s to %s: %s%s: renamed netif to '%s'INTERFACE_OLDDEVPATHINTERFACEparse_config_file%s: can't open '%s' as config file: %s%s: line too long, conf line skipped %s, line %dudev_rootudev_rulesudev_log%s: error parsing %s, line %d:%d/dev/etc/udev/udev.conf/etc/udev/rules.dUDEV_RUNUDEV_CONFIG_FILEUDEV_ROOTUDEV_LOGudev_node_remove_symlinksudev_node_removeudev_node_mknodudev_node_addudev_node_symlink%s/%s%s: symlink '%s' points to a different device, skip removal%s: removing symlink '%s'DEVLINKS%s: device node '%s' points to a different device, skip removal%s: removing device node '%s'DEVNAME%s: removing all_partitions '%s[1-%i]'%s: garbage from udev database, skip all_partitions removal%s%d%s: preserve file '%s', because it has correct dev_t%s: unlink(%s) failed: %s%s: mknod(%s, %#o, %u, %u) failed: %s%s: chmod(%s, %#o) failed: %s%s: chown(%s, %u, %u) failed: %s%s: creating device node '%s', major = '%d', minor = '%d', mode = '%#o', uid = '%d', gid = '%d'range%s: creating device partition nodes '%s[1-%i]'../%s: creating symlink '%s' to '%s'%s: preserving symlink '%s' to '%s'%s: link '%s' points to different target '%s', delete it%s: symlink(%s, %s) failed: %sudev_db_get_all_entriesudev_db_lookup_nameudev_db_add_deviceudev_db_get_device/.udev/db%s: no udev_db available '%s':0<߿ %s%s: unable to read %s: %s%s: found a symlink as db file%s: error reading db link %s: %s%s: unable to read db file '%s': %s%s: unable to create db link '%s': %sw%s: unable to create db file '%s': %sN:%s S:%s M:%u:%u A:%u R:%u E:%s %s: no db file to read %s: %s%s: error reading db file %s: %s/class//block//devices//bus/subsystem/driver/bus//drivers/drivers/module/module/devices/block/class/deviceSYSFS_PATH/sysimport_keys_into_env5p5n5k5b5M5m5c~3s5s6P 6N m+r 6E get_format_lenget_format_attributeudev_rules_apply_formatwait_for_sysfsmatch_ruleimport_file_into_envudev_rules_get_runudev_rules_get_name%s: format parsing error '%s'%s: missing closing brace for format%s: missing file parameter for attr%s: %i untrusted character(s) replaced%s/.tmp-%u-%u%s: unknown substitution type=%iACTIONKERNELSUBSYSTEMDRIVERENV%s: file '%s' appeared after %i loops%s: device disappeared while waiting for '%s'%s: wait for '%s' for %i mseconds%s: waiting for '%s' failedATTRKERNELSSUBSYSTEMSDRIVERSATTRSRESULT%s: can't open '%s': %s%s: error writing ATTR{%s}: %s%s: error opening ATTR{%s} for writing: %s%s: rule applied, '%s' is ignored%s: reset run list%s: reset symlink list%s: add symlink '%s'%s: rule applied, '%s' becomes '%s'%s: no node name set, will use kernel name '%s'devpathnumberkernelidmajorminorresultsysfsparenttempnodeenvget_key_attributeadd_rule_key_pairparse_fileadd_to_rulesudev_rules_init%s: skip, too many keys of the same type in a single rule%s: can't open '%s' as rules file: %s%s: line too long, rule skipped '%s:%u'%s: malloc failed%s: invalid ACTION operation%s: invalid DEVPATH operation%s: invalid KERNEL operation%s: invalid SUBSYSTEM operation%s: invalid DRIVER operation%s: DRIVER== will change in a future relase, please use DRIVERS== in %s:%uATTR{%s: error parsing AT%<߿ TR attributeID%s: invalid KERNELS operationBUS%s: invalid SUBSYSTEMS operation%s: invalid DRIVERS operationATTRS{SYSFS{%s: error parsing ATTRS attributeENV{%s: error parsing ENV attributePROGRAM%s: invalid RESULT operationIMPORTprogram/lib/udev/WAIT_FOR_SYSFSLABELGOTOall_partitionsignore_removeSYMLINKOWNERGROUPMODEOPTIONSlast_ruleignore_device%s: unknown key '%s' in %s:%u%s: realloc failed%s: invalid rule '%s:%u'.rules%s: could not read '%s': %slookup_grouplookup_useradd_matching_files%s: specified group unknown '%s'%s: error resolving group '%s': %s%s: specified user unknown '%s'%s: error resolving user '%s': %s%s=%s%s: unable to open '%s': %serrdebug #$%+-./:=?@_,trueyesunlink_securedelete_path%s: chown(%s, 0, 0) failed: %s%s: chmod(%s, 0000) failed: %s%s: rmdir(%s) failed: %srun_programpass_env_to_socket%s: '%s'%s: pipe failed: %s%s: open /dev/null failed: %s%s: exec of program '%s' failed%s: fork of '%s' failed: %s%s: stdin read failed: %s%s: ressize %ld too short%s: '%s' (stdout) '%s'%s: stderr read failed: %s%s: '%s' (stderr) '%s'%s: '%s' returned with status %i%s: '%s' abnormal exit%s@%s%s: passed %zi bytes to socket '%s', %<߿ 0  D  0  hhppA(aeabi5TE ,GCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (Hisilicon_v100(gcc4.4-290+uclibc_0.9.30.2+eabi+linuxpthread)) 4.4.1GCC: (GNU) 3.3.2 20031005 (Debian prerelease).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.init_array.fini_array.jcr.dynamic.got0<߿.data.bss.ARM.attributes.comment < DD! ) 2 00;6 dAlGM Uamr  {|XX<pp)<<߿dnsdomainnameH9Y8Y8YbusyboxLinkLocalIPH9YH9YH9Y@ ELF(44 (444HHHHHtTTTQtd/lib/ld-uClibc.so.0%,+"$ & '#)(*%   !O/ a"̇؇6. @,!P 8DPp\;htEWk-ȈwԈ'5fmemcpyabortmemsetlibc.so.0srandomstderrfprintfputsforkbindinet_atonputcharinet_ntoarecvexitpollmemcmpsprintfwaitpidtimeioctl__uClibc_mainsystemsendtosetenvperrorstrcmpsocketstrncpydaemonexeclgettimeofday__data_startfwrite_edata__bss_start__bss_start____bss_end____end___end$048<@DHL P T X \`dhlptx| "#%&)* -L-夑Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ|Ə ʌtƏ ʌlƏ ʌdƏ ʌ\Ə <߿ ʌTƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0<`90@ R  /P@@-0S00@S3/8@-)I @@@X 0 @d @U x 0 0@P@ ( 0@ 0C @ P% @ @xX 0+ @  @m @ h@-@H -!HA 7a,á$8# ,̀!40@-@PMPp` WP  P \Ѝ @&i)9 @0@8 @ 0(\( @W @ %V 9 @  0 @?E-TMP@`p<  06 2L @0̠ *2&@' 0 p400 t&< 0PTЍX @O-`MME,a0y[p@0} PU )JP@ `@``@[h @ P l @P[A  &P P䐍  䠍蠍~ ' SP IYD 0@ '&)!( < ,P ,L4 㰒 0@  0 $IL @@@0 y < 0YPd4.p R $ Ă|Q,1^ I$ gP K RL HI/ ,0 Ȑ5PU `P@``@  @iP @_ @o @  @(J(,: 0@( @( @kQ@$ @p:0 @ 0   -L%s: %s Usage: %s [OPTIONS -q quit after obtaining address -f do not fork a daemon -n exit with failure if no address can be obtained -i network interface (default %s) eth0 -I network interface alias -s